Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|6005
Gene name
LocationContig_50:67238..68033
Strand-
Gene length (bp)795
Transcript length (bp)738
Coding sequence length (bp)738
Protein length (aa) 246

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13419 HAD_2 Haloacid dehalogenase-like hydrolase 1.2E-22 7 201
PF00702 Hydrolase haloacid dehalogenase-like hydrolase 5.7E-07 4 190
PF03031 NIF NLI interacting factor-like phosphatase 1.2E-05 6 218

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P31467|YIEH_ECOLI 6-phosphogluconate phosphatase OS=Escherichia coli (strain K12) GN=yieH PE=1 SV=1 1 202 4.0E-12
sp|Q9X0Y1|P1254_THEMA Phosphorylated carbohydrates phosphatase TM_1254 OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=TM_1254 PE=1 SV=1 4 228 3.0E-10
sp|Q9ZVJ5|SGGP_ARATH Haloacid dehalogenase-like hydrolase domain-containing protein Sgpp OS=Arabidopsis thaliana GN=SGPP PE=1 SV=2 4 201 5.0E-08
sp|O33513|CBBY_RHOCA Protein CbbY OS=Rhodobacter capsulatus GN=cbbY PE=3 SV=1 3 200 9.0E-08
sp|Q680K2|GPPL1_ARATH Haloacid dehalogenase-like hydrolase domain-containing protein At4g39970 OS=Arabidopsis thaliana GN=At4g39970 PE=2 SV=1 7 224 8.0E-07
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P31467|YIEH_ECOLI 6-phosphogluconate phosphatase OS=Escherichia coli (strain K12) GN=yieH PE=1 SV=1 1 202 4.0E-12
sp|Q9X0Y1|P1254_THEMA Phosphorylated carbohydrates phosphatase TM_1254 OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=TM_1254 PE=1 SV=1 4 228 3.0E-10
sp|Q9ZVJ5|SGGP_ARATH Haloacid dehalogenase-like hydrolase domain-containing protein Sgpp OS=Arabidopsis thaliana GN=SGPP PE=1 SV=2 4 201 5.0E-08
sp|O33513|CBBY_RHOCA Protein CbbY OS=Rhodobacter capsulatus GN=cbbY PE=3 SV=1 3 200 9.0E-08
sp|Q680K2|GPPL1_ARATH Haloacid dehalogenase-like hydrolase domain-containing protein At4g39970 OS=Arabidopsis thaliana GN=At4g39970 PE=2 SV=1 7 224 8.0E-07
sp|Q9JMQ2|PPAX_BACSU Pyrophosphatase PpaX OS=Bacillus subtilis (strain 168) GN=ppaX PE=1 SV=1 3 201 2.0E-06
[Show less]

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup471
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|2267
Ophiocordyceps australis map64 (Brazil) OphauB2|6005 (this protein)
Ophiocordyceps camponoti-floridani Ophcf2|06791
Ophiocordyceps camponoti-rufipedis Ophun1|6209
Ophiocordyceps kimflemingae Ophio5|6811
Ophiocordyceps subramaniannii Hirsu2|10371
Ophiocordyceps subramaniannii Hirsu2|3539
Ophiocordyceps subramaniannii Hirsu2|5668

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|6005
MPQITTLLFDCDNTLVLSEELAFEACAGLINEICEKRNLDKRFTGESLIQEFVGQNFRGMLTSLQKEYGIDIVPD
DLERYVRMEEDAVIAKLKASLRPCVGVDEQLEELAASNKYLMAVVSSSALRRVRASVEKVGQDKYFAGDVIFSAA
TSLDKPTSKPDPAIYLHALKKLGRTAQESVAIEDSKSGTLSGTRAGIKVVGYVGPYADNKKAEMEKVLRDAGAVI
IMRDWSEFPACLKKIEAGEV*
Coding >OphauB2|6005
ATGCCTCAGATTACGACGCTCCTCTTTGACTGTGACAACACGCTTGTCCTGTCGGAGGAGCTGGCGTTTGAGGCT
TGTGCCGGCCTCATCAATGAGATTTGCGAGAAGCGAAACCTGGATAAACGCTTCACGGGCGAGTCGCTCATTCAG
GAGTTTGTCGGCCAAAACTTTCGCGGCATGCTCACCTCGCTGCAAAAGGAGTATGGCATCGACATTGTCCCCGAT
GACTTGGAACGCTACGTGCGCATGGAGGAGGATGCCGTGATTGCAAAGCTCAAGGCTTCGCTGCGCCCGTGTGTC
GGTGTCGATGAGCAGCTGGAAGAGCTGGCGGCGTCCAACAAGTATTTGATGGCGGTTGTGTCGTCGTCGGCTCTG
CGCCGTGTCCGTGCTTCGGTGGAAAAGGTGGGCCAGGACAAGTACTTTGCCGGCGATGTCATCTTCTCGGCCGCC
ACTAGTCTGGACAAGCCCACGAGCAAGCCCGACCCCGCCATTTACCTGCACGCCCTCAAGAAGCTGGGCCGCACG
GCACAGGAGAGCGTTGCCATTGAGGACAGCAAGAGTGGCACTCTTAGCGGCACTCGGGCCGGCATCAAGGTTGTT
GGCTACGTTGGTCCTTATGCCGACAACAAAAAGGCCGAGATGGAAAAGGTGCTCAGGGACGCTGGCGCCGTCATC
ATCATGCGTGACTGGTCCGAGTTTCCTGCCTGCCTGAAAAAGATTGAGGCTGGCGAGGTCTAG
Transcript >OphauB2|6005
ATGCCTCAGATTACGACGCTCCTCTTTGACTGTGACAACACGCTTGTCCTGTCGGAGGAGCTGGCGTTTGAGGCT
TGTGCCGGCCTCATCAATGAGATTTGCGAGAAGCGAAACCTGGATAAACGCTTCACGGGCGAGTCGCTCATTCAG
GAGTTTGTCGGCCAAAACTTTCGCGGCATGCTCACCTCGCTGCAAAAGGAGTATGGCATCGACATTGTCCCCGAT
GACTTGGAACGCTACGTGCGCATGGAGGAGGATGCCGTGATTGCAAAGCTCAAGGCTTCGCTGCGCCCGTGTGTC
GGTGTCGATGAGCAGCTGGAAGAGCTGGCGGCGTCCAACAAGTATTTGATGGCGGTTGTGTCGTCGTCGGCTCTG
CGCCGTGTCCGTGCTTCGGTGGAAAAGGTGGGCCAGGACAAGTACTTTGCCGGCGATGTCATCTTCTCGGCCGCC
ACTAGTCTGGACAAGCCCACGAGCAAGCCCGACCCCGCCATTTACCTGCACGCCCTCAAGAAGCTGGGCCGCACG
GCACAGGAGAGCGTTGCCATTGAGGACAGCAAGAGTGGCACTCTTAGCGGCACTCGGGCCGGCATCAAGGTTGTT
GGCTACGTTGGTCCTTATGCCGACAACAAAAAGGCCGAGATGGAAAAGGTGCTCAGGGACGCTGGCGCCGTCATC
ATCATGCGTGACTGGTCCGAGTTTCCTGCCTGCCTGAAAAAGATTGAGGCTGGCGAGGTCTAG
Gene >OphauB2|6005
ATGCCTCAGGTATGGAGCCTCTGACCTGATTCCCCCGGGCGGCAGCGACGCAACTAACACGACAAGATTACGACG
CTCCTCTTTGACTGTGACAACACGCTTGTCCTGTCGGAGGAGCTGGCGTTTGAGGCTTGTGCCGGCCTCATCAAT
GAGATTTGCGAGAAGCGAAACCTGGATAAACGCTTCACGGGCGAGTCGCTCATTCAGGAGTTTGTCGGCCAAAAC
TTTCGCGGCATGCTCACCTCGCTGCAAAAGGAGTATGGCATCGACATTGTCCCCGATGACTTGGAACGCTACGTG
CGCATGGAGGAGGATGCCGTGATTGCAAAGCTCAAGGCTTCGCTGCGCCCGTGTGTCGGTGTCGATGAGCAGCTG
GAAGAGCTGGCGGCGTCCAACAAGTATTTGATGGCGGTTGTGTCGTCGTCGGCTCTGCGCCGTGTCCGTGCTTCG
GTGGAAAAGGTGGGCCAGGACAAGTACTTTGCCGGCGATGTCATCTTCTCGGCCGCCACTAGTCTGGACAAGCCC
ACGAGCAAGCCCGACCCCGCCATTTACCTGCACGCCCTCAAGAAGCTGGGCCGCACGGCACAGGAGAGCGTTGCC
ATTGAGGACAGCAAGAGTGGCACTCTTAGCGGCACTCGGGCCGGCATCAAGGTTGTTGGCTACGTTGGTCCTTAT
GCCGACAACAAAAAGGCCGAGATGGAAAAGGTGCTCAGGGACGCTGGCGCCGTCATCATCATGCGTGACTGGTCC
GAGTTTCCTGCCTGCCTGAAAAAGATTGAGGCTGGCGAGGTCTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail