Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|5993
Gene name
LocationContig_50:32524..33902
Strand+
Gene length (bp)1378
Transcript length (bp)1182
Coding sequence length (bp)1182
Protein length (aa) 394

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13230 GATase_4 Glutamine amidotransferases class-II 7.8E-14 38 167
PF13522 GATase_6 Glutamine amidotransferase domain 2.5E-07 85 166

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P53871|DUG3_YEAST Probable glutamine amidotransferase DUG3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DUG3 PE=1 SV=1 1 350 2.0E-108
sp|P54004|Y199_SYNY3 Putative glutamine amidotransferase slr0199 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=slr0199 PE=3 SV=1 1 310 4.0E-30
sp|O69670|EGTC_MYCTU Gamma-glutamyl-hercynylcysteine sulfoxide hydrolase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=egtC PE=1 SV=1 1 121 2.0E-11
sp|A0R5M9|EGTC_MYCS2 Gamma-glutamyl-hercynylcysteine sulfoxide hydrolase OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=egtC PE=1 SV=1 1 309 3.0E-10

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup1570
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|2279
Ophiocordyceps australis map64 (Brazil) OphauB2|5993 (this protein)
Ophiocordyceps camponoti-floridani Ophcf2|06779
Ophiocordyceps camponoti-rufipedis Ophun1|5908
Ophiocordyceps kimflemingae Ophio5|2619
Ophiocordyceps subramaniannii Hirsu2|1163

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|5993
MCRFLVYKGSEEILLSKLILDPAHSILKQSFDSRLRLDTRRGQNNADGFGIGFYTDAKLGSAPCLFTSTTPAWNC
TNLQRIASKTASRLIFGHVRATTEGSLSEDNCHPFTHGSLMWMHNGNLGGWKYIKRRLADRLADKWYLGVKGGTD
SEWAFALFLDTLQRLGYDASSCPETGFGPTVLRKAMEQTIAQINDLTDSIPHDVVQAEDVDTRSLLNFAVTDGHS
VICTRYVSSSKDEAASLYYSSGTQWVTRTAAPDDRRFQMERKDKGADIVLVASEPLTFERENWVNVPTNSMLTIH
KQTVMVHPILDKYYERDPCHIRSSAFVQTKGLVSNEKVPSGPESPANEPPQAGFDGFRRMLAVQSVCSQSTSPDL
WKRSLTPVSLKEANLSPR*
Coding >OphauB2|5993
ATGTGCCGGTTTCTGGTGTATAAAGGCAGTGAAGAGATACTTCTATCAAAGCTAATTTTGGACCCGGCACATTCA
ATCCTGAAGCAGTCATTTGATTCCAGACTTCGCCTGGACACTCGGCGTGGCCAAAACAACGCCGACGGCTTCGGC
ATAGGCTTCTACACCGACGCCAAACTCGGCTCTGCCCCTTGTCTCTTCACATCCACCACTCCAGCCTGGAACTGT
ACCAACCTGCAGCGCATAGCGTCAAAGACGGCCTCGCGCCTCATTTTTGGCCACGTGCGCGCCACTACTGAGGGC
TCACTTAGCGAGGATAATTGCCATCCCTTTACCCATGGAAGCCTCATGTGGATGCACAATGGCAACCTTGGCGGC
TGGAAATACATCAAGAGACGCCTAGCAGATCGCCTGGCTGACAAGTGGTACCTGGGCGTCAAGGGCGGCACTGAT
AGCGAATGGGCCTTTGCCCTCTTCCTCGACACCCTCCAGCGCCTGGGATACGATGCAAGCTCGTGTCCGGAAACG
GGGTTTGGGCCAACTGTGCTCCGCAAGGCCATGGAGCAGACGATTGCGCAAATCAATGACTTGACCGACTCGATT
CCACACGACGTTGTCCAAGCCGAAGATGTGGACACGCGAAGCTTACTCAACTTTGCCGTGACTGATGGCCACAGT
GTCATTTGTACTAGATACGTTAGTAGCTCCAAGGATGAGGCTGCGAGCTTGTACTACTCGTCTGGGACCCAGTGG
GTTACGAGAACGGCAGCACCGGACGATAGGCGCTTTCAGATGGAGCGCAAAGACAAGGGCGCCGACATTGTTCTC
GTTGCTAGCGAACCTCTCACGTTTGAGCGGGAAAACTGGGTTAATGTGCCCACAAACTCTATGTTGACCATTCAC
AAACAGACGGTCATGGTACATCCCATTCTCGACAAATACTATGAGCGAGATCCCTGCCACATTCGCTCGAGTGCT
TTTGTGCAGACAAAGGGGCTAGTGTCGAATGAAAAGGTGCCCAGCGGTCCCGAGAGCCCGGCAAACGAGCCCCCA
CAGGCTGGCTTTGATGGTTTCAGGAGAATGCTAGCAGTGCAGTCGGTGTGTTCCCAGAGCACCAGCCCTGACCTC
TGGAAACGATCCTTGACCCCCGTGTCGTTGAAGGAGGCAAATTTGTCACCTCGCTGA
Transcript >OphauB2|5993
ATGTGCCGGTTTCTGGTGTATAAAGGCAGTGAAGAGATACTTCTATCAAAGCTAATTTTGGACCCGGCACATTCA
ATCCTGAAGCAGTCATTTGATTCCAGACTTCGCCTGGACACTCGGCGTGGCCAAAACAACGCCGACGGCTTCGGC
ATAGGCTTCTACACCGACGCCAAACTCGGCTCTGCCCCTTGTCTCTTCACATCCACCACTCCAGCCTGGAACTGT
ACCAACCTGCAGCGCATAGCGTCAAAGACGGCCTCGCGCCTCATTTTTGGCCACGTGCGCGCCACTACTGAGGGC
TCACTTAGCGAGGATAATTGCCATCCCTTTACCCATGGAAGCCTCATGTGGATGCACAATGGCAACCTTGGCGGC
TGGAAATACATCAAGAGACGCCTAGCAGATCGCCTGGCTGACAAGTGGTACCTGGGCGTCAAGGGCGGCACTGAT
AGCGAATGGGCCTTTGCCCTCTTCCTCGACACCCTCCAGCGCCTGGGATACGATGCAAGCTCGTGTCCGGAAACG
GGGTTTGGGCCAACTGTGCTCCGCAAGGCCATGGAGCAGACGATTGCGCAAATCAATGACTTGACCGACTCGATT
CCACACGACGTTGTCCAAGCCGAAGATGTGGACACGCGAAGCTTACTCAACTTTGCCGTGACTGATGGCCACAGT
GTCATTTGTACTAGATACGTTAGTAGCTCCAAGGATGAGGCTGCGAGCTTGTACTACTCGTCTGGGACCCAGTGG
GTTACGAGAACGGCAGCACCGGACGATAGGCGCTTTCAGATGGAGCGCAAAGACAAGGGCGCCGACATTGTTCTC
GTTGCTAGCGAACCTCTCACGTTTGAGCGGGAAAACTGGGTTAATGTGCCCACAAACTCTATGTTGACCATTCAC
AAACAGACGGTCATGGTACATCCCATTCTCGACAAATACTATGAGCGAGATCCCTGCCACATTCGCTCGAGTGCT
TTTGTGCAGACAAAGGGGCTAGTGTCGAATGAAAAGGTGCCCAGCGGTCCCGAGAGCCCGGCAAACGAGCCCCCA
CAGGCTGGCTTTGATGGTTTCAGGAGAATGCTAGCAGTGCAGTCGGTGTGTTCCCAGAGCACCAGCCCTGACCTC
TGGAAACGATCCTTGACCCCCGTGTCGTTGAAGGAGGCAAATTTGTCACCTCGCTGA
Gene >OphauB2|5993
ATGTGCCGGTTTCTGGTTTGTGCCCGTTTCCGAAGCCGGTTTACGTTGAAAGCTCATCATGTACTCGCCCCCAGG
TGTATAAAGGCAGTGAAGAGATACTTCTATCAAAGCTAATTTTGGACCCGGCACATTCAATCCTGAAGCAGTCAT
TTGATTCCAGACTTCGCCTGGTGGGTACATCCGTCTGCTCCGTTTTTGTTGCACCGGCGACGCTTGTCCAGTGGC
TCAATTGGTTTGCTTGTCAGGACACTCGGCGTGGCCAAAACAACGCCGACGGCTTCGGCATAGGCTTCTACACCG
ACGCCAAACTCGGCTCTGCCCCTTGTCTCTTCACATCCACCACTCCAGCCTGGAACTGTACCAACCTGCAGCGCA
TAGCGTCAAAGACGGCCTCGCGCCTCATTTTTGGCCACGTGCGCGCCACTACTGAGGGCTCACTTAGCGAGGATA
ATTGCCATCCCTTTACCCATGGAAGCCTCATGTGGATGCACAATGGCAACCTTGGCGGCTGGAAATACATCAAGA
GACGCCTAGCAGATCGCCTGGCTGACAAGTGGTACCTGGGCGTCAAGGGCGGCACTGATAGCGAATGGGCCTTTG
CCCTCTTCCTCGACACCCTCCAGCGCCTGGGATACGATGCAAGCTCGTGTCCGGAAACGGGGTTTGGGCCAACTG
TGCTCCGCAAGGCCATGGAGCAGACGATTGCGCAAATCAATGACTTGACCGACTCGATTCCACACGACGTTGTCC
AAGCCGAAGATGTGGACACGCGAAGCTTACTCAACTTTGCCGTGACTGATGGCCACAGTGTCATTTGTACTAGAT
ACGTTAGTAGCTCCAAGGATGAGGCTGCGAGCTTGTACTACTCGTCTGGGACCCAGTGGGTTACGAGAACGGCAG
CACCGGACGATAGGCGCTTTCAGATGGAGCGCAAAGACAAGGGCGCCGACATTGTTCTCGTTGCTAGCGAACCTC
TCACGTTTGAGCGGGGTAAGAGGCCCGTCCCGTTTATCCAACGTTTACAAATCACGAAATGACTGACGACGCACC
AGAAAACTGGGTTAATGTGCCCACAAACTCTATGTTGACCATTCACAAACAGACGGTCATGGTACATCCCATTCT
CGACAAATACTATGAGCGAGATCCCTGCCACATTCGCTCGAGTGCTTTTGTGCAGACAAAGGGGCTAGTGTCGAA
TGAAAAGGTGCCCAGCGGTCCCGAGAGCCCGGCAAACGAGCCCCCACAGGCTGGCTTTGATGGTTTCAGGAGAAT
GCTAGCAGTGCAGTCGGTGTGTTCCCAGAGCACCAGCCCTGACCTCTGGAAACGATCCTTGACCCCCGTGTCGTT
GAAGGAGGCAAATTTGTCACCTCGCTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail