Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|5992
Gene name
LocationContig_50:29166..31527
Strand-
Gene length (bp)2361
Transcript length (bp)2247
Coding sequence length (bp)2247
Protein length (aa) 749

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00400 WD40 WD domain, G-beta repeat 1.0E-02 676 706

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q10990|CDT2_SCHPO Cell division cycle protein cdt2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cdt2 PE=1 SV=1 280 707 2.0E-28
sp|Q5ZJW8|DTL_CHICK Denticleless protein homolog OS=Gallus gallus GN=DTL PE=2 SV=1 292 732 1.0E-16
sp|Q6GPU3|DTLB_XENLA Denticleless protein homolog B OS=Xenopus laevis GN=dtl-b PE=2 SV=1 274 720 7.0E-16
sp|Q6P1W0|DTL_XENTR Denticleless protein homolog OS=Xenopus tropicalis GN=dtl PE=1 SV=1 292 720 1.0E-15
sp|Q5RHI5|DTL_DANRE Denticleless protein homolog OS=Danio rerio GN=dtl PE=2 SV=1 294 615 7.0E-15
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q10990|CDT2_SCHPO Cell division cycle protein cdt2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cdt2 PE=1 SV=1 280 707 2.0E-28
sp|Q5ZJW8|DTL_CHICK Denticleless protein homolog OS=Gallus gallus GN=DTL PE=2 SV=1 292 732 1.0E-16
sp|Q6GPU3|DTLB_XENLA Denticleless protein homolog B OS=Xenopus laevis GN=dtl-b PE=2 SV=1 274 720 7.0E-16
sp|Q6P1W0|DTL_XENTR Denticleless protein homolog OS=Xenopus tropicalis GN=dtl PE=1 SV=1 292 720 1.0E-15
sp|Q5RHI5|DTL_DANRE Denticleless protein homolog OS=Danio rerio GN=dtl PE=2 SV=1 294 615 7.0E-15
sp|Q24371|L2DTL_DROME Protein lethal(2)denticleless OS=Drosophila melanogaster GN=l(2)dtl PE=1 SV=2 269 614 1.0E-14
sp|Q3TLR7|DTL_MOUSE Denticleless protein homolog OS=Mus musculus GN=Dtl PE=1 SV=2 282 731 5.0E-14
sp|Q9NZJ0|DTL_HUMAN Denticleless protein homolog OS=Homo sapiens GN=DTL PE=1 SV=3 292 732 5.0E-14
sp|Q4V837|DTLA_XENLA Denticleless protein homolog A OS=Xenopus laevis GN=dtl-a PE=2 SV=1 292 615 5.0E-14
sp|Q8YTC2|Y2800_NOSS1 Uncharacterized WD repeat-containing protein alr2800 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr2800 PE=3 SV=1 327 485 2.0E-07
sp|Q00808|HETE1_PODAS Vegetative incompatibility protein HET-E-1 OS=Podospora anserina GN=HET-E1 PE=3 SV=1 305 541 8.0E-07
sp|P49695|PKWA_THECU Probable serine/threonine-protein kinase PkwA OS=Thermomonospora curvata GN=pkwA PE=3 SV=1 292 430 2.0E-06
sp|Q91WQ5|TAF5L_MOUSE TAF5-like RNA polymerase II p300/CBP-associated factor-associated factor 65 kDa subunit 5L OS=Mus musculus GN=Taf5l PE=2 SV=1 247 415 7.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0003674 molecular_function No
GO:0005488 binding No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup1571
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|2280
Ophiocordyceps australis map64 (Brazil) OphauB2|5992 (this protein)
Ophiocordyceps camponoti-floridani Ophcf2|06778
Ophiocordyceps camponoti-rufipedis Ophun1|5909
Ophiocordyceps kimflemingae Ophio5|2620
Ophiocordyceps subramaniannii Hirsu2|1164

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|5992
MQAGTASSSPTHQPPTSAANGQLLSPPRTNRRKETRVPSVTPRRFRRFFTPRSLQAAEPDGPARVTLGSLEPAAI
NRRLQSPASLADDDESLDGAIPSSPIERLTEPEPRHAKRRRHSRQQASPGPKRQRPAGLLFACPKNVSSSSTSLS
ASSLAIGEAQQPIATDHGQNNSLSNFFRTSRAAPQALLGKPFSPLQGQMPADSQGRSPLVEAYKPTPIRKLANRG
FHAHLLNREHGFSAFADQQHVAYPAADPRVETASFYSDSDDVCFCTPLGAPGRAFPFCLASCHSYPITAIGDDQG
FVRLFSTKKSSRGSGGDDKVLAHHQLHENVVMDLDFSPDDSRLASASSDRRGNIMDMTTQTIAVTLAGGHWDSLR
QVAFRPDGSSGNVIATSDRAGRVQIWDLRCSSLPSTCFSTLLHGGWRRDETLDVWPARTVNTIDNAHRRKTSCST
SLASITTLQWLPGHQSHLILTGSEANASIKLWDTRFIKPRRQAEDMPVSITAEPPTHQWRSYGITSMALSADALR
LYAVCKDSTVYAYSTAHLKLGSAPELSSGTMRHRPTAAEGLGPILGFRHDALRVSSFYVKCAVRPAINGQRELLA
VGSSESCAVLFPTDDRYVRNVWSQREHLPNNASNSAMTMTTTPSTPCTPSTSFSSSLMSSVPSPPISISRIGTAL
IRGHTREVTSLSWSCQGRLVSASDDFAVRHWQEDASCAHHLRQVGEFGGERHLSGWAEVGEDWDAAHDVADML*
Coding >OphauB2|5992
ATGCAGGCCGGGACTGCTTCATCAAGTCCGACTCACCAACCTCCCACCTCGGCAGCCAACGGTCAGCTTCTATCA
CCTCCGCGAACCAATCGACGCAAGGAGACCCGTGTACCATCCGTCACTCCCAGGCGTTTCCGCCGTTTTTTTACC
CCGCGGTCGCTTCAAGCAGCCGAACCAGATGGACCGGCCCGCGTAACCCTCGGCTCTCTCGAGCCTGCTGCCATC
AACAGACGCCTTCAGTCACCGGCTTCTCTCGCTGACGATGATGAAAGCTTGGATGGTGCGATTCCCTCATCGCCC
ATCGAGCGTCTGACAGAACCAGAGCCACGGCATGCCAAGAGACGGAGGCATAGTCGTCAGCAAGCGTCTCCTGGA
CCTAAACGACAGAGGCCTGCAGGCCTGCTCTTTGCCTGCCCCAAAAACGTGTCGAGCTCTTCCACTTCTCTGAGC
GCATCATCTCTAGCCATAGGTGAAGCGCAACAGCCCATTGCCACCGACCATGGGCAGAACAACTCCCTCAGCAAC
TTCTTCAGGACCAGTCGTGCCGCTCCACAGGCTTTGCTTGGAAAACCCTTTTCACCTCTGCAAGGCCAAATGCCT
GCAGATTCTCAAGGCCGGTCCCCGCTTGTTGAAGCATATAAACCGACTCCAATACGCAAACTTGCAAATCGCGGC
TTCCACGCGCACCTTCTAAACCGCGAACATGGCTTCTCGGCCTTTGCTGACCAACAACATGTCGCCTATCCAGCC
GCGGATCCCCGCGTCGAGACTGCTTCCTTCTACAGCGACAGCGACGATGTTTGCTTCTGTACGCCGCTGGGTGCT
CCCGGGCGAGCATTTCCCTTTTGTCTCGCTAGCTGTCACTCGTATCCCATCACCGCCATTGGCGACGACCAGGGC
TTTGTTCGCTTGTTTTCTACCAAAAAGTCTTCTCGAGGCAGCGGAGGCGACGACAAAGTCTTGGCCCACCACCAA
TTGCACGAAAATGTTGTTATGGACCTGGATTTTTCGCCCGATGACAGCCGCTTGGCAAGCGCCAGCAGCGACCGG
AGAGGAAATATCATGGACATGACAACTCAAACCATTGCCGTGACGCTGGCCGGGGGGCACTGGGACTCGCTGCGA
CAAGTGGCATTCAGGCCTGACGGGAGCAGCGGTAATGTTATTGCCACGTCGGATAGGGCGGGCCGCGTGCAGATC
TGGGACTTGCGGTGCTCGTCGCTTCCATCCACTTGCTTCTCTACACTTCTTCACGGCGGTTGGCGTCGCGATGAG
ACTCTGGATGTCTGGCCCGCCAGGACGGTCAACACTATAGACAATGCTCATCGCCGCAAGACGTCTTGCAGCACC
TCGCTGGCGTCCATCACCACCCTTCAATGGCTTCCAGGTCACCAAAGCCATTTGATCCTTACGGGCTCAGAAGCA
AATGCGTCCATCAAGCTCTGGGATACGCGCTTCATTAAGCCGCGCCGCCAGGCTGAAGATATGCCCGTCTCCATC
ACGGCCGAGCCCCCTACCCACCAATGGCGCTCCTACGGAATCACGTCGATGGCTCTCAGCGCCGATGCCCTGCGT
CTTTATGCTGTGTGCAAGGACAGCACCGTCTACGCATACTCAACTGCTCATCTCAAGCTTGGGTCAGCTCCAGAG
CTCTCCTCTGGCACGATGCGGCATCGGCCCACTGCCGCAGAGGGGCTCGGTCCAATTCTCGGATTTAGACACGAC
GCCCTGCGCGTCTCATCATTTTATGTCAAGTGTGCCGTGCGGCCAGCCATCAATGGACAACGAGAGCTCTTGGCT
GTGGGCAGCTCCGAATCATGTGCCGTGCTCTTCCCAACCGACGATAGATACGTCCGCAATGTCTGGTCTCAGCGG
GAACACTTGCCCAATAATGCCTCGAATTCGGCTATGACGATGACGACGACGCCTTCAACGCCCTGCACGCCATCC
ACTTCCTTCTCCTCTAGCTTGATGTCCAGTGTTCCATCACCGCCCATATCCATCTCCCGCATCGGCACTGCTTTA
ATCCGCGGCCATACTCGAGAGGTGACTTCGCTCAGCTGGTCATGCCAGGGCCGCCTTGTCAGCGCATCTGATGAC
TTTGCTGTTCGCCACTGGCAGGAAGACGCTTCTTGTGCGCATCATCTTCGCCAAGTGGGCGAGTTCGGGGGCGAG
CGCCATCTTTCAGGCTGGGCTGAAGTTGGAGAAGATTGGGACGCCGCTCACGATGTTGCTGACATGCTTTGA
Transcript >OphauB2|5992
ATGCAGGCCGGGACTGCTTCATCAAGTCCGACTCACCAACCTCCCACCTCGGCAGCCAACGGTCAGCTTCTATCA
CCTCCGCGAACCAATCGACGCAAGGAGACCCGTGTACCATCCGTCACTCCCAGGCGTTTCCGCCGTTTTTTTACC
CCGCGGTCGCTTCAAGCAGCCGAACCAGATGGACCGGCCCGCGTAACCCTCGGCTCTCTCGAGCCTGCTGCCATC
AACAGACGCCTTCAGTCACCGGCTTCTCTCGCTGACGATGATGAAAGCTTGGATGGTGCGATTCCCTCATCGCCC
ATCGAGCGTCTGACAGAACCAGAGCCACGGCATGCCAAGAGACGGAGGCATAGTCGTCAGCAAGCGTCTCCTGGA
CCTAAACGACAGAGGCCTGCAGGCCTGCTCTTTGCCTGCCCCAAAAACGTGTCGAGCTCTTCCACTTCTCTGAGC
GCATCATCTCTAGCCATAGGTGAAGCGCAACAGCCCATTGCCACCGACCATGGGCAGAACAACTCCCTCAGCAAC
TTCTTCAGGACCAGTCGTGCCGCTCCACAGGCTTTGCTTGGAAAACCCTTTTCACCTCTGCAAGGCCAAATGCCT
GCAGATTCTCAAGGCCGGTCCCCGCTTGTTGAAGCATATAAACCGACTCCAATACGCAAACTTGCAAATCGCGGC
TTCCACGCGCACCTTCTAAACCGCGAACATGGCTTCTCGGCCTTTGCTGACCAACAACATGTCGCCTATCCAGCC
GCGGATCCCCGCGTCGAGACTGCTTCCTTCTACAGCGACAGCGACGATGTTTGCTTCTGTACGCCGCTGGGTGCT
CCCGGGCGAGCATTTCCCTTTTGTCTCGCTAGCTGTCACTCGTATCCCATCACCGCCATTGGCGACGACCAGGGC
TTTGTTCGCTTGTTTTCTACCAAAAAGTCTTCTCGAGGCAGCGGAGGCGACGACAAAGTCTTGGCCCACCACCAA
TTGCACGAAAATGTTGTTATGGACCTGGATTTTTCGCCCGATGACAGCCGCTTGGCAAGCGCCAGCAGCGACCGG
AGAGGAAATATCATGGACATGACAACTCAAACCATTGCCGTGACGCTGGCCGGGGGGCACTGGGACTCGCTGCGA
CAAGTGGCATTCAGGCCTGACGGGAGCAGCGGTAATGTTATTGCCACGTCGGATAGGGCGGGCCGCGTGCAGATC
TGGGACTTGCGGTGCTCGTCGCTTCCATCCACTTGCTTCTCTACACTTCTTCACGGCGGTTGGCGTCGCGATGAG
ACTCTGGATGTCTGGCCCGCCAGGACGGTCAACACTATAGACAATGCTCATCGCCGCAAGACGTCTTGCAGCACC
TCGCTGGCGTCCATCACCACCCTTCAATGGCTTCCAGGTCACCAAAGCCATTTGATCCTTACGGGCTCAGAAGCA
AATGCGTCCATCAAGCTCTGGGATACGCGCTTCATTAAGCCGCGCCGCCAGGCTGAAGATATGCCCGTCTCCATC
ACGGCCGAGCCCCCTACCCACCAATGGCGCTCCTACGGAATCACGTCGATGGCTCTCAGCGCCGATGCCCTGCGT
CTTTATGCTGTGTGCAAGGACAGCACCGTCTACGCATACTCAACTGCTCATCTCAAGCTTGGGTCAGCTCCAGAG
CTCTCCTCTGGCACGATGCGGCATCGGCCCACTGCCGCAGAGGGGCTCGGTCCAATTCTCGGATTTAGACACGAC
GCCCTGCGCGTCTCATCATTTTATGTCAAGTGTGCCGTGCGGCCAGCCATCAATGGACAACGAGAGCTCTTGGCT
GTGGGCAGCTCCGAATCATGTGCCGTGCTCTTCCCAACCGACGATAGATACGTCCGCAATGTCTGGTCTCAGCGG
GAACACTTGCCCAATAATGCCTCGAATTCGGCTATGACGATGACGACGACGCCTTCAACGCCCTGCACGCCATCC
ACTTCCTTCTCCTCTAGCTTGATGTCCAGTGTTCCATCACCGCCCATATCCATCTCCCGCATCGGCACTGCTTTA
ATCCGCGGCCATACTCGAGAGGTGACTTCGCTCAGCTGGTCATGCCAGGGCCGCCTTGTCAGCGCATCTGATGAC
TTTGCTGTTCGCCACTGGCAGGAAGACGCTTCTTGTGCGCATCATCTTCGCCAAGTGGGCGAGTTCGGGGGCGAG
CGCCATCTTTCAGGCTGGGCTGAAGTTGGAGAAGATTGGGACGCCGCTCACGATGTTGCTGACATGCTTTGA
Gene >OphauB2|5992
ATGCAGGCCGGGACTGCTTCATCAAGTCCGACTCACCAACCTCCCACCTCGGCAGCCAACGGTCAGCTTCTATCA
CCTCCGCGAACCAATCGACGCAAGGAGACCCGTGTACCATCCGTCACTCCCAGGCGTTTCCGCCGTTTTTTTACC
CCGCGGTCGCTTCAAGCAGCCGAACCAGATGGACCGGCCCGCGTAACCCTCGGCTCTCTCGAGCCTGCTGCCATC
AACAGACGCCTTCAGTCACCGGCTTCTCTCGCTGACGATGATGAAAGCTTGGATGGTGCGATTCCCTCATCGCCC
ATCGAGCGTCTGACAGAACCAGAGCCACGGCATGCCAAGAGACGGAGGCATAGTCGTCAGCAAGCGTCTCCTGGA
CCTAAACGACAGAGGCCTGCAGGCCTGCTCTTTGCCTGCCCCAAAAACGTGTCGAGCTCTTCCACTTCTCTGAGC
GCATCATCTCTAGCCATAGGTGAAGCGCAACAGCCCATTGCCACCGACCATGGGCAGAACAACTCCCTCGTGAGG
TCCCTTGCCTCTTGTGCTGGCGATAGGTATATCCTGCTCACACTTCTCAGAGCAACTTCTTCAGGACCAGTCGTG
CCGCTCCACAGGCTTTGCTTGGAAAACCCTTTTCACCTCTGCAAGGCCAAATGCCTGCAGATTCTCAAGGCCGGT
CCCCGGTAGGATGATTGGGCTTGGTGTTTGTACAACGCTCATGATGCTAATACATGGCGCCAGCTTGTTGAAGCA
TATAAACCGACTCCAATACGCAAACTTGCAAATCGCGGCTTCCACGCGCACCTTCTAAACCGCGAACATGGCTTC
TCGGCCTTTGCTGACCAACAACATGTCGCCTATCCAGCCGCGGATCCCCGCGTCGAGACTGCTTCCTTCTACAGC
GACAGCGACGATGTTTGCTTCTGTACGCCGCTGGGTGCTCCCGGGCGAGCATTTCCCTTTTGTCTCGCTAGCTGT
CACTCGTATCCCATCACCGCCATTGGCGACGACCAGGGCTTTGTTCGCTTGTTTTCTACCAAAAAGTCTTCTCGA
GGCAGCGGAGGCGACGACAAAGTCTTGGCCCACCACCAATTGCACGAAAATGTTGTTATGGACCTGGATTTTTCG
CCCGATGACAGCCGCTTGGCAAGCGCCAGCAGCGACCGGAGAGGAAATATCATGGACATGACAACTCAAACCATT
GCCGTGACGCTGGCCGGGGGGCACTGGGACTCGCTGCGACAAGTGGCATTCAGGCCTGACGGGAGCAGCGGTAAT
GTTATTGCCACGTCGGATAGGGCGGGCCGCGTGCAGATCTGGGACTTGCGGTGCTCGTCGCTTCCATCCACTTGC
TTCTCTACACTTCTTCACGGCGGTTGGCGTCGCGATGAGACTCTGGATGTCTGGCCCGCCAGGACGGTCAACACT
ATAGACAATGCTCATCGCCGCAAGACGTCTTGCAGCACCTCGCTGGCGTCCATCACCACCCTTCAATGGCTTCCA
GGTCACCAAAGCCATTTGATCCTTACGGGCTCAGAAGCAAATGCGTCCATCAAGCTCTGGGATACGCGCTTCATT
AAGCCGCGCCGCCAGGCTGAAGATATGCCCGTCTCCATCACGGCCGAGCCCCCTACCCACCAATGGCGCTCCTAC
GGAATCACGTCGATGGCTCTCAGCGCCGATGCCCTGCGTCTTTATGCTGTGTGCAAGGACAGCACCGTCTACGCA
TACTCAACTGCTCATCTCAAGCTTGGGTCAGCTCCAGAGCTCTCCTCTGGCACGATGCGGCATCGGCCCACTGCC
GCAGAGGGGCTCGGTCCAATTCTCGGATTTAGACACGACGCCCTGCGCGTCTCATCATTTTATGTCAAGTGTGCC
GTGCGGCCAGCCATCAATGGACAACGAGAGCTCTTGGCTGTGGGCAGCTCCGAATCATGTGCCGTGCTCTTCCCA
ACCGACGATAGATACGTCCGCAATGTCTGGTCTCAGCGGGAACACTTGCCCAATAATGCCTCGAATTCGGCTATG
ACGATGACGACGACGCCTTCAACGCCCTGCACGCCATCCACTTCCTTCTCCTCTAGCTTGATGTCCAGTGTTCCA
TCACCGCCCATATCCATCTCCCGCATCGGCACTGCTTTAATCCGCGGCCATACTCGAGAGGTGACTTCGCTCAGC
TGGTCATGCCAGGGCCGCCTTGTCAGCGCATCTGATGACTTTGCTGTTCGCCACTGGCAGGAAGACGCTTCTTGT
GCGCATCATCTTCGCCAAGTGGGCGAGTTCGGGGGCGAGCGCCATCTTTCAGGCTGGGCTGAAGTTGGAGAAGAT
TGGGACGCCGCTCACGATGTTGCTGACATGCTTTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail