Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|5991
Gene name
LocationContig_50:26091..27492
Strand-
Gene length (bp)1401
Transcript length (bp)1401
Coding sequence length (bp)1401
Protein length (aa) 467

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01126 Heme_oxygenase Heme oxygenase 1.2E-08 109 310

Swissprot hits

(None)

GO

GO Term Description Terminal node
GO:0004392 heme oxygenase (decyclizing) activity Yes
GO:0006788 heme oxidation Yes
GO:0003824 catalytic activity No
GO:0006725 cellular aromatic compound metabolic process No
GO:0008150 biological_process No
GO:0016712 oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen No
GO:0003674 molecular_function No
GO:0042168 heme metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:1901360 organic cyclic compound metabolic process No
GO:0033013 tetrapyrrole metabolic process No
GO:0046483 heterocycle metabolic process No
GO:0016705 oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen No
GO:0071704 organic substance metabolic process No
GO:0044237 cellular metabolic process No
GO:0004497 monooxygenase activity No
GO:0008152 metabolic process No
GO:0009987 cellular process No
GO:0016491 oxidoreductase activity No
GO:0042440 pigment metabolic process No
GO:0006778 porphyrin-containing compound metabolic process No
GO:1901564 organonitrogen compound metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 29 0.45

Transmembrane Domains

Domain # Start End Length
1 170 189 19
2 442 464 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|5991
MSACPFDSFKEDRPLADSIVAATRSVHAQLNKLVVARLPMALPPYASDPSLYLTGLLHIAPIYLAFEQAWKTIID
SPACQQDAHHGSQEQDVSDDQHLDEPRACPRVRALLSKLYTDRLMRSGNLRSDIAFLTRWPADVVDEELRSVSQT
GRVANTVHHIRRTCAQRPHVVIAYSYIMFMALFAGGRFIRATLESPGDKFWQSELSSLQSDNEGTRSKVNSQYQL
DITSAAASERGVSSTSTCFSTSPSMLQSNAKLPLSLFDFDSEMDGEDLKREFKKCLAESECELTTREKHDIVQES
VCIFENVIAIVGQLDIMCAATTKQGPPKRGKSILSLAGLLKNPLGIRFRDSVVITKERRDRSSSKRSEDHDPEFD
AQAVAMSTLTSDGHLHGNSAHNLCPASKAVRFQKAPPHARHSGSFFSPGCLQIVQTRFYGYHVGSWALAMALSII
MLGAIFAGGRVGFWGS*
Coding >OphauB2|5991
ATGTCGGCCTGCCCCTTCGACTCATTCAAAGAGGACCGTCCGCTGGCGGATTCCATCGTGGCCGCCACGCGATCT
GTCCATGCCCAGCTCAACAAGCTGGTTGTGGCTCGCTTGCCCATGGCGCTGCCTCCTTATGCTTCTGATCCTTCG
CTCTATCTTACTGGCTTACTGCACATTGCGCCCATATATCTAGCCTTTGAGCAAGCCTGGAAGACGATTATAGAC
TCGCCAGCTTGTCAGCAAGACGCCCACCACGGCTCTCAAGAGCAAGACGTGTCCGACGACCAGCACCTGGATGAG
CCGCGTGCCTGTCCTCGTGTCCGTGCGCTCCTCTCCAAGCTCTACACCGACAGGCTAATGCGCTCTGGCAACCTG
CGCTCCGACATTGCTTTCTTGACTCGCTGGCCCGCTGATGTTGTCGACGAGGAATTGCGTTCTGTCAGCCAGACA
GGTCGGGTCGCAAATACGGTCCATCATATCCGCCGCACATGTGCCCAACGACCGCATGTTGTCATAGCTTATTCA
TACATCATGTTCATGGCTCTTTTTGCTGGCGGCCGCTTCATTCGCGCTACCCTTGAGTCACCTGGTGACAAGTTT
TGGCAATCTGAGCTGTCATCTCTGCAGTCGGACAATGAAGGCACAAGGTCAAAGGTCAATTCTCAATACCAGCTT
GACATCACCTCTGCTGCAGCATCTGAGCGAGGCGTTTCTTCCACTTCGACTTGTTTTTCTACTTCGCCGTCAATG
CTCCAGAGCAACGCCAAATTGCCCCTGAGCTTGTTTGATTTCGACTCGGAGATGGACGGCGAGGACTTGAAGCGC
GAATTTAAGAAATGTCTGGCCGAATCGGAGTGCGAACTCACAACTCGCGAAAAGCACGACATTGTTCAAGAGTCG
GTGTGCATATTTGAAAATGTCATTGCAATTGTTGGCCAGCTCGACATCATGTGTGCGGCGACTACCAAACAGGGC
CCCCCAAAGAGAGGCAAGTCTATTCTGTCGCTTGCTGGCCTTCTCAAGAACCCACTGGGCATTCGCTTCAGGGAC
AGCGTCGTCATCACAAAGGAACGAAGGGACAGGAGCTCATCGAAGCGATCGGAAGATCACGACCCCGAATTCGAC
GCTCAAGCTGTGGCCATGTCGACACTTACCAGCGACGGACACCTGCATGGCAACTCTGCGCATAACCTTTGTCCC
GCGTCCAAGGCTGTCAGATTCCAAAAGGCACCACCTCATGCCAGACACAGTGGAAGCTTCTTTTCGCCGGGCTGT
TTACAAATTGTGCAGACACGCTTTTACGGCTACCATGTCGGCAGCTGGGCTCTTGCCATGGCCTTGAGCATCATC
ATGCTGGGTGCCATTTTTGCGGGCGGTCGTGTTGGTTTCTGGGGGAGCTGA
Transcript >OphauB2|5991
ATGTCGGCCTGCCCCTTCGACTCATTCAAAGAGGACCGTCCGCTGGCGGATTCCATCGTGGCCGCCACGCGATCT
GTCCATGCCCAGCTCAACAAGCTGGTTGTGGCTCGCTTGCCCATGGCGCTGCCTCCTTATGCTTCTGATCCTTCG
CTCTATCTTACTGGCTTACTGCACATTGCGCCCATATATCTAGCCTTTGAGCAAGCCTGGAAGACGATTATAGAC
TCGCCAGCTTGTCAGCAAGACGCCCACCACGGCTCTCAAGAGCAAGACGTGTCCGACGACCAGCACCTGGATGAG
CCGCGTGCCTGTCCTCGTGTCCGTGCGCTCCTCTCCAAGCTCTACACCGACAGGCTAATGCGCTCTGGCAACCTG
CGCTCCGACATTGCTTTCTTGACTCGCTGGCCCGCTGATGTTGTCGACGAGGAATTGCGTTCTGTCAGCCAGACA
GGTCGGGTCGCAAATACGGTCCATCATATCCGCCGCACATGTGCCCAACGACCGCATGTTGTCATAGCTTATTCA
TACATCATGTTCATGGCTCTTTTTGCTGGCGGCCGCTTCATTCGCGCTACCCTTGAGTCACCTGGTGACAAGTTT
TGGCAATCTGAGCTGTCATCTCTGCAGTCGGACAATGAAGGCACAAGGTCAAAGGTCAATTCTCAATACCAGCTT
GACATCACCTCTGCTGCAGCATCTGAGCGAGGCGTTTCTTCCACTTCGACTTGTTTTTCTACTTCGCCGTCAATG
CTCCAGAGCAACGCCAAATTGCCCCTGAGCTTGTTTGATTTCGACTCGGAGATGGACGGCGAGGACTTGAAGCGC
GAATTTAAGAAATGTCTGGCCGAATCGGAGTGCGAACTCACAACTCGCGAAAAGCACGACATTGTTCAAGAGTCG
GTGTGCATATTTGAAAATGTCATTGCAATTGTTGGCCAGCTCGACATCATGTGTGCGGCGACTACCAAACAGGGC
CCCCCAAAGAGAGGCAAGTCTATTCTGTCGCTTGCTGGCCTTCTCAAGAACCCACTGGGCATTCGCTTCAGGGAC
AGCGTCGTCATCACAAAGGAACGAAGGGACAGGAGCTCATCGAAGCGATCGGAAGATCACGACCCCGAATTCGAC
GCTCAAGCTGTGGCCATGTCGACACTTACCAGCGACGGACACCTGCATGGCAACTCTGCGCATAACCTTTGTCCC
GCGTCCAAGGCTGTCAGATTCCAAAAGGCACCACCTCATGCCAGACACAGTGGAAGCTTCTTTTCGCCGGGCTGT
TTACAAATTGTGCAGACACGCTTTTACGGCTACCATGTCGGCAGCTGGGCTCTTGCCATGGCCTTGAGCATCATC
ATGCTGGGTGCCATTTTTGCGGGCGGTCGTGTTGGTTTCTGGGGGAGCTGA
Gene >OphauB2|5991
ATGTCGGCCTGCCCCTTCGACTCATTCAAAGAGGACCGTCCGCTGGCGGATTCCATCGTGGCCGCCACGCGATCT
GTCCATGCCCAGCTCAACAAGCTGGTTGTGGCTCGCTTGCCCATGGCGCTGCCTCCTTATGCTTCTGATCCTTCG
CTCTATCTTACTGGCTTACTGCACATTGCGCCCATATATCTAGCCTTTGAGCAAGCCTGGAAGACGATTATAGAC
TCGCCAGCTTGTCAGCAAGACGCCCACCACGGCTCTCAAGAGCAAGACGTGTCCGACGACCAGCACCTGGATGAG
CCGCGTGCCTGTCCTCGTGTCCGTGCGCTCCTCTCCAAGCTCTACACCGACAGGCTAATGCGCTCTGGCAACCTG
CGCTCCGACATTGCTTTCTTGACTCGCTGGCCCGCTGATGTTGTCGACGAGGAATTGCGTTCTGTCAGCCAGACA
GGTCGGGTCGCAAATACGGTCCATCATATCCGCCGCACATGTGCCCAACGACCGCATGTTGTCATAGCTTATTCA
TACATCATGTTCATGGCTCTTTTTGCTGGCGGCCGCTTCATTCGCGCTACCCTTGAGTCACCTGGTGACAAGTTT
TGGCAATCTGAGCTGTCATCTCTGCAGTCGGACAATGAAGGCACAAGGTCAAAGGTCAATTCTCAATACCAGCTT
GACATCACCTCTGCTGCAGCATCTGAGCGAGGCGTTTCTTCCACTTCGACTTGTTTTTCTACTTCGCCGTCAATG
CTCCAGAGCAACGCCAAATTGCCCCTGAGCTTGTTTGATTTCGACTCGGAGATGGACGGCGAGGACTTGAAGCGC
GAATTTAAGAAATGTCTGGCCGAATCGGAGTGCGAACTCACAACTCGCGAAAAGCACGACATTGTTCAAGAGTCG
GTGTGCATATTTGAAAATGTCATTGCAATTGTTGGCCAGCTCGACATCATGTGTGCGGCGACTACCAAACAGGGC
CCCCCAAAGAGAGGCAAGTCTATTCTGTCGCTTGCTGGCCTTCTCAAGAACCCACTGGGCATTCGCTTCAGGGAC
AGCGTCGTCATCACAAAGGAACGAAGGGACAGGAGCTCATCGAAGCGATCGGAAGATCACGACCCCGAATTCGAC
GCTCAAGCTGTGGCCATGTCGACACTTACCAGCGACGGACACCTGCATGGCAACTCTGCGCATAACCTTTGTCCC
GCGTCCAAGGCTGTCAGATTCCAAAAGGCACCACCTCATGCCAGACACAGTGGAAGCTTCTTTTCGCCGGGCTGT
TTACAAATTGTGCAGACACGCTTTTACGGCTACCATGTCGGCAGCTGGGCTCTTGCCATGGCCTTGAGCATCATC
ATGCTGGGTGCCATTTTTGCGGGCGGTCGTGTTGGTTTCTGGGGGAGCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail