Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|5990
Gene name
LocationContig_50:24047..25691
Strand+
Gene length (bp)1644
Transcript length (bp)1392
Coding sequence length (bp)1392
Protein length (aa) 464

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00892 EamA EamA-like transporter family 1.6E-06 208 269
PF13127 DUF3955 Protein of unknown function (DUF3955) 9.5E-08 66 118

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q03730|YMB8_YEAST Uncharacterized vacuolar membrane protein YML018C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YML018C PE=1 SV=1 63 460 4.0E-74
sp|O94654|YGF3_SCHPO Uncharacterized transporter C405.03c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC405.03c PE=3 SV=1 63 439 4.0E-52
sp|Q5R6J3|S35F5_PONAB Solute carrier family 35 member F5 OS=Pongo abelii GN=SLC35F5 PE=2 SV=1 60 448 2.0E-50
sp|Q8R314|S35F5_MOUSE Solute carrier family 35 member F5 OS=Mus musculus GN=Slc35f5 PE=2 SV=1 63 448 7.0E-50
sp|Q8WV83|S35F5_HUMAN Solute carrier family 35 member F5 OS=Homo sapiens GN=SLC35F5 PE=2 SV=1 60 448 1.0E-49
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q03730|YMB8_YEAST Uncharacterized vacuolar membrane protein YML018C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YML018C PE=1 SV=1 63 460 4.0E-74
sp|O94654|YGF3_SCHPO Uncharacterized transporter C405.03c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC405.03c PE=3 SV=1 63 439 4.0E-52
sp|Q5R6J3|S35F5_PONAB Solute carrier family 35 member F5 OS=Pongo abelii GN=SLC35F5 PE=2 SV=1 60 448 2.0E-50
sp|Q8R314|S35F5_MOUSE Solute carrier family 35 member F5 OS=Mus musculus GN=Slc35f5 PE=2 SV=1 63 448 7.0E-50
sp|Q8WV83|S35F5_HUMAN Solute carrier family 35 member F5 OS=Homo sapiens GN=SLC35F5 PE=2 SV=1 60 448 1.0E-49
sp|A6QL92|S35F5_BOVIN Solute carrier family 35 member F5 OS=Bos taurus GN=SLC35F5 PE=2 SV=1 60 438 3.0E-49
sp|Q4R794|S35F5_MACFA Solute carrier family 35 member F5 OS=Macaca fascicularis GN=SLC35F5 PE=2 SV=1 190 457 4.0E-44
sp|Q04083|THI74_YEAST Thiamine-repressible mitochondrial transport protein THI74 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=THI74 PE=1 SV=1 78 452 5.0E-39
[Show less]

GO

GO Term Description Terminal node
GO:0016020 membrane Yes
GO:0016021 integral component of membrane Yes
GO:0110165 cellular anatomical entity No
GO:0031224 intrinsic component of membrane No
GO:0005575 cellular_component No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 45 0.45

Transmembrane Domains

Domain # Start End Length
1 66 88 22
2 98 120 22
3 254 272 18
4 287 309 22
5 326 348 22
6 380 402 22
7 414 433 19

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|5990
MKSPESQRSSDAADPRQRSAPAMHLDAASQSAMSLPSMPSSCSASSPGPFDKGNLAARLGLTRRALGICLLLVTV
CLWTVSNFLASFIFSDHTYNKPFFLVYINTSVFAFSLLPLFVKYLLNNGLRGLRSDVVHLWRDYKYNPSHMRLPA
SQSIQHVGPVDDDDDAMAPPSERLMVDDADSVACVLPEPRLGLAETAVLSLEFSMLWFLANYFASACLEHTSVAS
VTILTSTSSVWTLVFCSLFRVESFSLRKFLGVLASLAGVVFISTVDLTGESDENRGSFPHKTSGQIALGDSMALF
SAVIYGLYVTVMKRRVGNEDKVDMRLFFGLVGVFNLALLWPLFFILHWTGIEPFEMPPTGKIWTIIIVNSLSSFM
SDMSWAFSMLLTTPLVVTVGLSLSIPLSLVGEMIQYGQYSSFMYWIGATIVFVSFLFVNNESHDECHEHRPARDE
GPERIQTSAAAIV*
Coding >OphauB2|5990
ATGAAGTCGCCCGAGTCGCAACGGTCCAGCGATGCGGCCGACCCGAGGCAAAGGTCTGCTCCCGCCATGCACCTC
GACGCCGCCAGTCAATCCGCCATGAGCCTGCCGTCCATGCCTTCGTCTTGCTCTGCCTCTTCTCCCGGCCCCTTT
GACAAGGGAAACCTTGCCGCGCGCCTGGGCCTCACCCGGCGCGCCTTGGGCATCTGCCTCTTGCTCGTTACTGTT
TGCCTTTGGACAGTGTCCAACTTTTTGGCTAGTTTCATCTTTTCCGATCACACATACAACAAGCCTTTTTTTCTC
GTATACATCAATACCTCGGTATTTGCATTTTCCTTGCTGCCTCTCTTCGTCAAATACTTGCTCAACAACGGCCTG
CGCGGCCTGCGCAGCGACGTGGTACACTTGTGGCGTGATTACAAGTACAATCCGTCGCACATGCGCCTCCCAGCC
AGCCAAAGCATCCAGCATGTTGGCCCCGTCGACGACGACGACGACGCAATGGCCCCGCCCAGCGAGCGGCTCATG
GTGGACGACGCCGACAGCGTCGCCTGTGTCTTGCCGGAACCCAGGCTCGGCCTAGCCGAGACGGCTGTGCTGAGC
CTCGAGTTCTCCATGCTGTGGTTCCTGGCAAACTACTTTGCTTCTGCGTGCCTCGAGCACACGAGCGTGGCAAGC
GTCACCATATTGACGTCGACGAGTAGCGTTTGGACCCTCGTCTTTTGCTCCCTCTTTCGTGTCGAGAGCTTTTCC
TTGCGCAAGTTTCTGGGTGTCTTGGCCTCGCTGGCCGGCGTCGTCTTCATCTCCACTGTGGACTTGACGGGCGAG
AGCGACGAGAACAGAGGATCTTTTCCTCACAAGACGTCTGGCCAGATTGCTCTGGGAGACTCAATGGCCCTTTTC
AGTGCCGTCATCTACGGGCTCTACGTCACCGTCATGAAGCGGCGTGTTGGCAACGAGGACAAGGTCGACATGCGT
CTCTTTTTTGGCCTCGTTGGTGTCTTTAACCTCGCCCTGCTGTGGCCCCTCTTCTTCATCTTGCATTGGACAGGC
ATTGAGCCGTTTGAAATGCCGCCCACGGGCAAAATCTGGACAATTATTATTGTCAACTCGCTCTCATCATTCATG
AGTGACATGTCATGGGCCTTTTCCATGTTGCTGACTACACCCCTCGTTGTCACAGTCGGCCTCTCGCTCTCCATC
CCACTGTCGCTTGTGGGTGAGATGATACAGTACGGACAGTACTCGAGCTTCATGTACTGGATAGGTGCCACCATT
GTATTTGTCTCGTTTCTCTTTGTCAACAACGAGAGCCATGACGAGTGTCACGAGCACCGCCCAGCCAGAGATGAG
GGGCCAGAACGTATACAAACTTCGGCTGCTGCCATTGTGTAG
Transcript >OphauB2|5990
ATGAAGTCGCCCGAGTCGCAACGGTCCAGCGATGCGGCCGACCCGAGGCAAAGGTCTGCTCCCGCCATGCACCTC
GACGCCGCCAGTCAATCCGCCATGAGCCTGCCGTCCATGCCTTCGTCTTGCTCTGCCTCTTCTCCCGGCCCCTTT
GACAAGGGAAACCTTGCCGCGCGCCTGGGCCTCACCCGGCGCGCCTTGGGCATCTGCCTCTTGCTCGTTACTGTT
TGCCTTTGGACAGTGTCCAACTTTTTGGCTAGTTTCATCTTTTCCGATCACACATACAACAAGCCTTTTTTTCTC
GTATACATCAATACCTCGGTATTTGCATTTTCCTTGCTGCCTCTCTTCGTCAAATACTTGCTCAACAACGGCCTG
CGCGGCCTGCGCAGCGACGTGGTACACTTGTGGCGTGATTACAAGTACAATCCGTCGCACATGCGCCTCCCAGCC
AGCCAAAGCATCCAGCATGTTGGCCCCGTCGACGACGACGACGACGCAATGGCCCCGCCCAGCGAGCGGCTCATG
GTGGACGACGCCGACAGCGTCGCCTGTGTCTTGCCGGAACCCAGGCTCGGCCTAGCCGAGACGGCTGTGCTGAGC
CTCGAGTTCTCCATGCTGTGGTTCCTGGCAAACTACTTTGCTTCTGCGTGCCTCGAGCACACGAGCGTGGCAAGC
GTCACCATATTGACGTCGACGAGTAGCGTTTGGACCCTCGTCTTTTGCTCCCTCTTTCGTGTCGAGAGCTTTTCC
TTGCGCAAGTTTCTGGGTGTCTTGGCCTCGCTGGCCGGCGTCGTCTTCATCTCCACTGTGGACTTGACGGGCGAG
AGCGACGAGAACAGAGGATCTTTTCCTCACAAGACGTCTGGCCAGATTGCTCTGGGAGACTCAATGGCCCTTTTC
AGTGCCGTCATCTACGGGCTCTACGTCACCGTCATGAAGCGGCGTGTTGGCAACGAGGACAAGGTCGACATGCGT
CTCTTTTTTGGCCTCGTTGGTGTCTTTAACCTCGCCCTGCTGTGGCCCCTCTTCTTCATCTTGCATTGGACAGGC
ATTGAGCCGTTTGAAATGCCGCCCACGGGCAAAATCTGGACAATTATTATTGTCAACTCGCTCTCATCATTCATG
AGTGACATGTCATGGGCCTTTTCCATGTTGCTGACTACACCCCTCGTTGTCACAGTCGGCCTCTCGCTCTCCATC
CCACTGTCGCTTGTGGGTGAGATGATACAGTACGGACAGTACTCGAGCTTCATGTACTGGATAGGTGCCACCATT
GTATTTGTCTCGTTTCTCTTTGTCAACAACGAGAGCCATGACGAGTGTCACGAGCACCGCCCAGCCAGAGATGAG
GGGCCAGAACGTATACAAACTTCGGCTGCTGCCATTGTGTAG
Gene >OphauB2|5990
ATGAAGTCGCCCGAGTCGCAACGGTCCAGCGATGCGGCCGACCCGAGGCAAAGGTCTGCTCCCGCCATGCACCTC
GACGCCGCCAGTCAATCCGCCATGAGCCTGCCGTCCATGCCTTCGTCTTGCTCTGCCTCTTCTCCCGGCCCCTTT
GACAAGGGAAACCTTGCCGCGCGCCTGGGCCTCACCCGGCGCGCCTTGGGCATCTGCCTCTTGCTCGTTACTGTT
TGCCTTTGGACAGTGTCCAACTTTTTGGCTAGTGTAGGCTACCCTGTTTCCCCCTCTTGGCTTTTTCTTTGTCTT
GTCTGCAGCACCATGCCGACGGTTGCTGACCTTTGTGCAGTTCATCTTTTCCGATCACACATACAACAAGCCTTT
TTTTCTCGTATACATCAATACCTCGGTATTTGCATTTTCCTTGCTGCCTCTCTTCGTCAAATACTTGCTCAACAA
CGGCCTGCGCGGCCTGCGCAGCGACGTGGTACACTTGTGGCGTGATTACAAGTACAATCCGTCGCACATGCGCCT
CCCAGCCAGCCAAAGCATCCAGCATGTTGGCCCCGTCGACGACGACGACGACGCAATGGCCCCGCCCAGCGAGCG
GCTCATGGTGGACGACGCCGACAGCGTCGCCTGTGTCTTGCCGGAACCCAGGCTCGGCCTAGCCGAGACGGCTGT
GCTGAGCCTCGAGTTCTCCATGCTGTGGTTCCTGGCAAACTACTTTGCTTCTGCGTGCCTCGAGCACACGAGCGT
GGCAAGCGTCACCATATTGACGTCGACGAGTAGCGTTTGGACCCTCGTCTTTTGCTCCCTCTTTCGTGTCGAGAG
CTTTTCCTTGCGCAAGTTTCTGGGTGTCTTGGCCTCGCTGGCCGGCGTCGTCTTCATCTCCACTGTGGACTTGAC
GGGCGAGAGCGACGAGAACAGAGGATCTTTTCCTCACAAGACGTCTGGCCAGATTGCTCTGGGAGACTCAATGGC
CCTTTTCAGTGCCGTCATCTACGGGCTCTACGTCACCGTCATGAAGCGGCGTGTTGGCAACGAGGACAAGGTCGA
CATGCGTCTCTTTTTTGGCCTCGTTGGTGTCTTTAACCTCGCCCTGCTGTGGCCCCTCTTCTTCATCTTGCATTG
GACAGGCATTGAGCCGGTAAGCCTCCTCGCACACTCTGCATCATGGAGCCCTGAAGGAAGGTAAAAAGACACTAA
TCAAGTGTAACAACTTGCAGTTTGAAATGCCGCCCACGGGCAAAATCTGGACAATTATTATTGTACGCATCACCC
TGGCATCACCCTGGCCCCACGTCACACATGACTTGTGAAGCCGTGGCCGGTGCAACGCTCCTAACAGCTTTCTTG
CAGGTCAACTCGCTCTCATCATTCATGAGTGACATGTCATGGGCCTTTTCCATGTTGCTGACTACACCCCTCGTT
GTCACAGTCGGCCTCTCGCTCTCCATCCCACTGTCGCTTGTGGGTGAGATGATACAGTACGGACAGTACTCGAGC
TTCATGTACTGGATAGGTGCCACCATTGTATTTGTCTCGTTTCTCTTTGTCAACAACGAGAGCCATGACGAGTGT
CACGAGCACCGCCCAGCCAGAGATGAGGGGCCAGAACGTATACAAACTTCGGCTGCTGCCATTGTGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail