Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|5980
Gene name
LocationContig_5:342146..344214
Strand-
Gene length (bp)2068
Transcript length (bp)2022
Coding sequence length (bp)2022
Protein length (aa) 674

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00505 HMG_box HMG (high mobility group) box 1.6E-22 95 163
PF09011 HMG_box_2 HMG-box domain 4.3E-07 96 162

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P35693|FPR1_PODAS MAT+ sexual cell fertilization-promoting factor OS=Podospora anserina GN=FPR1 PE=3 SV=2 94 171 4.0E-16
sp|Q5A220|RFG1_CANAL Repressor of filamentous growth 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=RFG1 PE=2 SV=2 87 194 8.0E-16
sp|P0CY16|MTMC3_SCHPO Silenced mating-type M-specific polypeptide Mc OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mat3-Mc PE=3 SV=1 94 169 7.0E-15
sp|P0CY17|MATMC_SCHPO Mating-type M-specific polypeptide Mc OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mat1-Mc PE=2 SV=1 94 169 7.0E-15
sp|C7U331|MATMC_SCHPM Mating-type M-specific polypeptide Mc OS=Schizosaccharomyces pombe GN=mat3-Mc PE=2 SV=1 94 169 7.0E-15
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P35693|FPR1_PODAS MAT+ sexual cell fertilization-promoting factor OS=Podospora anserina GN=FPR1 PE=3 SV=2 94 171 4.0E-16
sp|Q5A220|RFG1_CANAL Repressor of filamentous growth 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=RFG1 PE=2 SV=2 87 194 8.0E-16
sp|P0CY16|MTMC3_SCHPO Silenced mating-type M-specific polypeptide Mc OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mat3-Mc PE=3 SV=1 94 169 7.0E-15
sp|P0CY17|MATMC_SCHPO Mating-type M-specific polypeptide Mc OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mat1-Mc PE=2 SV=1 94 169 7.0E-15
sp|C7U331|MATMC_SCHPM Mating-type M-specific polypeptide Mc OS=Schizosaccharomyces pombe GN=mat3-Mc PE=2 SV=1 94 169 7.0E-15
sp|Q6WRX6|MATMC_SCHKA Mating-type M-specific polypeptide Mc OS=Schizosaccharomyces kambucha GN=matMc PE=3 SV=1 94 169 8.0E-15
sp|Q08143|SMR2_PODAS Sporulation minus regulator 2 OS=Podospora anserina GN=SMR2 PE=3 SV=1 5 169 2.0E-14
sp|P25042|ROX1_YEAST Repressor ROX1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ROX1 PE=1 SV=1 92 168 2.0E-13
sp|P43267|SOX15_MOUSE Protein SOX-15 OS=Mus musculus GN=Sox15 PE=1 SV=3 91 193 2.0E-12
sp|P36981|MATB_NEUCS Mating-type protein a-1 OS=Neurospora crassa GN=mta-1 PE=1 SV=2 94 169 3.0E-12
sp|O60248|SOX15_HUMAN Protein SOX-15 OS=Homo sapiens GN=SOX15 PE=1 SV=1 91 198 4.0E-12
sp|Q864Q4|SRY_MESST Sex-determining region Y protein OS=Mesoplodon stejnegeri GN=SRY PE=3 SV=1 94 201 5.0E-12
sp|P36389|SRY_HORSE Sex-determining region Y protein OS=Equus caballus GN=SRY PE=2 SV=2 94 175 7.0E-12
sp|Q6TC38|SRY_MIRLE Sex-determining region Y protein OS=Mirounga leonina GN=SRY PE=3 SV=1 94 182 3.0E-11
sp|Q6TC39|SRY_MIRAN Sex-determining region Y protein OS=Mirounga angustirostris GN=SRY PE=3 SV=1 94 182 3.0E-11
sp|Q67EX7|SRY_MOSBE Sex-determining region Y protein OS=Moschus berezovskii GN=SRY PE=3 SV=1 95 180 5.0E-11
sp|P47792|SX19A_DANRE Transcription factor Sox-19a OS=Danio rerio GN=sox19a PE=1 SV=2 91 172 5.0E-11
sp|Q864Q7|SRY_EUBAS Sex-determining region Y protein OS=Eubalaena australis GN=SRY PE=3 SV=1 94 201 6.0E-11
sp|Q864Q6|SRY_PHYCD Sex-determining region Y protein OS=Physeter catodon GN=SRY PE=3 SV=1 94 180 9.0E-11
sp|Q7SZS1|SX21A_DANRE Transcription factor Sox-21-A OS=Danio rerio GN=sox21a PE=2 SV=1 88 171 9.0E-11
sp|Q864Q2|SRY_PHOPH Sex-determining region Y protein OS=Phocoena phocoena GN=SRY PE=3 SV=1 84 171 1.0E-10
sp|Q864Q1|SRY_NEOPH Sex-determining region Y protein OS=Neophocaena phocaenoides GN=SRY PE=3 SV=1 84 171 1.0E-10
sp|Q05066|SRY_HUMAN Sex-determining region Y protein OS=Homo sapiens GN=SRY PE=1 SV=1 94 171 1.0E-10
sp|Q864Q3|SRY_DELLE Sex-determining region Y protein OS=Delphinapterus leucas GN=SRY PE=3 SV=1 84 171 1.0E-10
sp|Q864P7|SRY_GRAGR Sex-determining region Y protein OS=Grampus griseus GN=SRY PE=3 SV=1 84 171 1.0E-10
sp|Q864P5|SRY_ORCOR Sex-determining region Y protein OS=Orcinus orca GN=SRY PE=3 SV=1 84 171 1.0E-10
sp|Q864P3|SRY_ORCBR Sex-determining region Y protein OS=Orcaella brevirostris GN=SRY PE=3 SV=1 84 171 1.0E-10
sp|Q864Q0|SRY_TURTR Sex-determining region Y protein OS=Tursiops truncatus GN=SRY PE=3 SV=1 84 171 1.0E-10
sp|Q864P6|SRY_PENEL Sex-determining region Y protein OS=Peponocephala electra GN=SRY PE=3 SV=1 84 171 1.0E-10
sp|Q864P8|SRY_LAGOL Sex-determining region Y protein OS=Lagenorhynchus obliquidens GN=SRY PE=3 SV=1 84 171 1.0E-10
sp|Q864P4|SRY_GLOMA Sex-determining region Y protein OS=Globicephala macrorhynchus GN=SRY PE=3 SV=2 84 171 1.0E-10
sp|Q864P9|SRY_DELDE Sex-determining region Y protein OS=Delphinus delphis GN=SRY PE=3 SV=1 84 171 1.0E-10
sp|P48046|SRY_GORGO Sex-determining region Y protein OS=Gorilla gorilla gorilla GN=SRY PE=3 SV=1 94 171 1.0E-10
sp|Q9DDD7|SX19B_DANRE Transcription factor Sox-19b OS=Danio rerio GN=sox19b PE=1 SV=1 91 180 1.0E-10
sp|Q6TC27|SRY_ENHLU Sex-determining region Y protein OS=Enhydra lutris GN=SRY PE=3 SV=1 95 175 1.0E-10
sp|Q03255|SRY_BOVIN Sex-determining region Y protein OS=Bos taurus GN=SRY PE=3 SV=2 64 180 1.0E-10
sp|Q864R1|SRY_BALBN Sex-determining region Y protein OS=Balaenoptera bonaerensis GN=SRY PE=3 SV=1 94 201 1.0E-10
sp|Q864R2|SRY_BALAC Sex-determining region Y protein OS=Balaenoptera acutorostrata GN=SRY PE=3 SV=1 94 201 1.0E-10
sp|Q8SPQ2|SRY_BISBI Sex-determining region Y protein OS=Bison bison GN=SRY PE=3 SV=1 64 180 1.0E-10
sp|Q7JGF7|SRY_BOSIN Sex-determining region Y protein OS=Bos indicus GN=SRY PE=3 SV=1 64 180 1.0E-10
sp|Q7JGF9|SRY_BOSGF Sex-determining region Y protein OS=Bos gaurus frontalis GN=SRY PE=3 SV=1 64 180 1.0E-10
sp|Q27949|SRY_BISBO Sex-determining region Y protein OS=Bison bonasus GN=SRY PE=3 SV=2 64 180 1.0E-10
sp|Q9BG90|SRY_MACMU Sex-determining region Y protein OS=Macaca mulatta GN=SRY PE=2 SV=1 94 171 2.0E-10
sp|Q864R0|SRY_BALMU Sex-determining region Y protein OS=Balaenoptera musculus GN=SRY PE=3 SV=1 94 201 2.0E-10
sp|Q6TC40|SRY_HYDLE Sex-determining region Y protein OS=Hydrurga leptonyx GN=SRY PE=3 SV=1 94 182 2.0E-10
sp|Q864Q8|SRY_MEGNO Sex-determining region Y protein OS=Megaptera novaeangliae GN=SRY PE=3 SV=1 94 171 2.0E-10
sp|Q864Q9|SRY_BALPH Sex-determining region Y protein OS=Balaenoptera physalus GN=SRY PE=3 SV=1 94 171 2.0E-10
sp|Q864Q5|SRY_KOGSI Sex-determining region Y protein OS=Kogia sima GN=SRY PE=3 SV=1 94 201 2.0E-10
sp|Q6TC50|SRY_FELCA Sex-determining region Y protein OS=Felis catus GN=SRY PE=3 SV=1 94 175 3.0E-10
sp|P36395|SRY_SMIMA Sex-determining region Y protein OS=Sminthopsis macroura GN=SRY PE=2 SV=1 92 171 3.0E-10
sp|Q6TC33|SRY_PHOVI Sex-determining region Y protein OS=Phoca vitulina GN=SRY PE=3 SV=1 94 182 3.0E-10
sp|Q6TC31|SRY_PHOLR Sex-determining region Y protein OS=Phoca largha GN=SRY PE=3 SV=1 94 182 3.0E-10
sp|P36390|SRY_HALGR Sex-determining region Y protein OS=Halichoerus grypus GN=SRY PE=3 SV=2 94 175 4.0E-10
sp|Q6TC46|SRY_EUMJU Sex-determining region Y protein OS=Eumetopias jubatus GN=SRY PE=3 SV=1 94 175 4.0E-10
sp|Q6TC36|SRY_PAGGO Sex-determining region Y protein OS=Pagophilus groenlandicus GN=SRY PE=3 SV=1 94 175 4.0E-10
sp|Q6TC43|SRY_CALUR Sex-determining region Y protein OS=Callorhinus ursinus GN=SRY PE=3 SV=1 94 175 4.0E-10
sp|Q6TC32|SRY_PUSHI Sex-determining region Y protein OS=Pusa hispida GN=SRY PE=3 SV=1 94 175 4.0E-10
sp|Q6TC37|SRY_CYSCR Sex-determining region Y protein OS=Cystophora cristata GN=SRY PE=3 SV=1 94 175 4.0E-10
sp|Q6TC45|SRY_ZALCA Sex-determining region Y protein OS=Zalophus californianus GN=SRY PE=3 SV=1 94 182 4.0E-10
sp|Q28783|SRY_PONPY Sex-determining region Y protein OS=Pongo pygmaeus GN=SRY PE=3 SV=1 94 183 4.0E-10
sp|Q6TC44|SRY_ARCGZ Sex-determining region Y protein OS=Arctocephalus gazella GN=SRY PE=3 SV=1 94 175 4.0E-10
sp|Q6TC28|SRY_LUTLU Sex-determining region Y protein OS=Lutra lutra GN=SRY PE=3 SV=1 95 182 4.0E-10
sp|Q03256|SRY_CAPHI Sex-determining region Y protein OS=Capra hircus GN=SRY PE=3 SV=2 95 181 5.0E-10
sp|Q6T724|SRY_ARCFO Sex-determining region Y protein OS=Arctocephalus forsteri GN=SRY PE=3 SV=1 94 175 5.0E-10
sp|Q6T723|SRY_ARCAU Sex-determining region Y protein OS=Arctocephalus australis GN=SRY PE=3 SV=1 94 175 5.0E-10
sp|Q6TC34|SRY_PUSCA Sex-determining region Y protein OS=Pusa caspica GN=SRY PE=3 SV=1 94 175 7.0E-10
sp|Q32PP9|SOX14_DANRE Transcription factor Sox-14 OS=Danio rerio GN=sox14 PE=2 SV=1 88 171 7.0E-10
sp|Q67EX6|SRY_MOSCH Sex-determining region Y protein OS=Moschus chrysogaster GN=SRY PE=3 SV=1 95 180 7.0E-10
sp|Q863D9|SRY_ALCAC Sex-determining region Y protein OS=Alces alces cameloides GN=SRY PE=3 SV=1 95 173 7.0E-10
sp|P36396|SRY_URSAR Sex-determining region Y protein OS=Ursus arctos GN=SRY PE=3 SV=2 94 173 7.0E-10
sp|Q8SPQ1|SRY_BOSJA Sex-determining region Y protein OS=Bos javanicus GN=SRY PE=3 SV=1 64 180 8.0E-10
sp|Q9BH08|SRY_CERNI Sex-determining region Y protein OS=Cervus nippon GN=SRY PE=3 SV=1 95 241 9.0E-10
sp|Q863B7|SRY_ELADA Sex-determining region Y protein OS=Elaphurus davidianus GN=SRY PE=3 SV=1 95 173 9.0E-10
sp|Q863C2|SRY_AXIPR Sex-determining region Y protein OS=Axis porcinus GN=SRY PE=3 SV=1 95 173 1.0E-09
sp|Q6TC30|SRY_ERIBA Sex-determining region Y protein OS=Erignathus barbatus GN=SRY PE=3 SV=1 94 173 1.0E-09
sp|Q28798|SRY_PANTR Sex-determining region Y protein OS=Pan troglodytes GN=SRY PE=2 SV=1 94 168 1.0E-09
sp|P61259|SOX14_MACFA Transcription factor SOX-14 OS=Macaca fascicularis GN=SOX14 PE=2 SV=1 88 171 2.0E-09
sp|O95416|SOX14_HUMAN Transcription factor SOX-14 OS=Homo sapiens GN=SOX14 PE=1 SV=1 88 171 2.0E-09
sp|Q28447|SRY_HYLLA Sex-determining region Y protein OS=Hylobates lar GN=SRY PE=3 SV=1 94 171 2.0E-09
sp|Q9XS37|SRY_BOSMU Sex-determining region Y protein OS=Bos mutus grunniens GN=SRY PE=3 SV=1 64 180 2.0E-09
sp|Q04892|SOX14_MOUSE Transcription factor SOX-14 OS=Mus musculus GN=Sox14 PE=2 SV=2 88 171 2.0E-09
sp|Q8AXQ4|SOX12_XENLA Transcription factor Sox-12 OS=Xenopus laevis GN=sox12 PE=2 SV=1 95 175 2.0E-09
sp|P36393|SRY_PIG Sex-determining region Y protein OS=Sus scrofa GN=SRY PE=2 SV=3 94 168 2.0E-09
sp|Q9W7R6|SOX14_CHICK Transcription factor SOX-14 OS=Gallus gallus GN=SOX14 PE=2 SV=1 88 171 2.0E-09
sp|Q9XT60|SRY_CANLF Sex-determining region Y protein OS=Canis lupus familiaris GN=SRY PE=3 SV=1 94 182 2.0E-09
sp|A4QNG3|SOX14_XENTR Transcription factor Sox-14 OS=Xenopus tropicalis GN=sox14 PE=2 SV=1 88 171 2.0E-09
sp|Q04890|SOX12_MOUSE Transcription factor SOX-12 OS=Mus musculus GN=Sox12 PE=2 SV=2 91 171 2.0E-09
sp|B0ZTE2|SOX14_XENLA Transcription factor Sox-14 OS=Xenopus laevis GN=sox14 PE=2 SV=1 88 171 3.0E-09
sp|Q03257|SRY_SHEEP Sex-determining region Y protein OS=Ovis aries GN=SRY PE=3 SV=2 95 180 3.0E-09
sp|O15370|SOX12_HUMAN Transcription factor SOX-12 OS=Homo sapiens GN=SOX12 PE=2 SV=2 90 171 3.0E-09
sp|Q28778|SRY_PANPA Sex-determining region Y protein OS=Pan paniscus GN=SRY PE=3 SV=1 94 168 3.0E-09
sp|P36631|STE11_SCHPO Transcription factor ste11 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ste11 PE=1 SV=2 95 168 3.0E-09
sp|Q69FB1|SRY_BUBBU Sex-determining region Y protein OS=Bubalus bubalis GN=SRY PE=3 SV=1 95 180 4.0E-09
sp|P51501|SRY_CALJA Sex-determining region Y protein OS=Callithrix jacchus GN=SRY PE=3 SV=1 94 168 4.0E-09
sp|Q6TC41|SRY_MONSC Sex-determining region Y protein OS=Monachus schauinslandi GN=SRY PE=3 SV=1 94 175 5.0E-09
sp|Q870J1|STE11_PNECA HMG-box protein STE11 OS=Pneumocystis carinii PE=1 SV=1 98 181 5.0E-09
sp|Q24533|DICH_DROME SOX domain-containing protein dichaete OS=Drosophila melanogaster GN=D PE=2 SV=1 77 171 6.0E-09
sp|Q6NVN0|SOX2_XENTR Transcription factor Sox-2 OS=Xenopus tropicalis GN=sox2 PE=2 SV=1 94 171 8.0E-09
sp|P40650|SX11B_XENLA Transcription factor Sox-11-B OS=Xenopus laevis GN=sox11-b PE=1 SV=2 95 202 8.0E-09
sp|O42569|SOX2_XENLA Transcription factor Sox-2 OS=Xenopus laevis GN=sox2 PE=2 SV=1 94 171 8.0E-09
sp|P48430|SOX2_CHICK Transcription factor SOX-2 OS=Gallus gallus GN=SOX2 PE=1 SV=1 94 171 8.0E-09
sp|P0C1G9|SOX11_RAT Transcription factor SOX-11 OS=Rattus norvegicus GN=Sox11 PE=2 SV=1 95 186 9.0E-09
sp|Q7M6Y2|SOX11_MOUSE Transcription factor SOX-11 OS=Mus musculus GN=Sox11 PE=1 SV=1 95 186 9.0E-09
sp|Q06945|SOX4_HUMAN Transcription factor SOX-4 OS=Homo sapiens GN=SOX4 PE=1 SV=1 90 171 9.0E-09
sp|P48432|SOX2_MOUSE Transcription factor SOX-2 OS=Mus musculus GN=Sox2 PE=1 SV=2 94 171 1.0E-08
sp|P48431|SOX2_HUMAN Transcription factor SOX-2 OS=Homo sapiens GN=SOX2 PE=1 SV=1 94 171 1.0E-08
sp|P54231|SOX2_SHEEP Transcription factor SOX-2 OS=Ovis aries GN=SOX2 PE=3 SV=1 94 171 1.0E-08
sp|Q68FA4|SOX3_XENTR Transcription factor Sox-3 OS=Xenopus tropicalis GN=sox3 PE=2 SV=1 94 168 1.0E-08
sp|Q06831|SOX4_MOUSE Transcription factor SOX-4 OS=Mus musculus GN=Sox4 PE=1 SV=2 91 180 1.0E-08
sp|P48433|SOX3_CHICK Transcription factor SOX-3 OS=Gallus gallus GN=SOX3 PE=2 SV=1 94 168 1.0E-08
sp|P53784|SOX3_MOUSE Transcription factor SOX-3 OS=Mus musculus GN=Sox3 PE=1 SV=2 94 168 1.0E-08
sp|Q6RVD7|SX21B_DANRE Transcription factor Sox-21-B OS=Danio rerio GN=sox21b PE=2 SV=1 88 171 1.0E-08
sp|P41225|SOX3_HUMAN Transcription factor SOX-3 OS=Homo sapiens GN=SOX3 PE=1 SV=2 94 168 1.0E-08
sp|Q9Y651|SOX21_HUMAN Transcription factor SOX-21 OS=Homo sapiens GN=SOX21 PE=2 SV=1 88 171 2.0E-08
sp|Q811W0|SOX21_MOUSE Transcription factor SOX-21 OS=Mus musculus GN=Sox21 PE=2 SV=1 88 171 2.0E-08
sp|Q6P0E1|SOX2_DANRE Transcription factor Sox-2 OS=Danio rerio GN=sox2 PE=2 SV=1 94 171 2.0E-08
sp|Q9W7R5|SOX21_CHICK Transcription factor SOX-21 OS=Gallus gallus GN=SOX21 PE=2 SV=1 88 171 2.0E-08
sp|P35716|SOX11_HUMAN Transcription factor SOX-11 OS=Homo sapiens GN=SOX11 PE=1 SV=2 95 186 2.0E-08
sp|P40646|SOX7_MOUSE Transcription factor SOX-7 OS=Mus musculus GN=Sox7 PE=1 SV=2 94 193 2.0E-08
sp|P55863|SOX3A_XENLA Transcription factor Sox-3-A OS=Xenopus laevis GN=sox3-a PE=1 SV=1 94 168 3.0E-08
sp|Q6DGL6|SOX1A_DANRE Transcription factor Sox-1a OS=Danio rerio GN=sox1a PE=2 SV=2 59 168 3.0E-08
sp|Q66JF1|SOX11_XENTR Transcription factor Sox-11 OS=Xenopus tropicalis GN=sox11 PE=2 SV=1 95 190 3.0E-08
sp|P48435|SOX11_CHICK Transcription factor SOX-11 OS=Gallus gallus GN=SOX11 PE=2 SV=1 95 186 3.0E-08
sp|Q5FWM3|SOX3B_XENLA Transcription factor Sox-3-B OS=Xenopus laevis GN=sox3-b PE=2 SV=1 94 168 3.0E-08
sp|Q91731|SX11A_XENLA Transcription factor Sox-11-A OS=Xenopus laevis GN=sox11-a PE=1 SV=2 95 171 4.0E-08
sp|B0ZTE1|SOX21_XENLA Transcription factor Sox-21 OS=Xenopus laevis GN=sox21 PE=2 SV=1 88 171 5.0E-08
sp|P36394|SRY_RAT Sex-determining region Y protein (Fragment) OS=Rattus norvegicus GN=Sry PE=1 SV=2 94 176 8.0E-08
sp|Q2PG84|SOX1_XENLA Transcription factor Sox-1 OS=Xenopus laevis GN=sox1 PE=2 SV=1 94 168 9.0E-08
sp|Q9P445|MAT2_COCSA Mating-type protein MAT-2 OS=Cochliobolus sativus GN=MAT2 PE=3 SV=1 21 168 1.0E-07
sp|Q2Z1R2|SOX1B_DANRE Transcription factor Sox-1b OS=Danio rerio GN=sox1b PE=2 SV=1 94 168 1.0E-07
sp|Q6EJB7|SOX3_DANRE Transcription factor Sox-3 OS=Danio rerio GN=sox3 PE=1 SV=1 94 168 1.0E-07
sp|A2TED3|SOX1_XENTR Transcription factor Sox-1 OS=Xenopus tropicalis GN=sox1 PE=2 SV=1 94 168 1.0E-07
sp|Q9BT81|SOX7_HUMAN Transcription factor SOX-7 OS=Homo sapiens GN=SOX7 PE=1 SV=1 94 171 1.0E-07
sp|Q02991|MAT2_COCHE Mating-type protein MAT-2 OS=Cochliobolus heterostrophus GN=MAT2 PE=3 SV=1 51 168 1.0E-07
sp|A4IIJ8|SOX10_XENTR Transcription factor Sox-10 OS=Xenopus tropicalis GN=sox10 PE=2 SV=1 93 220 2.0E-07
sp|P40656|SOX14_DROME Putative transcription factor SOX-14 OS=Drosophila melanogaster GN=Sox14 PE=2 SV=3 95 188 2.0E-07
sp|P57073|SOX8_HUMAN Transcription factor SOX-8 OS=Homo sapiens GN=SOX8 PE=2 SV=1 93 168 2.0E-07
sp|O42342|SOX7_XENLA Transcription factor Sox-7 OS=Xenopus laevis GN=sox7 PE=2 SV=1 94 168 2.0E-07
sp|Q6IZ48|SOX8_TETNG Transcription factor Sox-8 OS=Tetraodon nigroviridis GN=sox8 PE=2 SV=2 93 187 2.0E-07
sp|B1H349|SOX6_XENTR Transcription factor Sox-6 OS=Xenopus tropicalis GN=sox6 PE=2 SV=1 93 167 2.0E-07
sp|Q28GD5|SOX7_XENTR Transcription factor Sox-7 OS=Xenopus tropicalis GN=sox7 PE=2 SV=1 94 168 2.0E-07
sp|O00570|SOX1_HUMAN Transcription factor SOX-1 OS=Homo sapiens GN=SOX1 PE=1 SV=2 94 168 2.0E-07
sp|P53783|SOX1_MOUSE Transcription factor SOX-1 OS=Mus musculus GN=Sox1 PE=2 SV=2 94 168 2.0E-07
sp|O57401|SOX1_CHICK Transcription factor SOX-1 OS=Gallus gallus GN=SOX1 PE=2 SV=1 94 168 2.0E-07
sp|Q5RCU4|SOX6_PONAB Transcription factor SOX-6 OS=Pongo abelii GN=SOX6 PE=2 SV=1 93 167 3.0E-07
sp|P40645|SOX6_MOUSE Transcription factor SOX-6 OS=Mus musculus GN=Sox6 PE=1 SV=2 93 167 3.0E-07
sp|Q04886|SOX8_MOUSE Transcription factor SOX-8 OS=Mus musculus GN=Sox8 PE=2 SV=2 93 168 3.0E-07
sp|P35712|SOX6_HUMAN Transcription factor SOX-6 OS=Homo sapiens GN=SOX6 PE=1 SV=3 93 167 3.0E-07
sp|P57074|SOX8_CHICK Transcription factor SOX-8 OS=Gallus gallus GN=SOX8 PE=2 SV=1 93 196 4.0E-07
sp|Q61473|SOX17_MOUSE Transcription factor SOX-17 OS=Mus musculus GN=Sox17 PE=1 SV=1 94 168 5.0E-07
sp|Q6VVD7|SOX8_XENLA Transcription factor Sox-8 OS=Xenopus laevis GN=sox8 PE=2 SV=1 80 168 5.0E-07
sp|B3DLD3|SOX18_XENTR Transcription factor Sox-18 OS=Xenopus tropicalis GN=sox18 PE=2 SV=1 93 171 5.0E-07
sp|Q10116|MATD_NEUCR Mating-type protein A-3 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=mtA-3 PE=2 SV=1 97 188 6.0E-07
sp|Q8AXX8|SOX10_XENLA Transcription factor Sox-10 OS=Xenopus laevis GN=sox10 PE=1 SV=1 93 220 7.0E-07
sp|Q9H6I2|SOX17_HUMAN Transcription factor SOX-17 OS=Homo sapiens GN=SOX17 PE=1 SV=1 94 168 7.0E-07
sp|O55170|SOX10_RAT Transcription factor SOX-10 OS=Rattus norvegicus GN=Sox10 PE=1 SV=1 93 168 8.0E-07
sp|P56693|SOX10_HUMAN Transcription factor SOX-10 OS=Homo sapiens GN=SOX10 PE=1 SV=1 93 168 8.0E-07
sp|A5A763|SOX10_PIG Transcription factor SOX-10 OS=Sus scrofa GN=SOX10 PE=2 SV=1 93 168 8.0E-07
sp|Q04888|SOX10_MOUSE Transcription factor SOX-10 OS=Mus musculus GN=Sox10 PE=2 SV=2 93 168 8.0E-07
sp|P40639|AES4_ALLMI SRY-related protein AES4 (Fragment) OS=Alligator mississippiensis PE=3 SV=1 95 166 9.0E-07
sp|B3DM43|SOX5_XENTR Transcription factor Sox-5 OS=Xenopus tropicalis GN=sox5 PE=2 SV=1 93 167 9.0E-07
sp|Q6GLH8|S17B2_XENTR Transcription factor Sox-17-beta.2 OS=Xenopus tropicalis GN=sox17b.2 PE=2 SV=2 94 184 9.0E-07
sp|P35710|SOX5_MOUSE Transcription factor SOX-5 OS=Mus musculus GN=Sox5 PE=1 SV=2 93 167 1.0E-06
sp|Q23045|EGL13_CAEEL Transcription factor egl-13 OS=Caenorhabditis elegans GN=egl-13 PE=1 SV=2 95 167 1.0E-06
sp|P40657|SOX15_DROME Putative transcription factor SOX-15 OS=Drosophila melanogaster GN=Sox15 PE=2 SV=2 90 211 1.0E-06
sp|P35711|SOX5_HUMAN Transcription factor SOX-5 OS=Homo sapiens GN=SOX5 PE=1 SV=3 93 167 1.0E-06
sp|P40647|SOX5_XENLA Transcription factor Sox-5 OS=Xenopus laevis GN=sox5 PE=2 SV=2 93 167 1.0E-06
sp|Q90ZH7|SX18B_XENLA Transcription factor Sox-18B OS=Xenopus laevis GN=sox18-b PE=1 SV=1 93 171 1.0E-06
sp|Q9W757|SOX10_CHICK Transcription factor SOX-10 OS=Gallus gallus GN=SOX10 PE=2 SV=2 93 168 1.0E-06
sp|Q90ZH8|SX18A_XENLA Transcription factor Sox-18A OS=Xenopus laevis GN=sox18-a PE=1 SV=1 93 171 1.0E-06
sp|P40640|AES6_ALLMI SRY-related protein AES6 (Fragment) OS=Alligator mississippiensis PE=3 SV=1 95 166 2.0E-06
sp|P43680|SOX18_MOUSE Transcription factor SOX-18 OS=Mus musculus GN=Sox18 PE=1 SV=3 94 171 2.0E-06
sp|Q62563|SRY_MUSSP Sex-determining region Y protein OS=Mus spretus GN=Sry PE=3 SV=2 95 171 2.0E-06
sp|P40635|ADW4_ALLMI SRY-related protein ADW4 (Fragment) OS=Alligator mississippiensis PE=3 SV=1 95 166 2.0E-06
sp|Q9UN79|SOX13_HUMAN Transcription factor SOX-13 OS=Homo sapiens GN=SOX13 PE=1 SV=3 95 167 2.0E-06
sp|Q04891|SOX13_MOUSE Transcription factor SOX-13 OS=Mus musculus GN=Sox13 PE=2 SV=4 95 167 2.0E-06
sp|P35713|SOX18_HUMAN Transcription factor SOX-18 OS=Homo sapiens GN=SOX18 PE=1 SV=2 94 171 2.0E-06
sp|Q90ZH9|S17AB_XENLA Transcription factor Sox-17-alpha-B OS=Xenopus laevis GN=sox17a-b PE=1 SV=1 94 168 2.0E-06
sp|Q04887|SOX9_MOUSE Transcription factor SOX-9 OS=Mus musculus GN=Sox9 PE=2 SV=2 93 168 2.0E-06
sp|Q9BG91|SOX9_CALJA Transcription factor SOX-9 OS=Callithrix jacchus GN=SOX9 PE=2 SV=1 93 168 3.0E-06
sp|Q7YRJ7|SOX9_CANLF Transcription factor SOX-9 OS=Canis lupus familiaris GN=SOX9 PE=2 SV=1 93 168 3.0E-06
sp|Q6DFF5|SOX9B_XENLA Transcription factor Sox-9-B OS=Xenopus laevis GN=sox9-b PE=2 SV=1 93 187 3.0E-06
sp|P61754|SOX9_PONPY Transcription factor SOX-9 OS=Pongo pygmaeus GN=SOX9 PE=2 SV=1 93 168 3.0E-06
sp|P61753|SOX9_MACMU Transcription factor SOX-9 OS=Macaca mulatta GN=SOX9 PE=2 SV=1 93 168 3.0E-06
sp|P48436|SOX9_HUMAN Transcription factor SOX-9 OS=Homo sapiens GN=SOX9 PE=1 SV=1 93 168 3.0E-06
sp|O18896|SOX9_PIG Transcription factor SOX-9 OS=Sus scrofa GN=SOX9 PE=2 SV=1 93 168 3.0E-06
sp|Q05738|SRY_MOUSE Sex-determining region Y protein OS=Mus musculus GN=Sry PE=1 SV=2 95 171 3.0E-06
sp|Q62565|SRY_MUSSI Sex-determining region Y protein OS=Mus spicilegus GN=Sry PE=3 SV=2 95 171 3.0E-06
sp|P48434|SOX9_CHICK Transcription factor SOX-9 OS=Gallus gallus GN=SOX9 PE=1 SV=3 93 168 3.0E-06
sp|Q8AWH3|SX17A_XENTR Transcription factor Sox-17-alpha OS=Xenopus tropicalis GN=sox17a PE=2 SV=1 94 168 4.0E-06
sp|Q9BG89|SOX9_PANTR Transcription factor SOX-9 OS=Pan troglodytes GN=SOX9 PE=2 SV=1 93 168 4.0E-06
sp|B7ZR65|SOX9A_XENLA Transcription factor Sox-9-A OS=Xenopus laevis GN=sox9-a PE=1 SV=1 93 168 5.0E-06
sp|Q3KQ35|S17AA_XENLA Transcription factor Sox-17-alpha-A OS=Xenopus laevis GN=sox17a-a PE=1 SV=1 94 168 6.0E-06
sp|Q6F2E7|SOX9_XENTR Transcription factor Sox-9 OS=Xenopus tropicalis GN=sox9 PE=1 SV=1 93 168 6.0E-06
sp|O42601|S17B1_XENLA Transcription factor Sox-17-beta.1 OS=Xenopus laevis GN=sox17b.1 PE=1 SV=1 94 184 6.0E-06
sp|Q28EW4|SOX13_XENTR Transcription factor Sox-13 OS=Xenopus tropicalis GN=sox13 PE=2 SV=1 95 167 8.0E-06
sp|P40637|AES1_ALLMI SRY-related protein AES1 (Fragment) OS=Alligator mississippiensis PE=3 SV=1 95 166 8.0E-06
sp|P40649|SOX13_XENLA Transcription factor Sox-13 OS=Xenopus laevis GN=sox13 PE=2 SV=3 95 221 8.0E-06
sp|P40636|ADW5_ALLMI SRY-related protein ADW5 (Fragment) OS=Alligator mississippiensis PE=3 SV=2 95 166 9.0E-06
sp|Q6F2F0|S17B3_XENTR Transcription factor Sox-17-beta.3 OS=Xenopus tropicalis GN=sox17b.3 PE=3 SV=2 94 220 9.0E-06
sp|A5D8R3|S17B3_XENLA Transcription factor Sox-17-beta.3 OS=Xenopus laevis GN=sox17b.3 PE=2 SV=1 94 168 9.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 15 0.45

Transmembrane Domains

(None)

Transcription Factor Class

Transcription Factor Class
(based on PFAM domains)
HMG

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|5980
MSPVLALAARQMDAVRVPLHIGIDHHRHSPLTPLSTPSSTPVGSHRSQPHRSPSLAAGPGPGLDAMPAPSNPSAA
AHKRQGSQGLVCLCAPAPKIPRPRNAFILYRQHHQAQVTADNPRLSNPDISKIIGGQWKMESDEVKQTWKRLADE
EKQRHQNQYPHYRYQPRRSTKPQGSWPGASPSDDQARCPKCNGKSVAGPQTPSTPVSEPSSVKLAAAAQGPSLPR
LDSALSRRTSFDLSPSSSLPSVPRLLPSVRDMHLNEPSSPPDMKRRRADDSGNYHAVDWRSSSYPGKPHALASRE
MPSSSGYARTPLPELRNLARPQSGHMPPPLHPPPSGWLDKDPPDNRRADFDESLRLPPLQASVPAFPSRGILADA
RQNSVCLPPPPACGSLREGSGRERQPQAKTLKDAIMSIPLQKKIAVLAGICQPIPPLAPDSNSAGDTRGAFISIE
GADPRQLREVGDALEAGLAACGDYLVRVWRDDKDERLTPDDDDMNPLSQPGRHDARRYGDMFEPYINAISAWQKK
SRQIGRHVTGKTQEQKLAKELRQGASSKTPVALARDGFSLTIADRYACAMPIVDMYAPADHWQWMATLWRGTVSP
DLIIYVMSRDEADAADGTGVELSARQGLITVKLPPDTALDEATSRRLTFEVLEWMRRGSFRHEVPQGWRAGAW*
Coding >OphauB2|5980
ATGTCCCCCGTGCTTGCCCTGGCTGCCCGTCAAATGGATGCTGTGCGAGTTCCCCTACACATTGGCATAGACCAC
CATAGACACTCGCCCTTGACTCCCCTCAGCACGCCCAGCAGCACTCCCGTCGGCTCTCACCGGAGCCAGCCTCAC
CGGAGCCCGTCGCTGGCAGCTGGCCCTGGCCCTGGCCTGGATGCCATGCCGGCGCCCTCCAACCCGTCCGCAGCG
GCTCACAAGCGCCAGGGCTCGCAGGGCCTCGTGTGCCTGTGTGCCCCGGCGCCCAAGATCCCTCGCCCGCGCAAT
GCATTCATCCTCTACCGGCAGCACCACCAGGCCCAGGTCACGGCCGACAACCCGCGGCTGTCCAATCCAGACATC
TCCAAGATCATAGGCGGCCAGTGGAAGATGGAGAGCGACGAGGTCAAGCAGACGTGGAAGAGGCTGGCCGACGAG
GAGAAGCAGCGCCACCAGAACCAGTATCCTCACTATCGCTACCAGCCCCGGCGCAGCACCAAACCCCAGGGCTCC
TGGCCCGGCGCCTCGCCATCCGACGACCAAGCCCGCTGCCCCAAGTGCAACGGCAAGTCGGTAGCAGGCCCCCAG
ACGCCATCAACGCCCGTCAGCGAGCCGTCGTCTGTCAAGCTGGCAGCGGCGGCCCAGGGCCCCAGTCTCCCTCGC
CTCGACTCGGCCCTGTCACGCCGCACCAGCTTTGATCTTTCGCCGTCAAGCTCGCTGCCCTCGGTCCCCAGGCTG
CTGCCCTCGGTCAGAGACATGCATCTCAATGAGCCGTCGTCACCCCCTGACATGAAGCGGCGCCGGGCCGACGAC
AGCGGCAACTATCATGCTGTTGACTGGCGCTCGAGCAGCTACCCCGGCAAGCCGCACGCTCTGGCATCGCGAGAG
ATGCCGTCGTCGAGCGGATACGCCCGGACGCCTCTGCCGGAGCTCAGGAACCTGGCCCGACCCCAGAGCGGCCAT
ATGCCCCCGCCGCTGCACCCGCCGCCCTCGGGCTGGCTGGATAAGGACCCTCCGGATAATCGCCGCGCTGACTTT
GACGAGTCTCTACGTCTGCCGCCGCTGCAGGCCTCTGTGCCTGCTTTCCCGTCACGCGGCATCTTGGCCGACGCG
CGACAGAACTCGGTGTGTCTGCCGCCGCCACCGGCATGTGGCTCGCTGCGAGAGGGCTCAGGGCGCGAGAGACAG
CCGCAGGCCAAGACGCTCAAGGATGCAATCATGTCCATCCCGCTCCAGAAAAAGATTGCCGTCTTGGCCGGCATC
TGTCAGCCCATCCCGCCGCTGGCACCAGACAGCAACAGCGCAGGCGACACTCGGGGCGCCTTCATCTCCATTGAG
GGGGCCGACCCGCGGCAGCTCCGAGAGGTGGGCGATGCCCTGGAAGCAGGCCTCGCAGCGTGCGGCGACTACCTG
GTGCGCGTGTGGCGAGACGACAAGGACGAGCGCCTGACGCCAGACGACGACGACATGAACCCGCTGTCGCAGCCT
GGCCGCCACGATGCCAGACGCTATGGCGACATGTTTGAGCCCTACATCAATGCAATCTCGGCGTGGCAGAAGAAG
TCTAGGCAAATAGGCCGGCACGTCACGGGCAAGACTCAGGAGCAAAAGCTGGCCAAAGAGCTGCGTCAAGGCGCC
AGCAGCAAGACGCCCGTGGCCCTGGCCCGAGATGGCTTCAGCCTGACCATTGCCGATCGCTACGCCTGTGCCATG
CCCATTGTCGACATGTATGCGCCCGCAGACCACTGGCAGTGGATGGCGACCCTGTGGCGTGGGACTGTCAGTCCC
GATCTCATCATCTACGTCATGTCACGAGATGAGGCAGATGCGGCAGACGGAACAGGCGTCGAGCTCTCGGCCCGC
CAGGGGCTCATTACCGTCAAGCTGCCGCCAGACACGGCCCTCGACGAGGCCACGTCGCGGCGCCTTACATTTGAG
GTGCTTGAGTGGATGCGCCGGGGATCTTTTCGCCACGAGGTGCCCCAGGGCTGGCGAGCGGGAGCATGGTGA
Transcript >OphauB2|5980
ATGTCCCCCGTGCTTGCCCTGGCTGCCCGTCAAATGGATGCTGTGCGAGTTCCCCTACACATTGGCATAGACCAC
CATAGACACTCGCCCTTGACTCCCCTCAGCACGCCCAGCAGCACTCCCGTCGGCTCTCACCGGAGCCAGCCTCAC
CGGAGCCCGTCGCTGGCAGCTGGCCCTGGCCCTGGCCTGGATGCCATGCCGGCGCCCTCCAACCCGTCCGCAGCG
GCTCACAAGCGCCAGGGCTCGCAGGGCCTCGTGTGCCTGTGTGCCCCGGCGCCCAAGATCCCTCGCCCGCGCAAT
GCATTCATCCTCTACCGGCAGCACCACCAGGCCCAGGTCACGGCCGACAACCCGCGGCTGTCCAATCCAGACATC
TCCAAGATCATAGGCGGCCAGTGGAAGATGGAGAGCGACGAGGTCAAGCAGACGTGGAAGAGGCTGGCCGACGAG
GAGAAGCAGCGCCACCAGAACCAGTATCCTCACTATCGCTACCAGCCCCGGCGCAGCACCAAACCCCAGGGCTCC
TGGCCCGGCGCCTCGCCATCCGACGACCAAGCCCGCTGCCCCAAGTGCAACGGCAAGTCGGTAGCAGGCCCCCAG
ACGCCATCAACGCCCGTCAGCGAGCCGTCGTCTGTCAAGCTGGCAGCGGCGGCCCAGGGCCCCAGTCTCCCTCGC
CTCGACTCGGCCCTGTCACGCCGCACCAGCTTTGATCTTTCGCCGTCAAGCTCGCTGCCCTCGGTCCCCAGGCTG
CTGCCCTCGGTCAGAGACATGCATCTCAATGAGCCGTCGTCACCCCCTGACATGAAGCGGCGCCGGGCCGACGAC
AGCGGCAACTATCATGCTGTTGACTGGCGCTCGAGCAGCTACCCCGGCAAGCCGCACGCTCTGGCATCGCGAGAG
ATGCCGTCGTCGAGCGGATACGCCCGGACGCCTCTGCCGGAGCTCAGGAACCTGGCCCGACCCCAGAGCGGCCAT
ATGCCCCCGCCGCTGCACCCGCCGCCCTCGGGCTGGCTGGATAAGGACCCTCCGGATAATCGCCGCGCTGACTTT
GACGAGTCTCTACGTCTGCCGCCGCTGCAGGCCTCTGTGCCTGCTTTCCCGTCACGCGGCATCTTGGCCGACGCG
CGACAGAACTCGGTGTGTCTGCCGCCGCCACCGGCATGTGGCTCGCTGCGAGAGGGCTCAGGGCGCGAGAGACAG
CCGCAGGCCAAGACGCTCAAGGATGCAATCATGTCCATCCCGCTCCAGAAAAAGATTGCCGTCTTGGCCGGCATC
TGTCAGCCCATCCCGCCGCTGGCACCAGACAGCAACAGCGCAGGCGACACTCGGGGCGCCTTCATCTCCATTGAG
GGGGCCGACCCGCGGCAGCTCCGAGAGGTGGGCGATGCCCTGGAAGCAGGCCTCGCAGCGTGCGGCGACTACCTG
GTGCGCGTGTGGCGAGACGACAAGGACGAGCGCCTGACGCCAGACGACGACGACATGAACCCGCTGTCGCAGCCT
GGCCGCCACGATGCCAGACGCTATGGCGACATGTTTGAGCCCTACATCAATGCAATCTCGGCGTGGCAGAAGAAG
TCTAGGCAAATAGGCCGGCACGTCACGGGCAAGACTCAGGAGCAAAAGCTGGCCAAAGAGCTGCGTCAAGGCGCC
AGCAGCAAGACGCCCGTGGCCCTGGCCCGAGATGGCTTCAGCCTGACCATTGCCGATCGCTACGCCTGTGCCATG
CCCATTGTCGACATGTATGCGCCCGCAGACCACTGGCAGTGGATGGCGACCCTGTGGCGTGGGACTGTCAGTCCC
GATCTCATCATCTACGTCATGTCACGAGATGAGGCAGATGCGGCAGACGGAACAGGCGTCGAGCTCTCGGCCCGC
CAGGGGCTCATTACCGTCAAGCTGCCGCCAGACACGGCCCTCGACGAGGCCACGTCGCGGCGCCTTACATTTGAG
GTGCTTGAGTGGATGCGCCGGGGATCTTTTCGCCACGAGGTGCCCCAGGGCTGGCGAGCGGGAGCATGGTGA
Gene >OphauB2|5980
ATGTCCCCCGTGCTTGCCCTGGCTGCCCGTCAAATGGATGCTGTGCGAGTTCCCCTACACATTGGCATAGACCAC
CATAGACACTCGCCCTTGACTCCCCTCAGCACGCCCAGCAGCACTCCCGTCGGCTCTCACCGGAGCCAGCCTCAC
CGGAGCCCGTCGCTGGCAGCTGGCCCTGGCCCTGGCCTGGATGCCATGCCGGCGCCCTCCAACCCGTCCGCAGCG
GCTCACAAGCGCCAGGGCTCGCAGGGCCTCGTGTGCCTGTGTGCCCCGGCGCCCAAGATCCCTCGCCCGCGCAAT
GGTAAGTCGTCTTGCTGCTGCGGCCCAGCCGTGACTGACAAGGCCAGCATTCATCCTCTACCGGCAGCACCACCA
GGCCCAGGTCACGGCCGACAACCCGCGGCTGTCCAATCCAGACATCTCCAAGATCATAGGCGGCCAGTGGAAGAT
GGAGAGCGACGAGGTCAAGCAGACGTGGAAGAGGCTGGCCGACGAGGAGAAGCAGCGCCACCAGAACCAGTATCC
TCACTATCGCTACCAGCCCCGGCGCAGCACCAAACCCCAGGGCTCCTGGCCCGGCGCCTCGCCATCCGACGACCA
AGCCCGCTGCCCCAAGTGCAACGGCAAGTCGGTAGCAGGCCCCCAGACGCCATCAACGCCCGTCAGCGAGCCGTC
GTCTGTCAAGCTGGCAGCGGCGGCCCAGGGCCCCAGTCTCCCTCGCCTCGACTCGGCCCTGTCACGCCGCACCAG
CTTTGATCTTTCGCCGTCAAGCTCGCTGCCCTCGGTCCCCAGGCTGCTGCCCTCGGTCAGAGACATGCATCTCAA
TGAGCCGTCGTCACCCCCTGACATGAAGCGGCGCCGGGCCGACGACAGCGGCAACTATCATGCTGTTGACTGGCG
CTCGAGCAGCTACCCCGGCAAGCCGCACGCTCTGGCATCGCGAGAGATGCCGTCGTCGAGCGGATACGCCCGGAC
GCCTCTGCCGGAGCTCAGGAACCTGGCCCGACCCCAGAGCGGCCATATGCCCCCGCCGCTGCACCCGCCGCCCTC
GGGCTGGCTGGATAAGGACCCTCCGGATAATCGCCGCGCTGACTTTGACGAGTCTCTACGTCTGCCGCCGCTGCA
GGCCTCTGTGCCTGCTTTCCCGTCACGCGGCATCTTGGCCGACGCGCGACAGAACTCGGTGTGTCTGCCGCCGCC
ACCGGCATGTGGCTCGCTGCGAGAGGGCTCAGGGCGCGAGAGACAGCCGCAGGCCAAGACGCTCAAGGATGCAAT
CATGTCCATCCCGCTCCAGAAAAAGATTGCCGTCTTGGCCGGCATCTGTCAGCCCATCCCGCCGCTGGCACCAGA
CAGCAACAGCGCAGGCGACACTCGGGGCGCCTTCATCTCCATTGAGGGGGCCGACCCGCGGCAGCTCCGAGAGGT
GGGCGATGCCCTGGAAGCAGGCCTCGCAGCGTGCGGCGACTACCTGGTGCGCGTGTGGCGAGACGACAAGGACGA
GCGCCTGACGCCAGACGACGACGACATGAACCCGCTGTCGCAGCCTGGCCGCCACGATGCCAGACGCTATGGCGA
CATGTTTGAGCCCTACATCAATGCAATCTCGGCGTGGCAGAAGAAGTCTAGGCAAATAGGCCGGCACGTCACGGG
CAAGACTCAGGAGCAAAAGCTGGCCAAAGAGCTGCGTCAAGGCGCCAGCAGCAAGACGCCCGTGGCCCTGGCCCG
AGATGGCTTCAGCCTGACCATTGCCGATCGCTACGCCTGTGCCATGCCCATTGTCGACATGTATGCGCCCGCAGA
CCACTGGCAGTGGATGGCGACCCTGTGGCGTGGGACTGTCAGTCCCGATCTCATCATCTACGTCATGTCACGAGA
TGAGGCAGATGCGGCAGACGGAACAGGCGTCGAGCTCTCGGCCCGCCAGGGGCTCATTACCGTCAAGCTGCCGCC
AGACACGGCCCTCGACGAGGCCACGTCGCGGCGCCTTACATTTGAGGTGCTTGAGTGGATGCGCCGGGGATCTTT
TCGCCACGAGGTGCCCCAGGGCTGGCGAGCGGGAGCATGGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail