Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|598
Gene name
LocationContig_11:211740..213771
Strand+
Gene length (bp)2031
Transcript length (bp)1692
Coding sequence length (bp)1692
Protein length (aa) 564

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18 1.4E-09 9 157

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q5AKZ3|CHI5_CANAL Probable chitinase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CaO19.12451 PE=3 SV=1 3 165 5.0E-16
sp|Q9W5U2|CHIT3_DROME Probable chitinase 3 OS=Drosophila melanogaster GN=Cht3 PE=2 SV=2 1 201 1.0E-12
sp|P09805|KTXA_KLULA Killer toxin subunits alpha/beta OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) PE=1 SV=1 1 155 3.0E-12
sp|Q9W5U2|CHIT3_DROME Probable chitinase 3 OS=Drosophila melanogaster GN=Cht3 PE=2 SV=2 2 163 6.0E-09
sp|Q28542|OVGP1_SHEEP Oviduct-specific glycoprotein OS=Ovis aries GN=OVGP1 PE=1 SV=1 1 164 9.0E-08
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q5AKZ3|CHI5_CANAL Probable chitinase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CaO19.12451 PE=3 SV=1 3 165 5.0E-16
sp|Q9W5U2|CHIT3_DROME Probable chitinase 3 OS=Drosophila melanogaster GN=Cht3 PE=2 SV=2 1 201 1.0E-12
sp|P09805|KTXA_KLULA Killer toxin subunits alpha/beta OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) PE=1 SV=1 1 155 3.0E-12
sp|Q9W5U2|CHIT3_DROME Probable chitinase 3 OS=Drosophila melanogaster GN=Cht3 PE=2 SV=2 2 163 6.0E-09
sp|Q28542|OVGP1_SHEEP Oviduct-specific glycoprotein OS=Ovis aries GN=OVGP1 PE=1 SV=1 1 164 9.0E-08
sp|P36718|OVGP1_PAPAN Oviduct-specific glycoprotein OS=Papio anubis GN=OVGP1 PE=2 SV=2 1 185 1.0E-07
sp|Q9W5U2|CHIT3_DROME Probable chitinase 3 OS=Drosophila melanogaster GN=Cht3 PE=2 SV=2 1 159 2.0E-07
sp|P36362|CHIT_MANSE Endochitinase OS=Manduca sexta PE=2 SV=1 28 159 2.0E-07
sp|Q60557|OVGP1_MESAU Oviduct-specific glycoprotein OS=Mesocricetus auratus GN=OVGP1 PE=1 SV=1 1 225 4.0E-07
sp|Q28042|OVGP1_BOVIN Oviduct-specific glycoprotein (Fragment) OS=Bos taurus GN=OVGP1 PE=1 SV=1 1 159 5.0E-07
sp|P29030|CHIT_BRUMA Endochitinase OS=Brugia malayi PE=1 SV=1 1 159 9.0E-07
sp|Q28990|OVGP1_PIG Oviduct-specific glycoprotein OS=Sus scrofa GN=OVGP1 PE=2 SV=1 1 194 1.0E-06
sp|Q12889|OVGP1_HUMAN Oviduct-specific glycoprotein OS=Homo sapiens GN=OVGP1 PE=2 SV=1 1 185 3.0E-06
sp|Q95M17|CHIA_BOVIN Acidic mammalian chitinase OS=Bos taurus GN=CHIA PE=1 SV=1 30 159 4.0E-06
sp|Q9W5U2|CHIT3_DROME Probable chitinase 3 OS=Drosophila melanogaster GN=Cht3 PE=2 SV=2 2 163 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0005975 carbohydrate metabolic process Yes
GO:0044238 primary metabolic process No
GO:0008152 metabolic process No
GO:0008150 biological_process No
GO:0071704 organic substance metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|598
MHGQWDHGSPFSNPGCPKGNCLRSQVNRTETEQSFSMITKAGVASHKVMVGLPLYGRSFQMTQPGCYTEMCTFTG
PESGAVAGKCTNAAGYISNWEIDQIVQAAGNNVQHYSSNVAGDIIVYNSTQWISYMKPETRRGRRDWARSLGFGG
TSDWAMDLETSNNNKGSGSRKGSGPVYIHPSILTQPGATIACEPPCTFIFPPWTLPTSTVISREPVTETILELHP
WVENLGHGTSRTVFVSRTTITTISLSPVTTDTISLRNIHWTNVSQTIINLTSSVRFPPTILTESPLHVTSSSTAS
KTVAGIMYTYSPEPYSGPSSTPTSKSGHSGPPSGLASSIHVTVGPAGPTCVPGSKGCGSLCEGLCDAKPPCIGIC
GCIGLGCPGGGSCVGFGCDEDDDEESSSKTPCSTKHTVTDCQVDCSVTNFGTSSTTTCYSTSCVTGEACSKTEAA
GRPSDGAVPLLGAGGDAGYTYITGTRLAPKSAAKPKAHCQVEIFDIEGWATDLGRKLLAEERGCGALTGWEWHQA
TLSTPAWAAFNLPLILAPRCVERAIVSSGGPLITCYGV*
Coding >OphauB2|598
ATGCATGGCCAATGGGACCATGGCAGTCCCTTTAGCAACCCAGGATGTCCCAAGGGCAACTGTCTTCGGTCGCAG
GTCAACCGTACCGAGACTGAGCAGTCATTTTCCATGATTACAAAAGCTGGTGTTGCTTCCCACAAGGTCATGGTT
GGGCTTCCGCTATATGGACGCAGCTTTCAAATGACACAGCCTGGCTGCTATACAGAAATGTGCACCTTTACCGGC
CCAGAGAGTGGCGCAGTTGCTGGGAAATGCACAAACGCAGCCGGCTACATTAGCAACTGGGAGATTGACCAGATT
GTTCAAGCTGCAGGCAATAATGTCCAGCACTATTCCTCAAACGTTGCGGGAGACATTATAGTGTATAATAGCACT
CAGTGGATTTCGTACATGAAGCCAGAAACACGAAGGGGTCGACGCGATTGGGCTCGCTCACTTGGTTTCGGAGGA
ACATCTGACTGGGCCATGGACCTTGAGACAAGCAACAACAACAAGGGAAGCGGCTCGCGAAAAGGCTCCGGCCCT
GTTTATATCCATCCCAGCATCTTGACTCAGCCCGGTGCAACAATAGCATGCGAACCGCCATGCACTTTTATATTC
CCGCCCTGGACTTTGCCTACGAGTACTGTCATTTCTCGAGAGCCTGTTACGGAAACAATTCTGGAACTCCATCCG
TGGGTGGAGAATCTAGGCCATGGTACTAGCAGGACCGTCTTCGTCTCTCGCACGACCATTACAACGATTTCTCTC
TCTCCTGTCACGACGGATACAATCTCATTGCGGAACATACATTGGACAAATGTGAGCCAGACCATTATCAATTTG
ACAAGCAGCGTGCGTTTCCCTCCCACCATCTTGACGGAGAGCCCTTTGCATGTCACGTCAAGCAGCACAGCATCA
AAAACTGTCGCCGGAATCATGTACACCTACAGTCCAGAGCCCTATTCGGGGCCGAGTTCAACGCCCACCTCCAAG
TCGGGACACTCAGGGCCGCCATCCGGTCTAGCATCTTCCATTCATGTCACCGTAGGGCCAGCTGGGCCCACATGT
GTTCCTGGATCCAAGGGGTGCGGCTCTCTATGCGAAGGCCTGTGTGACGCCAAACCTCCTTGCATTGGCATCTGC
GGCTGCATCGGTCTCGGGTGCCCCGGCGGCGGCTCCTGCGTGGGGTTTGGCTGTGATGAAGATGACGACGAAGAA
TCATCCTCCAAAACACCTTGCAGCACAAAGCACACAGTCACAGATTGCCAGGTGGACTGTTCCGTCACCAACTTT
GGCACATCATCGACAACGACATGCTATAGCACTAGCTGCGTTACTGGCGAGGCCTGTTCGAAAACTGAGGCTGCC
GGGAGGCCCTCGGATGGAGCAGTGCCTTTGCTTGGCGCTGGTGGTGATGCCGGCTACACCTATATTACCGGTACC
CGACTGGCCCCCAAAAGCGCCGCCAAGCCCAAGGCTCATTGCCAAGTTGAAATCTTTGACATTGAGGGCTGGGCC
ACAGACCTTGGTAGAAAGCTGCTGGCCGAGGAGCGAGGATGCGGCGCCTTGACGGGCTGGGAGTGGCACCAAGCC
ACTTTATCAACGCCCGCTTGGGCTGCCTTTAATCTTCCCTTGATATTGGCGCCTCGATGTGTGGAAAGGGCTATT
GTGTCGTCGGGCGGGCCTTTGATTACCTGCTACGGGGTTTAA
Transcript >OphauB2|598
ATGCATGGCCAATGGGACCATGGCAGTCCCTTTAGCAACCCAGGATGTCCCAAGGGCAACTGTCTTCGGTCGCAG
GTCAACCGTACCGAGACTGAGCAGTCATTTTCCATGATTACAAAAGCTGGTGTTGCTTCCCACAAGGTCATGGTT
GGGCTTCCGCTATATGGACGCAGCTTTCAAATGACACAGCCTGGCTGCTATACAGAAATGTGCACCTTTACCGGC
CCAGAGAGTGGCGCAGTTGCTGGGAAATGCACAAACGCAGCCGGCTACATTAGCAACTGGGAGATTGACCAGATT
GTTCAAGCTGCAGGCAATAATGTCCAGCACTATTCCTCAAACGTTGCGGGAGACATTATAGTGTATAATAGCACT
CAGTGGATTTCGTACATGAAGCCAGAAACACGAAGGGGTCGACGCGATTGGGCTCGCTCACTTGGTTTCGGAGGA
ACATCTGACTGGGCCATGGACCTTGAGACAAGCAACAACAACAAGGGAAGCGGCTCGCGAAAAGGCTCCGGCCCT
GTTTATATCCATCCCAGCATCTTGACTCAGCCCGGTGCAACAATAGCATGCGAACCGCCATGCACTTTTATATTC
CCGCCCTGGACTTTGCCTACGAGTACTGTCATTTCTCGAGAGCCTGTTACGGAAACAATTCTGGAACTCCATCCG
TGGGTGGAGAATCTAGGCCATGGTACTAGCAGGACCGTCTTCGTCTCTCGCACGACCATTACAACGATTTCTCTC
TCTCCTGTCACGACGGATACAATCTCATTGCGGAACATACATTGGACAAATGTGAGCCAGACCATTATCAATTTG
ACAAGCAGCGTGCGTTTCCCTCCCACCATCTTGACGGAGAGCCCTTTGCATGTCACGTCAAGCAGCACAGCATCA
AAAACTGTCGCCGGAATCATGTACACCTACAGTCCAGAGCCCTATTCGGGGCCGAGTTCAACGCCCACCTCCAAG
TCGGGACACTCAGGGCCGCCATCCGGTCTAGCATCTTCCATTCATGTCACCGTAGGGCCAGCTGGGCCCACATGT
GTTCCTGGATCCAAGGGGTGCGGCTCTCTATGCGAAGGCCTGTGTGACGCCAAACCTCCTTGCATTGGCATCTGC
GGCTGCATCGGTCTCGGGTGCCCCGGCGGCGGCTCCTGCGTGGGGTTTGGCTGTGATGAAGATGACGACGAAGAA
TCATCCTCCAAAACACCTTGCAGCACAAAGCACACAGTCACAGATTGCCAGGTGGACTGTTCCGTCACCAACTTT
GGCACATCATCGACAACGACATGCTATAGCACTAGCTGCGTTACTGGCGAGGCCTGTTCGAAAACTGAGGCTGCC
GGGAGGCCCTCGGATGGAGCAGTGCCTTTGCTTGGCGCTGGTGGTGATGCCGGCTACACCTATATTACCGGTACC
CGACTGGCCCCCAAAAGCGCCGCCAAGCCCAAGGCTCATTGCCAAGTTGAAATCTTTGACATTGAGGGCTGGGCC
ACAGACCTTGGTAGAAAGCTGCTGGCCGAGGAGCGAGGATGCGGCGCCTTGACGGGCTGGGAGTGGCACCAAGCC
ACTTTATCAACGCCCGCTTGGGCTGCCTTTAATCTTCCCTTGATATTGGCGCCTCGATGTGTGGAAAGGGCTATT
GTGTCGTCGGGCGGGCCTTTGATTACCTGCTACGGGGTTTAA
Gene >OphauB2|598
ATGCATGGCCAATGGGACCATGGCAGTCCCTTTAGCAAGTACCCATGCCCCATCCACTTGTACATACATGATATA
CTCCTTGTCACCATCAAGCTGACAGCTCTCTTATTCCATCAGCCCAGGATGTCCCAAGGGCAACTGTCTTCGGTC
GCAGGTCAACCGTACCGAGACTGAGCAGTCATTTTCCATGATTACAAAAGCTGGTGTTGCTTCCCACAAGGTCAT
GGTTGGGCTTCCGCTATATGGACGCAGCTTTCAAATGACACAGCCTGGCTGCTATACAGAAATGTGTAAGATGGT
GTTTGAGAAAAGCCAGGCGCGGACAATGCTAACAATCTTGCCGCAGGCACCTTTACCGGCCCAGAGAGTGGCGCA
GTTGCTGGGAAATGCACAAACGCAGCCGGCTACATTAGCAACTGGGAGATTGACCAGATTGTTCAAGCTGCAGGC
AATAATGTCCAGCACTATTCCTCAAACGTTGCGGGAGACATTATAGTGTATAATAGCACTCAGTGGATTTCGTAC
ATGAAGCCAGAAACACGAAGGGGTCGACGCGATTGGGCTCGCTCACTTGGTTTCGGAGGAACATCTGACTGGGCC
ATGGACCTTGAGACAAGCAACAACAACAAGGGAAGCGGCTCGCGAAAAGGCTCCGGCCCTGTTTATATCCATCCC
AGCATCTTGACTCAGCCCGGTGCAACAATAGCATGCGAACCGCCATGCACTTTTATATTCCCGCCCTGGACTTTG
CCTACGAGTACTGTCATTTCTCGAGAGCCTGTTACGGAAACAATTCTGGAACTCCATCCGTGGGTGGAGAATCTA
GGCCATGGTACTAGCAGGACCGTCTTCGTCTCTCGCACGACCATTACAACGATTTCTCTCTCTCCTGTCACGACG
GATACAATCTCATTGCGGAACATACATTGGACAAATGTGAGCCAGACCATTATCAATTTGACAAGCAGCGTGCGT
TTCCCTCCCACCATCTTGACGGAGAGCCCTTTGCATGTCACGTCAAGCAGCACAGCATCAAAAACTGTCGCCGGA
ATCATGTACACCTACAGTCCAGAGCCCTATTCGGGGCCGAGTTCAACGCCCACCTCCAAGTCGGGACACTCAGGG
CCGCCATCCGGTCTAGCATCTTCCATTCATGTCACCGTAGGGCCAGCTGGGCCCACATGTGTTCCTGGATCCAAG
GGGTGCGGCTCTCTATGCGAAGGCCTGTGTGACGCCAAACCTCCTTGCATTGGCATCTGCGGCTGCATCGGTCTC
GGGTGCCCCGGCGGCGGCTCCTGCGTGGGGTTTGGCTGTGATGAAGATGACGACGAAGAATCATCCTCCAAAACA
CCTTGCAGCACAAAGCACACAGTCACAGATTGCCAGGTGGACTGTTCCGTCACCAACTTTGGCACATCATCGACA
ACGACATGCTATAGCACTAGCTGCGTTACTGGCGAGGCCTGTTCGAAAACTGGTTCGACCAGCACTTCCTTGACA
ACAAGCTTTGACTGTCCATGGACGACGGCGCTAGAGGCTGCCGGGAGGCCCTCGGATGGAGCAGTGCCTTTGCTT
GGCGCTGGTGGTGATGCCGGCTACACCTATATTACCGGTACCCGACTGGCCCCCAAAAGTCACTCAAGCACCACC
AAACAAGAAGCCTCGGCGACACAAGCGCCCACCACAAGCCCGACAGGCGCCGCCAAGCCCAAGGCTCATTGCCAA
GTTGAGTAAGTTGACCGAGACGCGGCATCTGCTTCCGCCACTCAGGCTGACCTGTTTGCAAGCAATGACTTGTTT
TTCTTGTCCTACAGAATCTTTGACATTGAGGGCTGGGCCACAGACCTTGGTAGAAAGCTGCTGGCCGAGGAGCGA
GGATGCGGCGCCTTGACGGGCTGGGAGTGGCACCAAGCCACTTTATCAACGCCCGCTTGGGCTGCCTTTAATCTT
CCCTTGATATTGGCGCCTCGATGTGTGGAAAGGGCTATTGTGTCGTCGGGCGGGCCTTTGATTACCTGCTACGGG
GTTTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail