Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|5972
Gene name
LocationContig_5:321427..322904
Strand+
Gene length (bp)1477
Transcript length (bp)1413
Coding sequence length (bp)1413
Protein length (aa) 471

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07992 Pyr_redox_2 Pyridine nucleotide-disulphide oxidoreductase 1.9E-61 9 334
PF02852 Pyr_redox_dim Pyridine nucleotide-disulphide oxidoreductase, dimerisation domain 1.1E-32 357 468
PF00070 Pyr_redox Pyridine nucleotide-disulphide oxidoreductase 3.5E-19 179 257
PF13738 Pyr_redox_3 Pyridine nucleotide-disulphide oxidoreductase 6.4E-14 11 318

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q873E8|GSHR_NEUCR Glutathione reductase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=gtr-1 PE=3 SV=1 1 470 0.0E+00
sp|Q74ZK4|GSHR_ASHGO Glutathione reductase OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=GLR1 PE=3 SV=1 1 470 0.0E+00
sp|Q6FRV2|GSHR_CANGA Glutathione reductase OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=GLR1 PE=3 SV=1 1 470 0.0E+00
sp|P41921|GSHR_YEAST Glutathione reductase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GLR1 PE=1 SV=2 1 470 0.0E+00
sp|Q6HA23|GSHR_KLULA Glutathione reductase OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=GLR1 PE=1 SV=1 1 469 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q873E8|GSHR_NEUCR Glutathione reductase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=gtr-1 PE=3 SV=1 1 470 0.0E+00
sp|Q74ZK4|GSHR_ASHGO Glutathione reductase OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=GLR1 PE=3 SV=1 1 470 0.0E+00
sp|Q6FRV2|GSHR_CANGA Glutathione reductase OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=GLR1 PE=3 SV=1 1 470 0.0E+00
sp|P41921|GSHR_YEAST Glutathione reductase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GLR1 PE=1 SV=2 1 470 0.0E+00
sp|Q6HA23|GSHR_KLULA Glutathione reductase OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=GLR1 PE=1 SV=1 1 469 0.0E+00
sp|Q6C5H4|GSHR_YARLI Glutathione reductase OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=GLR1 PE=3 SV=1 9 470 0.0E+00
sp|P78965|GSHR_SCHPO Glutathione reductase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pgr1 PE=3 SV=2 1 469 0.0E+00
sp|Q6BPI1|GSHR_DEBHA Glutathione reductase OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=GLR1 PE=3 SV=3 1 470 2.0E-164
sp|P47791|GSHR_MOUSE Glutathione reductase, mitochondrial OS=Mus musculus GN=Gsr PE=1 SV=3 2 470 2.0E-158
sp|A2TIL1|GSHR_CALJA Glutathione reductase, mitochondrial OS=Callithrix jacchus GN=GSR PE=2 SV=1 9 470 1.0E-156
sp|P00390|GSHR_HUMAN Glutathione reductase, mitochondrial OS=Homo sapiens GN=GSR PE=1 SV=2 9 470 3.0E-154
sp|Q8T137|GSHR_DICDI Glutathione reductase OS=Dictyostelium discoideum GN=gsr PE=3 SV=2 5 469 1.0E-144
sp|P43783|GSHR_HAEIN Glutathione reductase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=gor PE=3 SV=1 4 470 2.0E-144
sp|P06715|GSHR_ECOLI Glutathione reductase OS=Escherichia coli (strain K12) GN=gor PE=1 SV=1 27 470 2.0E-143
sp|Q60151|GSHR_STRTR Glutathione reductase OS=Streptococcus thermophilus GN=gor PE=3 SV=1 4 470 1.0E-139
sp|P70619|GSHR_RAT Glutathione reductase (Fragment) OS=Rattus norvegicus GN=Gsr PE=2 SV=2 47 470 7.0E-139
sp|D0VWY5|GASHR_MARGR Glutathione amide reductase OS=Marichromatium gracile GN=garB PE=1 SV=1 4 470 2.0E-134
sp|P23189|GSHR_PSEAE Glutathione reductase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=gor PE=3 SV=1 9 470 2.0E-116
sp|O15770|GSHR_PLAF7 Glutathione reductase OS=Plasmodium falciparum (isolate 3D7) GN=GR3 PE=2 SV=4 31 470 3.0E-109
sp|Q94655|GSHR_PLAFK Glutathione reductase OS=Plasmodium falciparum (isolate K1 / Thailand) GN=GR2 PE=1 SV=3 31 470 8.0E-109
sp|P42770|GSHRP_ARATH Glutathione reductase, chloroplastic OS=Arabidopsis thaliana GN=EMB2360 PE=2 SV=1 9 470 6.0E-108
sp|P80461|GSHRP_TOBAC Glutathione reductase, chloroplastic (Fragment) OS=Nicotiana tabacum GN=GOR PE=1 SV=1 2 470 3.0E-107
sp|P27456|GSHRP_PEA Glutathione reductase, chloroplastic/mitochondrial OS=Pisum sativum GN=GR PE=2 SV=1 9 470 4.0E-105
sp|Q43154|GSHRP_SPIOL Glutathione reductase, chloroplastic (Fragment) OS=Spinacia oleracea PE=2 SV=1 9 470 2.0E-104
sp|Q43621|GSHRC_PEA Glutathione reductase, cytosolic OS=Pisum sativum PE=2 SV=1 9 470 4.0E-104
sp|P48640|GSHRP_SOYBN Glutathione reductase, chloroplastic OS=Glycine max GN=GR PE=2 SV=1 3 470 9.0E-104
sp|P48639|GSHR_BURCE Glutathione reductase OS=Burkholderia cepacia GN=gor PE=3 SV=1 9 470 1.0E-101
sp|O04955|GSHRC_BRARP Glutathione reductase, cytosolic OS=Brassica rapa subsp. pekinensis GN=GR1 PE=2 SV=2 9 470 6.0E-100
sp|P48641|GSHRC_ARATH Glutathione reductase, cytosolic OS=Arabidopsis thaliana GN=At3g24170 PE=2 SV=1 9 470 4.0E-99
sp|P48638|GSHR_NOSS1 Glutathione reductase OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=gor PE=3 SV=2 4 470 1.0E-95
sp|Q9JLT4|TRXR2_MOUSE Thioredoxin reductase 2, mitochondrial OS=Mus musculus GN=Txnrd2 PE=1 SV=4 9 469 1.0E-95
sp|Q9N2I8|TRXR2_BOVIN Thioredoxin reductase 2, mitochondrial OS=Bos taurus GN=TXNRD2 PE=1 SV=2 9 470 1.0E-94
sp|P48642|GSHRC_ORYSJ Glutathione reductase, cytosolic OS=Oryza sativa subsp. japonica GN=GRC2 PE=2 SV=2 9 470 2.0E-94
sp|Q9Z0J5|TRXR2_RAT Thioredoxin reductase 2, mitochondrial OS=Rattus norvegicus GN=Txnrd2 PE=1 SV=3 9 469 2.0E-93
sp|P30635|GSHR_CAEEL Probable glutathione reductase 2 OS=Caenorhabditis elegans GN=trxr-2 PE=3 SV=2 9 469 2.0E-87
sp|Q9NNW7|TRXR2_HUMAN Thioredoxin reductase 2, mitochondrial OS=Homo sapiens GN=TXNRD2 PE=1 SV=3 42 470 4.0E-87
sp|B9A1H3|TRXR1_EMIHU Thioredoxin reductase SEP1 OS=Emiliania huxleyi GN=SEP1 PE=1 SV=1 1 469 1.0E-86
sp|O62768|TRXR1_BOVIN Thioredoxin reductase 1, cytoplasmic OS=Bos taurus GN=TXNRD1 PE=2 SV=3 42 469 1.0E-85
sp|Q9JMH6|TRXR1_MOUSE Thioredoxin reductase 1, cytoplasmic OS=Mus musculus GN=Txnrd1 PE=1 SV=3 27 469 2.0E-84
sp|O89049|TRXR1_RAT Thioredoxin reductase 1, cytoplasmic OS=Rattus norvegicus GN=Txnrd1 PE=1 SV=5 42 469 7.0E-84
sp|P13110|TYTR_TRYCO Trypanothione reductase OS=Trypanosoma congolense GN=TPR PE=1 SV=1 4 470 3.0E-83
sp|Q5NVA2|TRXR1_PONAB Thioredoxin reductase 1, cytoplasmic OS=Pongo abelii GN=TXNRD1 PE=2 SV=3 42 469 7.0E-83
sp|Q9MYY8|TRXR1_PIG Thioredoxin reductase 1, cytoplasmic OS=Sus scrofa GN=TXNRD1 PE=2 SV=3 42 469 9.0E-83
sp|P39051|TYTR_TRYBB Trypanothione reductase OS=Trypanosoma brucei brucei GN=TPR PE=1 SV=1 4 470 4.0E-82
sp|P91938|TRXR1_DROME Thioredoxin reductase 1, mitochondrial OS=Drosophila melanogaster GN=Trxr-1 PE=1 SV=2 9 469 8.0E-82
sp|Q16881|TRXR1_HUMAN Thioredoxin reductase 1, cytoplasmic OS=Homo sapiens GN=TXNRD1 PE=1 SV=3 42 469 5.0E-81
sp|P28593|TYTR_TRYCR Trypanothione reductase OS=Trypanosoma cruzi GN=TPR PE=1 SV=1 4 470 5.0E-80
sp|Q99MD6|TRXR3_MOUSE Thioredoxin reductase 3 OS=Mus musculus GN=Txnrd3 PE=1 SV=3 42 470 2.0E-78
sp|Q86VQ6|TRXR3_HUMAN Thioredoxin reductase 3 OS=Homo sapiens GN=TXNRD3 PE=1 SV=4 42 470 3.0E-77
sp|Q9VNT5|TRXR2_DROME Thioredoxin reductase 2, mitochondrial OS=Drosophila melanogaster GN=Trxr-2 PE=2 SV=1 9 469 6.0E-77
sp|P39050|TYTR_LEIDO Trypanothione reductase OS=Leishmania donovani GN=TPR PE=3 SV=1 4 470 2.0E-76
sp|P39040|TYTR_CRIFA Trypanothione reductase OS=Crithidia fasciculata GN=TPR PE=1 SV=1 4 470 2.0E-76
sp|Q25861|TRXR_PLAF5 Thioredoxin reductase OS=Plasmodium falciparum (isolate FCH-5) GN=TR PE=1 SV=1 5 469 4.0E-71
sp|P61076|TRXR2_PLAF7 Thioredoxin reductase 2 OS=Plasmodium falciparum (isolate 3D7) GN=trxr2 PE=1 SV=2 5 469 1.0E-70
sp|Q17745|TRXR1_CAEEL Thioredoxin reductase 1 OS=Caenorhabditis elegans GN=trxr-1 PE=2 SV=3 42 469 1.0E-70
sp|P21880|DLDH1_BACSU Dihydrolipoyl dehydrogenase OS=Bacillus subtilis (strain 168) GN=pdhD PE=3 SV=1 7 464 1.0E-62
sp|Q9Z773|DLDH_CHLPN Dihydrolipoyl dehydrogenase OS=Chlamydia pneumoniae GN=lpdA PE=3 SV=1 4 464 1.0E-58
sp|P11959|DLDH1_GEOSE Dihydrolipoyl dehydrogenase OS=Geobacillus stearothermophilus GN=pdhD PE=1 SV=2 7 464 2.0E-55
sp|P18925|DLDH_AZOVI Dihydrolipoyl dehydrogenase OS=Azotobacter vinelandii PE=1 SV=1 4 466 4.0E-55
sp|P0A0E4|MERA_STAES Mercuric reductase OS=Staphylococcus epidermidis (strain ATCC 12228) GN=merA PE=3 SV=1 6 466 7.0E-55
sp|P0A0E5|MERA_STAAU Mercuric reductase OS=Staphylococcus aureus GN=merA PE=3 SV=1 6 466 7.0E-55
sp|P31052|DLDH2_PSEPU Dihydrolipoyl dehydrogenase OS=Pseudomonas putida GN=lpdG PE=1 SV=4 4 466 2.0E-54
sp|P0A0E7|DLDH_STAAW Dihydrolipoyl dehydrogenase OS=Staphylococcus aureus (strain MW2) GN=pdhD PE=3 SV=1 7 464 5.0E-54
sp|P0A0E8|DLDH_STAAU Dihydrolipoyl dehydrogenase OS=Staphylococcus aureus GN=pdhD PE=3 SV=1 7 464 5.0E-54
sp|Q6GAB8|DLDH_STAAS Dihydrolipoyl dehydrogenase OS=Staphylococcus aureus (strain MSSA476) GN=pdhD PE=3 SV=1 7 464 5.0E-54
sp|Q6GHY9|DLDH_STAAR Dihydrolipoyl dehydrogenase OS=Staphylococcus aureus (strain MRSA252) GN=pdhD PE=3 SV=1 7 464 5.0E-54
sp|P99084|DLDH_STAAN Dihydrolipoyl dehydrogenase OS=Staphylococcus aureus (strain N315) GN=pdhD PE=1 SV=1 7 464 5.0E-54
sp|P0A0E6|DLDH_STAAM Dihydrolipoyl dehydrogenase OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=pdhD PE=3 SV=1 7 464 5.0E-54
sp|Q5HGY8|DLDH_STAAC Dihydrolipoyl dehydrogenase OS=Staphylococcus aureus (strain COL) GN=pdhD PE=3 SV=1 7 464 5.0E-54
sp|Q9PJI3|DLDH_CHLMU Dihydrolipoyl dehydrogenase OS=Chlamydia muridarum (strain MoPn / Nigg) GN=lpdA PE=3 SV=1 9 464 7.0E-54
sp|P14218|DLDH_PSEFL Dihydrolipoyl dehydrogenase OS=Pseudomonas fluorescens GN=lpd PE=1 SV=3 4 466 1.0E-53
sp|Q9I3D1|DLDH2_PSEAE Dihydrolipoyl dehydrogenase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=lpdG PE=3 SV=1 4 466 2.0E-53
sp|O84561|DLDH_CHLTR Dihydrolipoyl dehydrogenase OS=Chlamydia trachomatis (strain D/UW-3/Cx) GN=lpdA PE=3 SV=1 9 464 4.0E-53
sp|P16171|MERA_BACCE Mercuric reductase OS=Bacillus cereus GN=merA PE=1 SV=1 9 466 5.0E-53
sp|O08749|DLDH_MOUSE Dihydrolipoyl dehydrogenase, mitochondrial OS=Mus musculus GN=Dld PE=1 SV=2 7 464 6.0E-52
sp|Q6P6R2|DLDH_RAT Dihydrolipoyl dehydrogenase, mitochondrial OS=Rattus norvegicus GN=Dld PE=1 SV=1 7 464 3.0E-50
sp|P49819|DLDH_CANLF Dihydrolipoyl dehydrogenase, mitochondrial OS=Canis lupus familiaris GN=DLD PE=1 SV=1 7 464 7.0E-50
sp|Q60HG3|DLDH_MACFA Dihydrolipoyl dehydrogenase, mitochondrial OS=Macaca fascicularis GN=DLD PE=2 SV=1 7 464 1.0E-49
sp|P09622|DLDH_HUMAN Dihydrolipoyl dehydrogenase, mitochondrial OS=Homo sapiens GN=DLD PE=1 SV=2 7 464 1.0E-49
sp|Q8NTE1|DLDH_CORGL Dihydrolipoyl dehydrogenase OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=lpd PE=1 SV=1 4 464 2.0E-49
sp|Q8CIZ7|DLDH_CRIGR Dihydrolipoyl dehydrogenase, mitochondrial OS=Cricetulus griseus GN=DLD PE=2 SV=1 7 464 6.0E-49
sp|Q5R4B1|DLDH_PONAB Dihydrolipoyl dehydrogenase, mitochondrial OS=Pongo abelii GN=DLD PE=2 SV=1 7 464 2.0E-48
sp|Q9I1L9|DLDH1_PSEAE Dihydrolipoyl dehydrogenase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=lpdV PE=1 SV=1 9 464 2.0E-48
sp|P09623|DLDH_PIG Dihydrolipoyl dehydrogenase, mitochondrial OS=Sus scrofa GN=DLD PE=1 SV=1 7 464 2.0E-48
sp|Q5UWH2|DLDH3_HALMA Dihydrolipoyl dehydrogenase 3 OS=Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) GN=lpdA3 PE=3 SV=1 4 467 2.0E-48
sp|P50970|DLDH_ZYMMO Dihydrolipoyl dehydrogenase OS=Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4) GN=lpd PE=3 SV=3 9 466 3.0E-48
sp|Q811C4|DLDH_MESAU Dihydrolipoyl dehydrogenase, mitochondrial (Fragment) OS=Mesocricetus auratus GN=DLD PE=1 SV=1 7 464 4.0E-48
sp|P85207|DLDH_THESS Dihydrolipoyl dehydrogenase OS=Thermus scotoductus (strain ATCC 700910 / SA-01) GN=lpd PE=1 SV=2 6 467 5.0E-48
sp|Q50068|DLDH_MYCLE Dihydrolipoyl dehydrogenase OS=Mycobacterium leprae (strain TN) GN=lpd PE=3 SV=1 9 466 1.0E-47
sp|O17953|DLDH_CAEEL Dihydrolipoyl dehydrogenase, mitochondrial OS=Caenorhabditis elegans GN=dld-1 PE=3 SV=2 5 464 1.0E-47
sp|Q54465|MERA_SHEPU Mercuric reductase OS=Shewanella putrefaciens GN=merA PE=3 SV=1 12 444 2.0E-47
sp|P31023|DLDH_PEA Dihydrolipoyl dehydrogenase, mitochondrial OS=Pisum sativum GN=LPD PE=1 SV=2 23 466 4.0E-47
sp|P09624|DLDH_YEAST Dihydrolipoyl dehydrogenase, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=LPD1 PE=1 SV=1 4 464 1.0E-46
sp|Q41219|LEGRE_SOYBN Leghemoglobin reductase OS=Glycine max GN=FLBR PE=1 SV=1 23 464 2.0E-46
sp|O05940|DLDH_RHIEC Dihydrolipoyl dehydrogenase OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=lpdA PE=3 SV=2 9 466 3.0E-46
sp|Q9HN74|DLDH_HALSA Dihydrolipoyl dehydrogenase OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=lpdA PE=3 SV=1 4 464 5.0E-46
sp|Q54EW8|DLDH_DICDI Dihydrolipoyl dehydrogenase, mitochondrial OS=Dictyostelium discoideum GN=lpd PE=3 SV=1 23 464 5.0E-46
sp|O00087|DLDH_SCHPO Dihydrolipoyl dehydrogenase, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=dld1 PE=2 SV=2 7 464 9.0E-46
sp|O34324|DLDH3_BACSU Dihydrolipoyl dehydrogenase OS=Bacillus subtilis (strain 168) GN=acoL PE=3 SV=1 31 466 2.0E-45
sp|Q04829|DLDH_HALVD Dihydrolipoyl dehydrogenase OS=Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2) GN=lpdA PE=1 SV=3 9 464 5.0E-45
sp|Q9M5K3|DLDH1_ARATH Dihydrolipoyl dehydrogenase 1, mitochondrial OS=Arabidopsis thaliana GN=LPD1 PE=1 SV=2 23 466 5.0E-45
sp|Q9SPB1|LEGRE_VIGUN Leghemoglobin reductase OS=Vigna unguiculata GN=FLBR PE=1 SV=1 23 464 1.0E-44
sp|O18480|DLDH_MANSE Dihydrolipoyl dehydrogenase OS=Manduca sexta PE=2 SV=1 5 466 2.0E-44
sp|A8MS68|PLPD1_ARATH Dihydrolipoyl dehydrogenase 1, chloroplastic OS=Arabidopsis thaliana GN=LPD1 PE=2 SV=1 31 466 3.0E-44
sp|P30341|MERA_STRLI Mercuric reductase OS=Streptomyces lividans GN=merA PE=2 SV=1 31 448 4.0E-44
sp|Q04933|DLDH_TRYBB Dihydrolipoyl dehydrogenase OS=Trypanosoma brucei brucei PE=3 SV=1 23 464 9.0E-44
sp|P9WHH9|DLDH_MYCTU Dihydrolipoyl dehydrogenase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=lpdC PE=1 SV=1 9 466 2.0E-43
sp|P9WHH8|DLDH_MYCTO Dihydrolipoyl dehydrogenase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=lpdC PE=3 SV=1 9 466 2.0E-43
sp|P66005|DLDH_MYCBO Dihydrolipoyl dehydrogenase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=lpd PE=3 SV=1 9 466 2.0E-43
sp|P9WHH3|MTR_MYCTU Mycothione reductase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=mtr PE=1 SV=1 9 464 2.0E-43
sp|P9WHH2|MTR_MYCTO Mycothione reductase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=mtr PE=3 SV=1 9 464 2.0E-43
sp|Q9HUY1|DLDH3_PSEAE Dihydrolipoyl dehydrogenase 3 OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=lpd3 PE=3 SV=1 9 466 4.0E-43
sp|P57303|DLDH_BUCAI Dihydrolipoyl dehydrogenase OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=lpdA PE=3 SV=1 11 466 9.0E-43
sp|P90597|DLDH_TRYCR Dihydrolipoyl dehydrogenase OS=Trypanosoma cruzi GN=LPD PE=1 SV=1 23 466 3.0E-42
sp|Q8KCW2|DLDH_CHLTE Dihydrolipoyl dehydrogenase OS=Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) GN=lpd PE=3 SV=1 9 464 3.0E-42
sp|P31046|DLDH3_PSEPU Dihydrolipoyl dehydrogenase 3 OS=Pseudomonas putida GN=lpd3 PE=1 SV=1 22 466 1.0E-41
sp|P9WHH5|STHA_MYCTU Probable soluble pyridine nucleotide transhydrogenase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=sthA PE=1 SV=1 6 464 2.0E-41
sp|P9WHH4|STHA_MYCTO Probable soluble pyridine nucleotide transhydrogenase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=sthA PE=3 SV=1 6 464 2.0E-41
sp|A5U665|STHA_MYCTA Soluble pyridine nucleotide transhydrogenase OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) GN=sthA PE=3 SV=1 6 464 2.0E-41
sp|C1AFH2|STHA_MYCBT Soluble pyridine nucleotide transhydrogenase OS=Mycobacterium bovis (strain BCG / Tokyo 172 / ATCC 35737 / TMC 1019) GN=sthA PE=3 SV=1 6 464 2.0E-41
sp|A1KM51|STHA_MYCBP Soluble pyridine nucleotide transhydrogenase OS=Mycobacterium bovis (strain BCG / Pasteur 1173P2) GN=sthA PE=3 SV=1 6 464 2.0E-41
sp|P66007|STHA_MYCBO Probable soluble pyridine nucleotide transhydrogenase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=sthA PE=3 SV=1 6 464 2.0E-41
sp|P52992|DLDH_CUPNH Dihydrolipoyl dehydrogenase OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=odhL PE=3 SV=2 4 464 2.0E-41
sp|P0A9P3|DLDH_SHIFL Dihydrolipoyl dehydrogenase OS=Shigella flexneri GN=lpdA PE=3 SV=2 11 466 4.0E-41
sp|P0A9P0|DLDH_ECOLI Dihydrolipoyl dehydrogenase OS=Escherichia coli (strain K12) GN=lpdA PE=1 SV=2 11 466 4.0E-41
sp|P0A9P1|DLDH_ECOL6 Dihydrolipoyl dehydrogenase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=lpdA PE=3 SV=2 11 466 4.0E-41
sp|P0A9P2|DLDH_ECO57 Dihydrolipoyl dehydrogenase OS=Escherichia coli O157:H7 GN=lpdA PE=3 SV=2 11 466 4.0E-41
sp|F4JLP5|PLPD2_ARATH Dihydrolipoyl dehydrogenase 2, chloroplastic OS=Arabidopsis thaliana GN=LPD2 PE=2 SV=2 31 464 5.0E-41
sp|Q9M5K2|DLDH2_ARATH Dihydrolipoyl dehydrogenase 2, mitochondrial OS=Arabidopsis thaliana GN=LPD2 PE=1 SV=1 23 466 2.0E-40
sp|P17239|MERA_ACIFR Mercuric reductase OS=Acidithiobacillus ferrooxidans GN=merA PE=1 SV=2 6 444 3.0E-40
sp|P75393|DLDH_MYCPN Dihydrolipoyl dehydrogenase OS=Mycoplasma pneumoniae (strain ATCC 29342 / M129) GN=pdhD PE=3 SV=1 9 464 8.0E-40
sp|P08332|MERA_SHIFL Mercuric reductase OS=Shigella flexneri GN=merA PE=3 SV=1 12 444 9.0E-40
sp|P00392|MERA_PSEAI Mercuric reductase OS=Pseudomonas aeruginosa GN=merA PE=1 SV=1 12 444 1.0E-39
sp|Q8K9T7|DLDH_BUCAP Dihydrolipoyl dehydrogenase OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=lpdA PE=3 SV=1 7 466 1.0E-39
sp|P72740|DLDH_SYNY3 Dihydrolipoyl dehydrogenase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=lpdA PE=1 SV=3 4 466 2.0E-38
sp|P94188|MERA_ALCSP Mercuric reductase OS=Alcaligenes sp. GN=merA PE=3 SV=1 16 444 2.0E-38
sp|P47513|DLDH_MYCGE Dihydrolipoyl dehydrogenase OS=Mycoplasma genitalium (strain ATCC 33530 / G-37 / NCTC 10195) GN=pdhD PE=3 SV=1 9 468 4.0E-38
sp|Q52109|MERA_ACICA Mercuric reductase OS=Acinetobacter calcoaceticus GN=merA PE=3 SV=1 11 444 6.0E-38
sp|Q9KPF6|DLDH_VIBCH Dihydrolipoyl dehydrogenase OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=lpd PE=3 SV=1 7 466 6.0E-38
sp|Q5UYG6|DLDH2_HALMA Dihydrolipoyl dehydrogenase 2 OS=Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) GN=lpdA2 PE=3 SV=1 4 464 7.0E-38
sp|P43784|DLDH_HAEIN Dihydrolipoyl dehydrogenase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=lpdA PE=3 SV=2 11 466 9.0E-38
sp|P09063|DLDH1_PSEPU Dihydrolipoyl dehydrogenase OS=Pseudomonas putida GN=lpdV PE=1 SV=1 23 464 1.0E-37
sp|O50311|DLDH_CHLP8 Dihydrolipoyl dehydrogenase OS=Chlorobaculum parvum (strain NCIB 8327) GN=lpd PE=3 SV=2 9 464 1.0E-37
sp|C3K4W1|STHA_PSEFS Soluble pyridine nucleotide transhydrogenase OS=Pseudomonas fluorescens (strain SBW25) GN=sthA PE=3 SV=1 9 437 1.0E-37
sp|P95596|DLDH_RHOCA Dihydrolipoyl dehydrogenase OS=Rhodobacter capsulatus GN=lpd PE=3 SV=1 27 464 1.0E-37
sp|O05139|STHA_PSEFL Soluble pyridine nucleotide transhydrogenase OS=Pseudomonas fluorescens GN=sthA PE=1 SV=3 9 437 1.0E-37
sp|B1J606|STHA_PSEPW Soluble pyridine nucleotide transhydrogenase OS=Pseudomonas putida (strain W619) GN=sthA PE=3 SV=1 9 437 1.0E-37
sp|Q48KI8|STHA_PSE14 Soluble pyridine nucleotide transhydrogenase OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=sthA PE=3 SV=1 9 464 3.0E-37
sp|B0KH90|STHA_PSEPG Soluble pyridine nucleotide transhydrogenase OS=Pseudomonas putida (strain GB-1) GN=sthA PE=3 SV=1 9 437 4.0E-37
sp|Q48A14|STHA_COLP3 Soluble pyridine nucleotide transhydrogenase OS=Colwellia psychrerythraea (strain 34H / ATCC BAA-681) GN=sthA PE=3 SV=1 9 464 4.0E-37
sp|P94702|MERA_ENTAG Mercuric reductase OS=Enterobacter agglomerans GN=merA PE=3 SV=1 11 444 5.0E-37
sp|Q884I6|STHA_PSESM Soluble pyridine nucleotide transhydrogenase OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=sthA PE=3 SV=3 9 464 5.0E-37
sp|O50286|DLDH_VIBPA Dihydrolipoyl dehydrogenase OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=lpd PE=3 SV=2 7 466 1.0E-36
sp|Q88KY8|STHA_PSEPK Soluble pyridine nucleotide transhydrogenase OS=Pseudomonas putida (strain KT2440) GN=sthA PE=3 SV=3 9 437 1.0E-36
sp|A5W6F5|STHA_PSEP1 Soluble pyridine nucleotide transhydrogenase OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=sthA PE=3 SV=1 9 437 1.0E-36
sp|Q4ZV77|STHA_PSEU2 Soluble pyridine nucleotide transhydrogenase OS=Pseudomonas syringae pv. syringae (strain B728a) GN=sthA PE=3 SV=2 9 464 1.0E-36
sp|Q3K9F5|STHA_PSEPF Soluble pyridine nucleotide transhydrogenase OS=Pseudomonas fluorescens (strain Pf0-1) GN=sthA PE=3 SV=1 9 437 1.0E-36
sp|Q4KFA6|STHA_PSEF5 Soluble pyridine nucleotide transhydrogenase OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=sthA PE=3 SV=1 9 437 2.0E-36
sp|Q51772|MERA_PSEFL Mercuric reductase OS=Pseudomonas fluorescens GN=merA PE=3 SV=1 10 444 3.0E-36
sp|A6V3A6|STHA_PSEA7 Soluble pyridine nucleotide transhydrogenase OS=Pseudomonas aeruginosa (strain PA7) GN=sthA PE=3 SV=1 9 437 4.0E-36
sp|P57112|STHA_PSEAE Soluble pyridine nucleotide transhydrogenase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=sthA PE=1 SV=2 9 437 5.0E-36
sp|Q02PF5|STHA_PSEAB Soluble pyridine nucleotide transhydrogenase OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=sthA PE=3 SV=1 9 437 5.0E-36
sp|B7UZU5|STHA_PSEA8 Soluble pyridine nucleotide transhydrogenase OS=Pseudomonas aeruginosa (strain LESB58) GN=sthA PE=3 SV=1 9 437 5.0E-36
sp|Q1I7F0|STHA_PSEE4 Soluble pyridine nucleotide transhydrogenase OS=Pseudomonas entomophila (strain L48) GN=sthA PE=3 SV=1 9 437 1.0E-35
sp|P54533|DLDH2_BACSU Dihydrolipoyl dehydrogenase OS=Bacillus subtilis (strain 168) GN=bfmBC PE=3 SV=1 7 466 4.0E-35
sp|A4XSQ1|STHA_PSEMY Soluble pyridine nucleotide transhydrogenase OS=Pseudomonas mendocina (strain ymp) GN=sthA PE=3 SV=1 9 464 5.0E-35
sp|Q89AQ8|DLDH_BUCBP Dihydrolipoyl dehydrogenase OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=lpdA PE=3 SV=1 4 466 8.0E-34
sp|Q9XBQ9|STHA_AZOVI Soluble pyridine nucleotide transhydrogenase OS=Azotobacter vinelandii GN=sthA PE=1 SV=1 9 464 1.0E-33
sp|C1DR10|STHA_AZOVD Soluble pyridine nucleotide transhydrogenase OS=Azotobacter vinelandii (strain DJ / ATCC BAA-1303) GN=sthA PE=3 SV=1 9 464 1.0E-33
sp|A6VW16|STHA_MARMS Soluble pyridine nucleotide transhydrogenase OS=Marinomonas sp. (strain MWYL1) GN=sthA PE=3 SV=1 5 464 2.0E-33
sp|Q7MQ83|STHA_VIBVY Soluble pyridine nucleotide transhydrogenase OS=Vibrio vulnificus (strain YJ016) GN=sthA PE=3 SV=1 9 464 4.0E-33
sp|Q8DD46|STHA_VIBVU Soluble pyridine nucleotide transhydrogenase OS=Vibrio vulnificus (strain CMCP6) GN=sthA PE=3 SV=1 9 464 4.0E-33
sp|A4VMU6|STHA_PSEU5 Soluble pyridine nucleotide transhydrogenase OS=Pseudomonas stutzeri (strain A1501) GN=sthA PE=3 SV=1 9 437 1.0E-32
sp|A1U1Y5|STHA_MARHV Soluble pyridine nucleotide transhydrogenase OS=Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8) GN=sthA PE=3 SV=1 9 464 2.0E-32
sp|C3LPZ2|STHA_VIBCM Soluble pyridine nucleotide transhydrogenase OS=Vibrio cholerae serotype O1 (strain M66-2) GN=sthA PE=3 SV=1 9 464 1.0E-31
sp|P50529|STHA_VIBCH Soluble pyridine nucleotide transhydrogenase OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=sthA PE=3 SV=2 9 464 1.0E-31
sp|A5F4K5|STHA_VIBC3 Soluble pyridine nucleotide transhydrogenase OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) GN=sthA PE=3 SV=1 9 464 1.0E-31
sp|P77212|RCLA_ECOLI Probable pyridine nucleotide-disulfide oxidoreductase RclA OS=Escherichia coli (strain K12) GN=rclA PE=2 SV=2 11 469 1.0E-31
sp|B1JQ50|STHA_YERPY Soluble pyridine nucleotide transhydrogenase OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=sthA PE=3 SV=1 9 464 1.0E-31
sp|Q66G61|STHA_YERPS Soluble pyridine nucleotide transhydrogenase OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=sthA PE=3 SV=1 9 464 1.0E-31
sp|A4TRG4|STHA_YERPP Soluble pyridine nucleotide transhydrogenase OS=Yersinia pestis (strain Pestoides F) GN=sthA PE=3 SV=1 9 464 1.0E-31
sp|Q1CNP4|STHA_YERPN Soluble pyridine nucleotide transhydrogenase OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=sthA PE=3 SV=1 9 464 1.0E-31
sp|A9R6N5|STHA_YERPG Soluble pyridine nucleotide transhydrogenase OS=Yersinia pestis bv. Antiqua (strain Angola) GN=sthA PE=3 SV=1 9 464 1.0E-31
sp|Q8ZA97|STHA_YERPE Soluble pyridine nucleotide transhydrogenase OS=Yersinia pestis GN=sthA PE=3 SV=1 9 464 1.0E-31
sp|B2JZF3|STHA_YERPB Soluble pyridine nucleotide transhydrogenase OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=sthA PE=3 SV=1 9 464 1.0E-31
sp|Q1CBU5|STHA_YERPA Soluble pyridine nucleotide transhydrogenase OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=sthA PE=3 SV=1 9 464 1.0E-31
sp|A7FD10|STHA_YERP3 Soluble pyridine nucleotide transhydrogenase OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=sthA PE=3 SV=1 9 464 1.0E-31
sp|A8GL77|STHA_SERP5 Soluble pyridine nucleotide transhydrogenase OS=Serratia proteamaculans (strain 568) GN=sthA PE=3 SV=1 9 464 1.0E-31
sp|Q87KN5|STHA_VIBPA Soluble pyridine nucleotide transhydrogenase OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=sthA PE=3 SV=1 9 464 2.0E-31
sp|A1JI37|STHA_YERE8 Soluble pyridine nucleotide transhydrogenase OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=sthA PE=3 SV=1 9 464 3.0E-31
sp|B7VM91|STHA_VIBTL Soluble pyridine nucleotide transhydrogenase OS=Vibrio tasmaniensis (strain LGP32) GN=sthA PE=3 SV=1 9 464 4.0E-31
sp|B2VGA0|STHA_ERWT9 Soluble pyridine nucleotide transhydrogenase OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=sthA PE=3 SV=1 9 464 6.0E-31
sp|Q5E212|STHA_VIBF1 Soluble pyridine nucleotide transhydrogenase OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=sthA PE=3 SV=2 9 464 6.0E-31
sp|B4F1H1|STHA_PROMH Soluble pyridine nucleotide transhydrogenase OS=Proteus mirabilis (strain HI4320) GN=sthA PE=3 SV=1 9 464 1.0E-30
sp|Q2NQZ3|STHA_SODGM Soluble pyridine nucleotide transhydrogenase OS=Sodalis glossinidius (strain morsitans) GN=sthA PE=3 SV=1 9 464 1.0E-30
sp|C4K3I8|STHA_HAMD5 Soluble pyridine nucleotide transhydrogenase OS=Hamiltonella defensa subsp. Acyrthosiphon pisum (strain 5AT) GN=sthA PE=3 SV=1 9 464 1.0E-30
sp|P35484|DLDH_ACHLA Dihydrolipoyl dehydrogenase (Fragment) OS=Acholeplasma laidlawii GN=pdhD PE=3 SV=1 23 354 4.0E-30
sp|Q1QX78|STHA_CHRSD Soluble pyridine nucleotide transhydrogenase OS=Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIMB 13768) GN=sthA PE=3 SV=1 9 464 1.0E-29
sp|Q6LLT9|STHA_PHOPR Soluble pyridine nucleotide transhydrogenase OS=Photobacterium profundum GN=sthA PE=3 SV=1 9 464 1.0E-29
sp|Q7MBG9|STHA_PHOLL Soluble pyridine nucleotide transhydrogenase OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=sthA PE=3 SV=1 9 437 1.0E-29
sp|A8AKW0|STHA_CITK8 Soluble pyridine nucleotide transhydrogenase OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=sthA PE=3 SV=1 3 464 3.0E-29
sp|B5REZ6|STHA_SALG2 Soluble pyridine nucleotide transhydrogenase OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=sthA PE=3 SV=1 3 464 5.0E-29
sp|Q83MI1|STHA_SHIFL Soluble pyridine nucleotide transhydrogenase OS=Shigella flexneri GN=sthA PE=3 SV=1 3 464 7.0E-29
sp|B1IVB6|STHA_ECOLC Soluble pyridine nucleotide transhydrogenase OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=sthA PE=3 SV=1 3 464 1.0E-28
sp|A8A770|STHA_ECOHS Soluble pyridine nucleotide transhydrogenase OS=Escherichia coli O9:H4 (strain HS) GN=sthA PE=3 SV=1 3 464 1.0E-28
sp|A4WG49|STHA_ENT38 Soluble pyridine nucleotide transhydrogenase OS=Enterobacter sp. (strain 638) GN=sthA PE=3 SV=1 9 464 1.0E-28
sp|Q0TA96|STHA_ECOL5 Soluble pyridine nucleotide transhydrogenase OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=sthA PE=3 SV=1 3 464 1.0E-28
sp|B7LUN3|STHA_ESCF3 Soluble pyridine nucleotide transhydrogenase OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=sthA PE=3 SV=1 3 464 1.0E-28
sp|Q1R3U7|STHA_ECOUT Soluble pyridine nucleotide transhydrogenase OS=Escherichia coli (strain UTI89 / UPEC) GN=sthA PE=3 SV=1 3 464 1.0E-28
sp|B6I5I0|STHA_ECOSE Soluble pyridine nucleotide transhydrogenase OS=Escherichia coli (strain SE11) GN=sthA PE=3 SV=1 3 464 1.0E-28
sp|B7NFR2|STHA_ECOLU Soluble pyridine nucleotide transhydrogenase OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=sthA PE=3 SV=1 3 464 1.0E-28
sp|P27306|STHA_ECOLI Soluble pyridine nucleotide transhydrogenase OS=Escherichia coli (strain K12) GN=sthA PE=1 SV=5 3 464 1.0E-28
sp|A1AIE2|STHA_ECOK1 Soluble pyridine nucleotide transhydrogenase OS=Escherichia coli O1:K1 / APEC GN=sthA PE=3 SV=1 3 464 1.0E-28
sp|B1XBX3|STHA_ECODH Soluble pyridine nucleotide transhydrogenase OS=Escherichia coli (strain K12 / DH10B) GN=sthA PE=3 SV=1 3 464 1.0E-28
sp|C5A0R1|STHA_ECOBW Soluble pyridine nucleotide transhydrogenase OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=sthA PE=3 SV=1 3 464 1.0E-28
sp|B7M718|STHA_ECO8A Soluble pyridine nucleotide transhydrogenase OS=Escherichia coli O8 (strain IAI1) GN=sthA PE=3 SV=1 3 464 1.0E-28
sp|B7NU38|STHA_ECO7I Soluble pyridine nucleotide transhydrogenase OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=sthA PE=3 SV=1 3 464 1.0E-28
sp|B5Z064|STHA_ECO5E Soluble pyridine nucleotide transhydrogenase OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=sthA PE=3 SV=1 3 464 1.0E-28
sp|B7LA64|STHA_ECO55 Soluble pyridine nucleotide transhydrogenase OS=Escherichia coli (strain 55989 / EAEC) GN=sthA PE=3 SV=1 3 464 1.0E-28
sp|B7MIA0|STHA_ECO45 Soluble pyridine nucleotide transhydrogenase OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=sthA PE=3 SV=1 3 464 1.0E-28
sp|A7ZUI2|STHA_ECO24 Soluble pyridine nucleotide transhydrogenase OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=sthA PE=3 SV=1 3 464 1.0E-28
sp|B7UNU0|STHA_ECO27 Soluble pyridine nucleotide transhydrogenase OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=sthA PE=3 SV=1 3 464 2.0E-28
sp|B2TWF7|STHA_SHIB3 Soluble pyridine nucleotide transhydrogenase OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=sthA PE=3 SV=1 3 464 2.0E-28
sp|C0Q478|STHA_SALPC Soluble pyridine nucleotide transhydrogenase OS=Salmonella paratyphi C (strain RKS4594) GN=sthA PE=3 SV=1 3 464 4.0E-28
sp|Q57H91|STHA_SALCH Soluble pyridine nucleotide transhydrogenase OS=Salmonella choleraesuis (strain SC-B67) GN=sthA PE=3 SV=1 3 464 4.0E-28
sp|Q8X727|STHA_ECO57 Soluble pyridine nucleotide transhydrogenase OS=Escherichia coli O157:H7 GN=sthA PE=3 SV=3 3 464 5.0E-28
sp|P66008|STHA_SALTY Soluble pyridine nucleotide transhydrogenase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=sthA PE=3 SV=2 3 464 5.0E-28
sp|P66009|STHA_SALTI Soluble pyridine nucleotide transhydrogenase OS=Salmonella typhi GN=sthA PE=3 SV=2 3 464 5.0E-28
sp|B5BJN6|STHA_SALPK Soluble pyridine nucleotide transhydrogenase OS=Salmonella paratyphi A (strain AKU_12601) GN=sthA PE=3 SV=1 3 464 5.0E-28
sp|A9N0H2|STHA_SALPB Soluble pyridine nucleotide transhydrogenase OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=sthA PE=3 SV=1 3 464 5.0E-28
sp|Q5PK71|STHA_SALPA Soluble pyridine nucleotide transhydrogenase OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=sthA PE=3 SV=1 3 464 5.0E-28
sp|B5QXQ7|STHA_SALEP Soluble pyridine nucleotide transhydrogenase OS=Salmonella enteritidis PT4 (strain P125109) GN=sthA PE=3 SV=1 3 464 5.0E-28
sp|B1LNS2|STHA_ECOSM Soluble pyridine nucleotide transhydrogenase OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=sthA PE=3 SV=1 3 464 6.0E-28
sp|Q8FB93|STHA_ECOL6 Soluble pyridine nucleotide transhydrogenase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=sthA PE=3 SV=3 3 464 6.0E-28
sp|Q2SIP2|STHA_HAHCH Soluble pyridine nucleotide transhydrogenase OS=Hahella chejuensis (strain KCTC 2396) GN=sthA PE=3 SV=1 25 437 8.0E-28
sp|Q6CZB1|STHA_PECAS Soluble pyridine nucleotide transhydrogenase OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=sthA PE=3 SV=1 9 464 1.0E-27
sp|A6TGE6|STHA_KLEP7 Soluble pyridine nucleotide transhydrogenase OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=sthA PE=3 SV=1 9 464 1.0E-27
sp|B7MR55|STHA_ECO81 Soluble pyridine nucleotide transhydrogenase OS=Escherichia coli O81 (strain ED1a) GN=sthA PE=3 SV=1 3 464 2.0E-27
sp|B5XZ14|STHA_KLEP3 Soluble pyridine nucleotide transhydrogenase OS=Klebsiella pneumoniae (strain 342) GN=sthA PE=3 SV=1 9 464 4.0E-27
sp|Q02733|IRC15_YEAST Increased recombination centers protein 15 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=IRC15 PE=1 SV=1 9 466 6.0E-27
sp|P9WHH7|LPDA_MYCTU NAD(P)H dehydrogenase (quinone) OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=lpdA PE=1 SV=1 11 383 8.0E-26
sp|P9WHH6|LPDA_MYCTO NAD(P)H dehydrogenase (quinone) OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=lpdA PE=3 SV=1 11 383 8.0E-26
sp|Q56839|XECC_XANP2 2-oxopropyl-CoM reductase, carboxylating OS=Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2) GN=xecC PE=1 SV=1 6 470 2.0E-23
sp|P08662|MERA_SERMA Mercuric reductase (Fragments) OS=Serratia marcescens GN=merA PE=3 SV=2 12 244 4.0E-21
sp|Q9UYU5|CDR_PYRAB Coenzyme A disulfide reductase OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=PYRAB14120 PE=3 SV=1 156 398 2.0E-11
sp|Q58065|NAOX_METJA Putative NADH oxidase OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ0649 PE=3 SV=2 11 336 5.0E-10
sp|Q5JGP4|CDR_THEKO Coenzyme A disulfide reductase OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=TK1299 PE=3 SV=1 156 398 5.0E-10
sp|Q8U1M0|CDR_PYRFU Coenzyme A disulfide reductase OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=PF1186 PE=3 SV=1 156 398 1.0E-09
sp|Q6GJR8|AHPF_STAAR Alkyl hydroperoxide reductase subunit F OS=Staphylococcus aureus (strain MRSA252) GN=ahpF PE=3 SV=1 9 323 4.0E-09
sp|P66013|AHPF_STAAW Alkyl hydroperoxide reductase subunit F OS=Staphylococcus aureus (strain MW2) GN=ahpF PE=3 SV=1 9 323 6.0E-09
sp|P99118|AHPF_STAAN Alkyl hydroperoxide reductase subunit F OS=Staphylococcus aureus (strain N315) GN=ahpF PE=1 SV=1 9 323 6.0E-09
sp|P66012|AHPF_STAAM Alkyl hydroperoxide reductase subunit F OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=ahpF PE=3 SV=1 9 323 6.0E-09
sp|A7ZQE0|NORW_ECO24 Nitric oxide reductase FlRd-NAD(+) reductase OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=norW PE=3 SV=1 143 343 7.0E-09
sp|Q6GC92|AHPF_STAAS Alkyl hydroperoxide reductase subunit F OS=Staphylococcus aureus (strain MSSA476) GN=ahpF PE=3 SV=1 9 323 1.0E-08
sp|B7LW23|NORW_ESCF3 Nitric oxide reductase FlRd-NAD(+) reductase OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=norW PE=3 SV=1 143 343 1.0E-08
sp|Q5HIR6|AHPF_STAAC Alkyl hydroperoxide reductase subunit F OS=Staphylococcus aureus (strain COL) GN=ahpF PE=3 SV=1 9 323 2.0E-08
sp|O05204|AHPF_STAA8 Alkyl hydroperoxide reductase subunit F OS=Staphylococcus aureus (strain NCTC 8325) GN=ahpF PE=3 SV=1 9 323 2.0E-08
sp|P08655|YMER_STAAU Uncharacterized 19.7 kDa protein in mercuric resistance operon OS=Staphylococcus aureus PE=4 SV=1 326 469 2.0E-08
sp|B7NSJ1|NORW_ECO7I Nitric oxide reductase FlRd-NAD(+) reductase OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=norW PE=3 SV=1 143 343 2.0E-08
sp|Q3YYF3|NORW_SHISS Nitric oxide reductase FlRd-NAD(+) reductase OS=Shigella sonnei (strain Ss046) GN=norW PE=3 SV=1 143 343 4.0E-08
sp|Q8FEN4|NORW_ECOL6 Nitric oxide reductase FlRd-NAD(+) reductase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=norW PE=3 SV=1 143 343 5.0E-08
sp|A8A3I8|NORW_ECOHS Nitric oxide reductase FlRd-NAD(+) reductase OS=Escherichia coli O9:H4 (strain HS) GN=norW PE=3 SV=1 143 343 5.0E-08
sp|B7UHC3|NORW_ECO27 Nitric oxide reductase FlRd-NAD(+) reductase OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=norW PE=3 SV=1 143 343 6.0E-08
sp|Q1R7Y9|NORW_ECOUT Nitric oxide reductase FlRd-NAD(+) reductase OS=Escherichia coli (strain UTI89 / UPEC) GN=norW PE=3 SV=1 143 343 6.0E-08
sp|A1AEQ1|NORW_ECOK1 Nitric oxide reductase FlRd-NAD(+) reductase OS=Escherichia coli O1:K1 / APEC GN=norW PE=3 SV=1 143 343 6.0E-08
sp|B7MKI0|NORW_ECO45 Nitric oxide reductase FlRd-NAD(+) reductase OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=norW PE=3 SV=1 143 343 6.0E-08
sp|B7M9E8|NORW_ECO8A Nitric oxide reductase FlRd-NAD(+) reductase OS=Escherichia coli O8 (strain IAI1) GN=norW PE=3 SV=1 143 343 6.0E-08
sp|B7LEC2|NORW_ECO55 Nitric oxide reductase FlRd-NAD(+) reductase OS=Escherichia coli (strain 55989 / EAEC) GN=norW PE=3 SV=1 143 343 6.0E-08
sp|B2U036|NORW_SHIB3 Nitric oxide reductase FlRd-NAD(+) reductase OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=norW PE=3 SV=1 143 343 7.0E-08
sp|Q0TEG9|NORW_ECOL5 Nitric oxide reductase FlRd-NAD(+) reductase OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=norW PE=3 SV=1 143 343 7.0E-08
sp|B6I697|NORW_ECOSE Nitric oxide reductase FlRd-NAD(+) reductase OS=Escherichia coli (strain SE11) GN=norW PE=3 SV=1 143 343 8.0E-08
sp|B7MYL1|NORW_ECO81 Nitric oxide reductase FlRd-NAD(+) reductase OS=Escherichia coli O81 (strain ED1a) GN=norW PE=3 SV=1 143 343 1.0E-07
sp|A2RIB7|NAOX_LACLM NADH oxidase OS=Lactococcus lactis subsp. cremoris (strain MG1363) GN=noxE PE=1 SV=1 143 321 1.0E-07
sp|B7N6U1|NORW_ECOLU Nitric oxide reductase FlRd-NAD(+) reductase OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=norW PE=3 SV=1 143 343 1.0E-07
sp|Q31X75|NORW_SHIBS Nitric oxide reductase FlRd-NAD(+) reductase OS=Shigella boydii serotype 4 (strain Sb227) GN=norW PE=3 SV=2 143 343 2.0E-07
sp|A8ANR8|NORW_CITK8 Nitric oxide reductase FlRd-NAD(+) reductase OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=norW PE=3 SV=1 143 343 2.0E-07
sp|P37596|NORW_ECOLI Nitric oxide reductase FlRd-NAD(+) reductase OS=Escherichia coli (strain K12) GN=norW PE=1 SV=3 143 343 2.0E-07
sp|B1IUW8|NORW_ECOLC Nitric oxide reductase FlRd-NAD(+) reductase OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=norW PE=3 SV=1 143 343 2.0E-07
sp|B1XCN8|NORW_ECODH Nitric oxide reductase FlRd-NAD(+) reductase OS=Escherichia coli (strain K12 / DH10B) GN=norW PE=3 SV=1 143 343 2.0E-07
sp|C4ZYV6|NORW_ECOBW Nitric oxide reductase FlRd-NAD(+) reductase OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=norW PE=3 SV=1 143 343 2.0E-07
sp|P59403|NORW_SHIFL Nitric oxide reductase FlRd-NAD(+) reductase OS=Shigella flexneri GN=norW PE=3 SV=1 143 343 2.0E-07
sp|Q0T1D6|NORW_SHIF8 Nitric oxide reductase FlRd-NAD(+) reductase OS=Shigella flexneri serotype 5b (strain 8401) GN=norW PE=3 SV=1 143 343 2.0E-07
sp|B1LQ29|NORW_ECOSM Nitric oxide reductase FlRd-NAD(+) reductase OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=norW PE=3 SV=1 143 343 2.0E-07
sp|A8GW75|FENR_RICB8 Ferredoxin--NADP reductase OS=Rickettsia bellii (strain OSU 85-389) GN=A1I_03745 PE=3 SV=1 9 343 3.0E-07
sp|B5Z372|NORW_ECO5E Nitric oxide reductase FlRd-NAD(+) reductase OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=norW PE=3 SV=1 143 343 3.0E-07
sp|Q8X850|NORW_ECO57 Nitric oxide reductase FlRd-NAD(+) reductase OS=Escherichia coli O157:H7 GN=norW PE=3 SV=1 143 343 3.0E-07
sp|Q32CL7|NORW_SHIDS Nitric oxide reductase FlRd-NAD(+) reductase OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=norW PE=3 SV=1 145 343 4.0E-07
sp|Q5XC60|NAOX_STRP6 Probable NADH oxidase OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) GN=M6_Spy0868 PE=1 SV=1 131 321 9.0E-07
sp|Q8CPT6|CDR_STAES Coenzyme A disulfide reductase OS=Staphylococcus epidermidis (strain ATCC 12228) GN=cdr PE=3 SV=1 171 442 9.0E-07
sp|Q5HQI9|CDR_STAEQ Coenzyme A disulfide reductase OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=cdr PE=3 SV=1 171 442 9.0E-07
sp|Q1RHV1|FENR_RICBR Ferredoxin--NADP reductase OS=Rickettsia bellii (strain RML369-C) GN=RBE_0982 PE=3 SV=1 9 343 1.0E-06
sp|O52582|CDR_STAA8 Coenzyme A disulfide reductase OS=Staphylococcus aureus (strain NCTC 8325) GN=cdr PE=1 SV=3 174 321 2.0E-06
sp|B4S9F8|FENR_PROA2 Ferredoxin--NADP reductase OS=Prosthecochloris aestuarii (strain DSM 271 / SK 413) GN=Paes_1610 PE=3 SV=1 131 321 3.0E-06
sp|O58308|CDR_PYRHO Coenzyme A disulfide reductase OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=PH0572 PE=1 SV=1 156 398 3.0E-06
sp|P16640|CAMA_PSEPU Putidaredoxin reductase OS=Pseudomonas putida GN=camA PE=1 SV=1 122 343 6.0E-06
sp|Q9GRX6|AIFM1_DICDI Apoptosis-inducing factor 1, mitochondrial OS=Dictyostelium discoideum GN=aif PE=2 SV=1 129 339 8.0E-06
sp|Q8NXE8|CDR_STAAW Coenzyme A disulfide reductase OS=Staphylococcus aureus (strain MW2) GN=cdr PE=3 SV=3 174 321 1.0E-05
sp|Q6GAV6|CDR_STAAS Coenzyme A disulfide reductase OS=Staphylococcus aureus (strain MSSA476) GN=cdr PE=3 SV=3 174 321 1.0E-05
[Show less]

GO

GO Term Description Terminal node
GO:0045454 cell redox homeostasis Yes
GO:0016491 oxidoreductase activity Yes
GO:0003824 catalytic activity No
GO:0065008 regulation of biological quality No
GO:0019725 cellular homeostasis No
GO:0009987 cellular process No
GO:0003674 molecular_function No
GO:0008150 biological_process No
GO:0050789 regulation of biological process No
GO:0050794 regulation of cellular process No
GO:0065007 biological regulation No
GO:0042592 homeostatic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 40 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|5972
MAPVTKEADYLVIGGGSGGLASARMASSKFGAKALVVEAKRLGGTCVNVGCVPKKITYNAAAIAETIHDAKAYGF
SVQQTAPFDWATFKKKRDAYVERLNGIYARNLSNDKVEYLHGHGRLVSRNQVQVTLDDGSTVLVNAKKILIAVGG
RPSEPPNIPGAELGINSDGFFDIATQPKRVAIVGGGYIAVEFAGMFNALGTDTHLFIRHDTFLRKFDPMIQEAVT
KEYGRLGINMHKRSQLSRVEKDASSGKLRVTYRDDAGKESSVSDVDHLIWAIGRVPETAGIGLDQVGVKLNEKGY
VVVDEYQNSNIDNIYALGDVAGRVELTPVAIAAGRKLAHRLFGPPQFSTAKLDYVNVPSVVFAHPEVGSIGLTEP
EAIEEYGQDKVKVYKTSFTAMYYAMMDPEQKGPTSYKLIVVGPDEKVVGLHIMGQGSAEMLQGFGVAVKMGATKA
DFDSCVAIHPTSAEELVTLK*
Coding >OphauB2|5972
ATGGCGCCCGTCACCAAAGAAGCCGACTATCTCGTCATTGGCGGCGGCAGCGGAGGTCTCGCCTCGGCTCGCATG
GCCAGCTCCAAATTTGGCGCAAAGGCACTCGTGGTCGAAGCCAAGCGCCTGGGCGGAACTTGTGTCAATGTTGGC
TGCGTTCCGAAAAAGATAACCTACAATGCGGCAGCCATCGCCGAAACGATTCACGATGCAAAGGCATACGGCTTC
TCTGTCCAACAGACGGCTCCCTTTGACTGGGCCACGTTCAAGAAGAAGCGCGATGCCTATGTCGAGCGACTCAAT
GGCATATATGCGCGCAACCTCTCCAACGACAAGGTGGAGTATCTGCACGGCCACGGCCGTCTTGTCTCTCGCAAC
CAGGTCCAAGTAACGCTGGACGATGGCTCAACAGTGCTTGTAAACGCCAAGAAGATACTCATCGCCGTTGGTGGT
CGTCCCAGCGAGCCGCCAAATATCCCCGGTGCCGAGCTCGGTATTAACAGTGATGGCTTCTTCGACATTGCGACG
CAGCCCAAGCGAGTCGCAATCGTCGGTGGCGGCTATATTGCCGTTGAGTTTGCCGGCATGTTCAACGCGCTTGGC
ACCGATACTCATCTGTTTATTCGGCACGATACCTTTTTGCGTAAATTCGATCCCATGATTCAAGAGGCCGTCACC
AAGGAGTACGGACGGCTGGGGATTAACATGCACAAGCGTTCCCAATTGTCGCGGGTAGAAAAGGACGCTAGCAGC
GGCAAGCTGAGGGTAACGTATCGCGACGATGCTGGCAAAGAGAGCTCCGTCTCCGATGTCGACCATTTGATCTGG
GCTATTGGACGTGTCCCTGAAACGGCTGGGATTGGGCTCGATCAAGTCGGTGTCAAGCTCAACGAAAAGGGCTAC
GTGGTTGTCGACGAGTACCAAAACAGCAATATTGACAATATATACGCCTTGGGCGATGTGGCAGGCCGTGTCGAG
CTGACGCCTGTGGCGATTGCTGCCGGGCGCAAGCTCGCCCATCGCCTCTTTGGCCCACCCCAGTTTTCCACTGCC
AAGCTAGACTATGTCAACGTGCCATCCGTCGTCTTTGCGCATCCCGAGGTGGGCAGCATCGGCCTAACAGAGCCC
GAGGCCATTGAAGAATATGGCCAGGACAAGGTCAAGGTGTACAAGACGTCGTTTACCGCCATGTACTACGCCATG
ATGGACCCCGAGCAAAAGGGCCCTACCAGCTACAAACTCATCGTGGTGGGCCCTGACGAAAAGGTTGTAGGCCTG
CACATCATGGGTCAGGGAAGCGCCGAGATGCTGCAAGGCTTTGGTGTGGCGGTCAAGATGGGAGCCACAAAGGCC
GACTTTGATAGCTGCGTTGCCATTCACCCCACGAGCGCCGAGGAGTTGGTGACGCTGAAATAG
Transcript >OphauB2|5972
ATGGCGCCCGTCACCAAAGAAGCCGACTATCTCGTCATTGGCGGCGGCAGCGGAGGTCTCGCCTCGGCTCGCATG
GCCAGCTCCAAATTTGGCGCAAAGGCACTCGTGGTCGAAGCCAAGCGCCTGGGCGGAACTTGTGTCAATGTTGGC
TGCGTTCCGAAAAAGATAACCTACAATGCGGCAGCCATCGCCGAAACGATTCACGATGCAAAGGCATACGGCTTC
TCTGTCCAACAGACGGCTCCCTTTGACTGGGCCACGTTCAAGAAGAAGCGCGATGCCTATGTCGAGCGACTCAAT
GGCATATATGCGCGCAACCTCTCCAACGACAAGGTGGAGTATCTGCACGGCCACGGCCGTCTTGTCTCTCGCAAC
CAGGTCCAAGTAACGCTGGACGATGGCTCAACAGTGCTTGTAAACGCCAAGAAGATACTCATCGCCGTTGGTGGT
CGTCCCAGCGAGCCGCCAAATATCCCCGGTGCCGAGCTCGGTATTAACAGTGATGGCTTCTTCGACATTGCGACG
CAGCCCAAGCGAGTCGCAATCGTCGGTGGCGGCTATATTGCCGTTGAGTTTGCCGGCATGTTCAACGCGCTTGGC
ACCGATACTCATCTGTTTATTCGGCACGATACCTTTTTGCGTAAATTCGATCCCATGATTCAAGAGGCCGTCACC
AAGGAGTACGGACGGCTGGGGATTAACATGCACAAGCGTTCCCAATTGTCGCGGGTAGAAAAGGACGCTAGCAGC
GGCAAGCTGAGGGTAACGTATCGCGACGATGCTGGCAAAGAGAGCTCCGTCTCCGATGTCGACCATTTGATCTGG
GCTATTGGACGTGTCCCTGAAACGGCTGGGATTGGGCTCGATCAAGTCGGTGTCAAGCTCAACGAAAAGGGCTAC
GTGGTTGTCGACGAGTACCAAAACAGCAATATTGACAATATATACGCCTTGGGCGATGTGGCAGGCCGTGTCGAG
CTGACGCCTGTGGCGATTGCTGCCGGGCGCAAGCTCGCCCATCGCCTCTTTGGCCCACCCCAGTTTTCCACTGCC
AAGCTAGACTATGTCAACGTGCCATCCGTCGTCTTTGCGCATCCCGAGGTGGGCAGCATCGGCCTAACAGAGCCC
GAGGCCATTGAAGAATATGGCCAGGACAAGGTCAAGGTGTACAAGACGTCGTTTACCGCCATGTACTACGCCATG
ATGGACCCCGAGCAAAAGGGCCCTACCAGCTACAAACTCATCGTGGTGGGCCCTGACGAAAAGGTTGTAGGCCTG
CACATCATGGGTCAGGGAAGCGCCGAGATGCTGCAAGGCTTTGGTGTGGCGGTCAAGATGGGAGCCACAAAGGCC
GACTTTGATAGCTGCGTTGCCATTCACCCCACGAGCGCCGAGGAGTTGGTGACGCTGAAATAG
Gene >OphauB2|5972
ATGGCGCCCGTCACCAAAGAAGCCGACTATCTCGTCATTGGCGGCGGCAGCGGAGGTCTCGCCTCGGCTCGCATG
GCCAGCTCCAAATTTGGCGCAAAGGCACTCGTGGTCGAAGCCAAGCGCCTGGGCGGAACTTGTGTCAATGTTGGG
TACGGTTTCAGGCCTTGTTGAAACATGTCGTCGAGGCGATTCTGACTCAGTCCTTGTCTGTAGCTGCGTTCCGAA
AAAGATAACCTACAATGCGGCAGCCATCGCCGAAACGATTCACGATGCAAAGGCATACGGCTTCTCTGTCCAACA
GACGGCTCCCTTTGACTGGGCCACGTTCAAGAAGAAGCGCGATGCCTATGTCGAGCGACTCAATGGCATATATGC
GCGCAACCTCTCCAACGACAAGGTGGAGTATCTGCACGGCCACGGCCGTCTTGTCTCTCGCAACCAGGTCCAAGT
AACGCTGGACGATGGCTCAACAGTGCTTGTAAACGCCAAGAAGATACTCATCGCCGTTGGTGGTCGTCCCAGCGA
GCCGCCAAATATCCCCGGTGCCGAGCTCGGTATTAACAGTGATGGCTTCTTCGACATTGCGACGCAGCCCAAGCG
AGTCGCAATCGTCGGTGGCGGCTATATTGCCGTTGAGTTTGCCGGCATGTTCAACGCGCTTGGCACCGATACTCA
TCTGTTTATTCGGCACGATACCTTTTTGCGTAAATTCGATCCCATGATTCAAGAGGCCGTCACCAAGGAGTACGG
ACGGCTGGGGATTAACATGCACAAGCGTTCCCAATTGTCGCGGGTAGAAAAGGACGCTAGCAGCGGCAAGCTGAG
GGTAACGTATCGCGACGATGCTGGCAAAGAGAGCTCCGTCTCCGATGTCGACCATTTGATCTGGGCTATTGGACG
TGTCCCTGAAACGGCTGGGATTGGGCTCGATCAAGTCGGTGTCAAGCTCAACGAAAAGGGCTACGTGGTTGTCGA
CGAGTACCAAAACAGCAATATTGACAATATATACGCCTTGGGCGATGTGGCAGGCCGTGTCGAGCTGACGCCTGT
GGCGATTGCTGCCGGGCGCAAGCTCGCCCATCGCCTCTTTGGCCCACCCCAGTTTTCCACTGCCAAGCTAGACTA
TGTCAACGTGCCATCCGTCGTCTTTGCGCATCCCGAGGTGGGCAGCATCGGCCTAACAGAGCCCGAGGCCATTGA
AGAATATGGCCAGGACAAGGTCAAGGTGTACAAGACGTCGTTTACCGCCATGTACTACGCCATGATGGACCCCGA
GCAAAAGGGCCCTACCAGCTACAAACTCATCGTGGTGGGCCCTGACGAAAAGGTTGTAGGCCTGCACATCATGGG
TCAGGGAAGCGCCGAGATGCTGCAAGGCTTTGGTGTGGCGGTCAAGATGGGAGCCACAAAGGCCGACTTTGATAG
CTGCGTTGCCATTCACCCCACGAGCGCCGAGGAGTTGGTGACGCTGAAATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail