Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|5967
Gene name
LocationContig_5:304230..305240
Strand-
Gene length (bp)1010
Transcript length (bp)849
Coding sequence length (bp)849
Protein length (aa) 283

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) 5.8E-10 18 83
PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) 7.9E-10 151 219

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q39061|CP33_ARATH RNA-binding protein CP33, chloroplastic OS=Arabidopsis thaliana GN=CP33 PE=2 SV=1 17 229 2.0E-07
sp|Q9FPJ8|RB45A_ARATH Polyadenylate-binding protein RBP45A OS=Arabidopsis thaliana GN=RBP45A PE=2 SV=1 1 219 2.0E-06

GO

GO Term Description Terminal node
GO:0003723 RNA binding Yes
GO:0003674 molecular_function No
GO:0005488 binding No
GO:1901363 heterocyclic compound binding No
GO:0097159 organic cyclic compound binding No
GO:0003676 nucleic acid binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 15 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|5967
MQADSPDQSDALAQGRRIYLGNLLYRIKPQHVEQVLVEKGFGDFEKIHISIDPVSARNPGYCFVDFADPSTAQRA
LSSLHATIEGRPIRVGPCEPKKPRSQNGGRFAFQRWGDWGAGAGDNDMPSRGAQQGPHGALEHFVDMAQGQRGRR
LYVGGLGKMIDQAQNNQEISDIFADFNPTAIGKRITPMPGHQHYCFVDFETKEEAQAAIQALNGKPIQGGGRLKV
RLANNFPARLDRLPADEHTSRTHQTASWRSKDLRLTNPAEANSRAMASNDWRRKGAH*
Coding >OphauB2|5967
ATGCAGGCCGACTCGCCAGACCAATCCGATGCCTTGGCCCAAGGCCGCCGCATCTATCTGGGCAATCTCTTGTAC
AGAATCAAGCCGCAGCATGTGGAGCAAGTCCTCGTTGAAAAGGGCTTTGGCGACTTTGAAAAGATTCACATCTCC
ATCGACCCCGTCAGTGCGCGCAACCCGGGCTACTGCTTTGTCGACTTTGCCGACCCCTCAACCGCCCAGCGCGCC
CTCTCCTCCTTGCATGCCACCATTGAAGGCCGGCCCATCAGGGTCGGTCCCTGTGAGCCCAAGAAACCGCGCAGC
CAGAACGGCGGCCGCTTTGCCTTTCAGCGATGGGGCGACTGGGGCGCCGGCGCCGGCGACAACGACATGCCATCA
AGAGGCGCCCAGCAGGGGCCTCACGGGGCTCTCGAGCACTTTGTCGATATGGCTCAGGGCCAGCGAGGAAGAAGA
CTATACGTCGGTGGCCTGGGCAAGATGATTGACCAGGCCCAAAACAATCAAGAGATTAGCGACATCTTTGCCGAC
TTTAATCCCACGGCAATCGGCAAACGCATCACGCCCATGCCGGGCCACCAGCACTACTGCTTCGTCGACTTTGAA
ACAAAAGAGGAGGCTCAAGCCGCCATACAAGCCCTCAACGGCAAGCCCATACAAGGAGGTGGGAGGCTCAAAGTC
AGGCTGGCCAATAACTTTCCAGCCAGGCTGGATCGTCTCCCCGCCGACGAACACACCAGCCGCACACACCAGACA
GCTTCTTGGCGCTCCAAGGACTTGCGTCTCACCAATCCAGCCGAGGCCAACAGCAGGGCCATGGCGTCCAATGAT
TGGCGCAGAAAAGGCGCCCATTAG
Transcript >OphauB2|5967
ATGCAGGCCGACTCGCCAGACCAATCCGATGCCTTGGCCCAAGGCCGCCGCATCTATCTGGGCAATCTCTTGTAC
AGAATCAAGCCGCAGCATGTGGAGCAAGTCCTCGTTGAAAAGGGCTTTGGCGACTTTGAAAAGATTCACATCTCC
ATCGACCCCGTCAGTGCGCGCAACCCGGGCTACTGCTTTGTCGACTTTGCCGACCCCTCAACCGCCCAGCGCGCC
CTCTCCTCCTTGCATGCCACCATTGAAGGCCGGCCCATCAGGGTCGGTCCCTGTGAGCCCAAGAAACCGCGCAGC
CAGAACGGCGGCCGCTTTGCCTTTCAGCGATGGGGCGACTGGGGCGCCGGCGCCGGCGACAACGACATGCCATCA
AGAGGCGCCCAGCAGGGGCCTCACGGGGCTCTCGAGCACTTTGTCGATATGGCTCAGGGCCAGCGAGGAAGAAGA
CTATACGTCGGTGGCCTGGGCAAGATGATTGACCAGGCCCAAAACAATCAAGAGATTAGCGACATCTTTGCCGAC
TTTAATCCCACGGCAATCGGCAAACGCATCACGCCCATGCCGGGCCACCAGCACTACTGCTTCGTCGACTTTGAA
ACAAAAGAGGAGGCTCAAGCCGCCATACAAGCCCTCAACGGCAAGCCCATACAAGGAGGTGGGAGGCTCAAAGTC
AGGCTGGCCAATAACTTTCCAGCCAGGCTGGATCGTCTCCCCGCCGACGAACACACCAGCCGCACACACCAGACA
GCTTCTTGGCGCTCCAAGGACTTGCGTCTCACCAATCCAGCCGAGGCCAACAGCAGGGCCATGGCGTCCAATGAT
TGGCGCAGAAAAGGCGCCCATTAG
Gene >OphauB2|5967
ATGCAGGCCGACTCGCCAGACCAATCCGATGCCTTGGCCCAAGGCCGCCGCATCTATCTGGGTGCAGTCACCTGT
TGCGCCTTGTCAGATGCTGTAACCGCGGCTAACCCGTCAGCGCCAAGACAGGCAATCTCTTGTACAGAATCAAGC
CGCAGCATGTGGAGCAAGTCCTCGTTGAAAAGGGCTTTGGCGACTTTGAAAAGATTCACATCTCCATCGACCCCG
TCAGTGCGCGCAACCCGGGCTACTGCTTTGTCGACTTTGCCGACCCCTCAACCGCCCAGCGCGCCCTCTCCTCCT
TGCATGCCACCATTGAAGGCCGGCCCATCAGGGTCGGTCCCTGTGAGCCCAAGAAACCGCGCAGCCAGAACGGCG
GCCGCTTTGCCTTTCAGCGATGGGGCGACTGGGGCGCCGGCGCCGGCGACAACGACATGCCATCAAGAGGCGCCC
AGCAGGGGCCTCACGGGGCTCTCGAGCACTTTGTCGATATGGCTCAGGGCCAGCGAGGAAGAAGACTATACGTCG
GTGGCCTGGGCAAGATGATTGACCAGGCCCAAAACAATCAAGAGATTAGCGACATCTTTGCCGACTTTAATCCGT
GAGTGGCAGCATTCCCGGCTTCTTTACCTCTGCTCCACGTCTCCTCCACGTCTCCTCCCGCCACTAATCGCTCAT
TGCAATTACCCTGCTCCAGCACGGCAATCGGCAAACGCATCACGCCCATGCCGGGCCACCAGCACTACTGCTTCG
TCGACTTTGAAACAAAAGAGGAGGCTCAAGCCGCCATACAAGCCCTCAACGGCAAGCCCATACAAGGAGGTGGGA
GGCTCAAAGTCAGGCTGGCCAATAACTTTCCAGCCAGGCTGGATCGTCTCCCCGCCGACGAACACACCAGCCGCA
CACACCAGACAGCTTCTTGGCGCTCCAAGGACTTGCGTCTCACCAATCCAGCCGAGGCCAACAGCAGGGCCATGG
CGTCCAATGATTGGCGCAGAAAAGGCGCCCATTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail