Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|5953
Gene name
LocationContig_5:263771..264593
Strand-
Gene length (bp)822
Transcript length (bp)651
Coding sequence length (bp)651
Protein length (aa) 217

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13499 EF-hand_7 EF-hand domain pair 3.0E-07 66 114
PF13499 EF-hand_7 EF-hand domain pair 1.5E-15 125 197
PF00036 EF-hand_1 EF hand 1.4E-06 92 116
PF00036 EF-hand_1 EF hand 2.9E-08 127 153
PF13405 EF-hand_6 EF-hand domain 2.7E-06 92 116
PF13202 EF-hand_5 EF hand 2.5E-04 92 111
PF13202 EF-hand_5 EF hand 3.5E-05 130 150
PF13202 EF-hand_5 EF hand 4.0E-04 176 197
PF13833 EF-hand_8 EF-hand domain pair 7.2E-05 66 112
PF13833 EF-hand_8 EF-hand domain pair 1.3E-03 124 149
PF13833 EF-hand_8 EF-hand domain pair 1.5E-02 157 199

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q09711|NCS1_SCHPO Calcium-binding protein NCS-1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ncs1 PE=1 SV=2 31 216 2.0E-105
sp|P62168|NCS1_RAT Neuronal calcium sensor 1 OS=Rattus norvegicus GN=Ncs1 PE=1 SV=2 31 216 4.0E-84
sp|Q8BNY6|NCS1_MOUSE Neuronal calcium sensor 1 OS=Mus musculus GN=Ncs1 PE=1 SV=3 31 216 4.0E-84
sp|P62166|NCS1_HUMAN Neuronal calcium sensor 1 OS=Homo sapiens GN=NCS1 PE=1 SV=2 31 216 4.0E-84
sp|P62167|NCS1_CHICK Neuronal calcium sensor 1 OS=Gallus gallus GN=NCS1 PE=1 SV=2 31 216 4.0E-84
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q09711|NCS1_SCHPO Calcium-binding protein NCS-1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ncs1 PE=1 SV=2 31 216 2.0E-105
sp|P62168|NCS1_RAT Neuronal calcium sensor 1 OS=Rattus norvegicus GN=Ncs1 PE=1 SV=2 31 216 4.0E-84
sp|Q8BNY6|NCS1_MOUSE Neuronal calcium sensor 1 OS=Mus musculus GN=Ncs1 PE=1 SV=3 31 216 4.0E-84
sp|P62166|NCS1_HUMAN Neuronal calcium sensor 1 OS=Homo sapiens GN=NCS1 PE=1 SV=2 31 216 4.0E-84
sp|P62167|NCS1_CHICK Neuronal calcium sensor 1 OS=Gallus gallus GN=NCS1 PE=1 SV=2 31 216 4.0E-84
sp|Q91614|NCS1_XENLA Neuronal calcium sensor 1 OS=Xenopus laevis GN=ncs1 PE=2 SV=2 31 216 4.0E-84
sp|Q5RC90|NCS1_PONAB Neuronal calcium sensor 1 OS=Pongo abelii GN=NCS1 PE=2 SV=3 31 216 8.0E-84
sp|Q06389|NCS1_YEAST Calcium-binding protein NCS-1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FRQ1 PE=1 SV=2 29 216 9.0E-84
sp|Q2V8Y7|NCS1_BOVIN Neuronal calcium sensor 1 OS=Bos taurus GN=NCS1 PE=1 SV=3 31 216 1.0E-82
sp|P36608|NCS1_CAEEL Neuronal calcium sensor 1 OS=Caenorhabditis elegans GN=ncs-1 PE=2 SV=2 31 215 4.0E-82
sp|P42325|NCAH_DROME Neurocalcin homolog OS=Drosophila melanogaster GN=Nca PE=1 SV=2 28 209 1.0E-77
sp|Q16981|NCS1_APLCA Neuronal calcium sensor 1 OS=Aplysia californica PE=2 SV=2 30 213 2.0E-77
sp|Q3YLA4|NCS1_LYMST Neuronal calcium sensor 1 OS=Lymnaea stagnalis PE=2 SV=2 30 213 2.0E-76
sp|Q16982|NECX_APLCA Neurocalcin OS=Aplysia californica PE=2 SV=2 28 209 2.0E-76
sp|B5FZ84|HPCL1_TAEGU Hippocalcin-like protein 1 OS=Taeniopygia guttata GN=HPCAL1 PE=2 SV=1 28 209 1.0E-75
sp|P42324|HPCL1_CHICK Hippocalcin-like protein 1 OS=Gallus gallus GN=HPCAL1 PE=1 SV=2 28 209 1.0E-75
sp|P62749|HPCL1_RAT Hippocalcin-like protein 1 OS=Rattus norvegicus GN=Hpcal1 PE=1 SV=2 28 209 2.0E-75
sp|P62748|HPCL1_MOUSE Hippocalcin-like protein 1 OS=Mus musculus GN=Hpcal1 PE=1 SV=2 28 209 2.0E-75
sp|P84076|HPCA_RAT Neuron-specific calcium-binding protein hippocalcin OS=Rattus norvegicus GN=Hpca PE=1 SV=2 28 209 3.0E-75
sp|Q06AT1|HPCA_PIG Neuron-specific calcium-binding protein hippocalcin OS=Sus scrofa GN=HPCA PE=2 SV=3 28 209 3.0E-75
sp|P84075|HPCA_MOUSE Neuron-specific calcium-binding protein hippocalcin OS=Mus musculus GN=Hpca PE=1 SV=2 28 209 3.0E-75
sp|P84074|HPCA_HUMAN Neuron-specific calcium-binding protein hippocalcin OS=Homo sapiens GN=HPCA PE=1 SV=2 28 209 3.0E-75
sp|Q4PL64|HPCA_BOVIN Neuron-specific calcium-binding protein hippocalcin OS=Bos taurus GN=HPCA PE=2 SV=3 28 209 3.0E-75
sp|B3VSB7|HPCL1_SHEEP Hippocalcin-like protein 1 OS=Ovis aries GN=HPCAL1 PE=2 SV=1 28 209 4.0E-75
sp|Q06AT0|HPCL1_PIG Hippocalcin-like protein 1 OS=Sus scrofa GN=HPCAL1 PE=2 SV=3 28 209 4.0E-75
sp|P29105|HPCL1_BOVIN Hippocalcin-like protein 1 OS=Bos taurus GN=HPCAL1 PE=1 SV=4 28 209 4.0E-75
sp|P37235|HPCL1_HUMAN Hippocalcin-like protein 1 OS=Homo sapiens GN=HPCAL1 PE=1 SV=3 28 209 5.0E-75
sp|Q28IM6|HPCL1_XENTR Hippocalcin-like protein 1 OS=Xenopus tropicalis GN=hpcal1 PE=2 SV=1 28 209 6.0E-75
sp|Q6DCM9|HPCL1_XENLA Hippocalcin-like protein 1 OS=Xenopus laevis GN=hpcal1 PE=2 SV=1 28 209 8.0E-75
sp|B3DLU1|NCALD_XENTR Neurocalcin-delta OS=Xenopus tropicalis GN=ncald PE=2 SV=1 28 209 9.0E-75
sp|Q7SY75|NCALD_XENLA Neurocalcin-delta OS=Xenopus laevis GN=ncald PE=2 SV=1 28 209 1.0E-74
sp|P62759|NCALD_TAEGU Neurocalcin-delta OS=Taeniopygia guttata GN=NCALD PE=2 SV=2 28 209 2.0E-74
sp|P62758|NCALD_CHICK Neurocalcin-delta OS=Gallus gallus GN=NCALD PE=2 SV=2 28 209 2.0E-74
sp|A9JTH1|NCLDA_DANRE Neurocalcin-delta A OS=Danio rerio GN=ncalda PE=2 SV=1 28 209 2.0E-74
sp|Q5PQN0|NCALD_RAT Neurocalcin-delta OS=Rattus norvegicus GN=Ncald PE=1 SV=3 28 209 3.0E-74
sp|Q91X97|NCALD_MOUSE Neurocalcin-delta OS=Mus musculus GN=Ncald PE=1 SV=4 28 209 3.0E-74
sp|Q4R4N4|NCALD_MACFA Neurocalcin-delta OS=Macaca fascicularis GN=NCALD PE=2 SV=3 28 209 3.0E-74
sp|P61601|NCALD_HUMAN Neurocalcin-delta OS=Homo sapiens GN=NCALD PE=1 SV=2 28 209 3.0E-74
sp|P61602|NCALD_BOVIN Neurocalcin-delta OS=Bos taurus GN=NCALD PE=1 SV=2 28 209 3.0E-74
sp|Q5R632|HPCL1_PONAB Hippocalcin-like protein 1 OS=Pongo abelii GN=HPCAL1 PE=2 SV=3 28 209 1.0E-73
sp|Q5RAH1|NCALD_PONAB Neurocalcin-delta OS=Pongo abelii GN=NCALD PE=2 SV=3 28 209 3.0E-73
sp|P62762|VISL1_RAT Visinin-like protein 1 OS=Rattus norvegicus GN=Vsnl1 PE=1 SV=2 28 209 4.0E-72
sp|Q5RD22|VISL1_PONAB Visinin-like protein 1 OS=Pongo abelii GN=VSNL1 PE=2 SV=3 28 209 4.0E-72
sp|P62761|VISL1_MOUSE Visinin-like protein 1 OS=Mus musculus GN=Vsnl1 PE=1 SV=2 28 209 4.0E-72
sp|Q4R5F7|VISL1_MACFA Visinin-like protein 1 OS=Macaca fascicularis GN=VSNL1 PE=2 SV=3 28 209 4.0E-72
sp|P62760|VISL1_HUMAN Visinin-like protein 1 OS=Homo sapiens GN=VSNL1 PE=1 SV=2 28 209 4.0E-72
sp|P62764|VISL1_CHICK Visinin-like protein 1 OS=Gallus gallus GN=VSNL1 PE=2 SV=2 28 209 4.0E-72
sp|P62763|VISL1_BOVIN Visinin-like protein 1 OS=Bos taurus GN=VSNL1 PE=1 SV=2 28 209 4.0E-72
sp|Q6AXL4|NCLDB_DANRE Neurocalcin-delta B OS=Danio rerio GN=ncaldb PE=2 SV=1 28 209 1.0E-71
sp|P35332|HPCL4_RAT Hippocalcin-like protein 4 OS=Rattus norvegicus GN=Hpcal4 PE=2 SV=2 32 209 1.0E-70
sp|Q8BGZ1|HPCL4_MOUSE Hippocalcin-like protein 4 OS=Mus musculus GN=Hpcal4 PE=1 SV=3 32 209 4.0E-70
sp|Q5R6S5|HPCL4_PONAB Hippocalcin-like protein 4 OS=Pongo abelii GN=HPCAL4 PE=2 SV=3 32 209 4.0E-70
sp|Q9UM19|HPCL4_HUMAN Hippocalcin-like protein 4 OS=Homo sapiens GN=HPCAL4 PE=1 SV=3 32 209 4.0E-70
sp|P29104|HPCL4_BOVIN Hippocalcin-like protein 4 OS=Bos taurus GN=HPCAL4 PE=1 SV=3 32 209 4.0E-70
sp|P37236|FREQ_DROME Frequenin-1 OS=Drosophila melanogaster GN=Frq1 PE=2 SV=2 30 214 3.0E-69
sp|Q8MIH6|RECO_CANLF Recoverin OS=Canis lupus familiaris GN=RCVRN PE=3 SV=1 30 206 4.0E-56
sp|P21457|RECO_BOVIN Recoverin OS=Bos taurus GN=RCVRN PE=1 SV=3 30 206 5.0E-56
sp|P36609|NCS2_CAEEL Neuronal calcium sensor 2 OS=Caenorhabditis elegans GN=ncs-2 PE=2 SV=2 29 210 3.0E-55
sp|P34057|RECO_MOUSE Recoverin OS=Mus musculus GN=Rcvrn PE=2 SV=2 29 206 4.0E-54
sp|P35243|RECO_HUMAN Recoverin OS=Homo sapiens GN=RCVRN PE=1 SV=2 29 206 4.0E-54
sp|Q9JJ57|KCIP1_MOUSE Kv channel-interacting protein 1 OS=Mus musculus GN=Kcnip1 PE=1 SV=2 37 216 4.0E-52
sp|Q8R426|KCIP1_RAT Kv channel-interacting protein 1 OS=Rattus norvegicus GN=Kcnip1 PE=1 SV=2 37 216 4.0E-52
sp|Q8HYN7|KCIP4_MACFA Kv channel-interacting protein 4 OS=Macaca fascicularis GN=KCNIP4 PE=2 SV=1 37 216 5.0E-52
sp|Q6PIL6|KCIP4_HUMAN Kv channel-interacting protein 4 OS=Homo sapiens GN=KCNIP4 PE=1 SV=1 37 216 5.0E-52
sp|Q99MG9|KCIP4_RAT Kv channel-interacting protein 4 OS=Rattus norvegicus GN=Kcnip4 PE=1 SV=1 37 216 5.0E-52
sp|Q6PHZ8|KCIP4_MOUSE Kv channel-interacting protein 4 OS=Mus musculus GN=Kcnip4 PE=1 SV=1 37 216 5.0E-52
sp|P31227|SMOD_LITCT S-modulin OS=Lithobates catesbeiana PE=1 SV=4 30 206 1.0E-51
sp|Q9NZI2|KCIP1_HUMAN Kv channel-interacting protein 1 OS=Homo sapiens GN=KCNIP1 PE=1 SV=2 37 216 2.0E-51
sp|Q8WN03|KCIP2_MUSPF Kv channel-interacting protein 2 OS=Mustela putorius furo GN=Kcnip2 PE=2 SV=1 37 216 2.0E-51
sp|Q9NS61|KCIP2_HUMAN Kv channel-interacting protein 2 OS=Homo sapiens GN=KCNIP2 PE=1 SV=3 37 216 2.0E-51
sp|Q2KI69|KCIP4_BOVIN Kv channel-interacting protein 4 OS=Bos taurus GN=KCNIP4 PE=2 SV=1 37 216 3.0E-51
sp|Q9JM47|CSEN_RAT Calsenilin OS=Rattus norvegicus GN=Kcnip3 PE=1 SV=1 37 216 6.0E-51
sp|Q17QD9|CSEN_BOVIN Calsenilin OS=Bos taurus GN=KCNIP3 PE=2 SV=1 37 216 7.0E-51
sp|Q9JJ69|KCIP2_MOUSE Kv channel-interacting protein 2 OS=Mus musculus GN=Kcnip2 PE=1 SV=2 37 216 7.0E-51
sp|Q9Y2W7|CSEN_HUMAN Calsenilin OS=Homo sapiens GN=KCNIP3 PE=1 SV=1 37 216 7.0E-51
sp|Q9JM59|KCIP2_RAT Kv channel-interacting protein 2 OS=Rattus norvegicus GN=Kcnip2 PE=1 SV=2 37 216 1.0E-50
sp|Q9QXT8|CSEN_MOUSE Calsenilin OS=Mus musculus GN=Kcnip3 PE=1 SV=2 37 216 2.0E-50
sp|P22728|VISI_CHICK Visinin OS=Gallus gallus PE=2 SV=5 30 206 4.0E-49
sp|Q75K28|NCSA_DICDI Calcium-binding protein NCSA OS=Dictyostelium discoideum GN=ncsA PE=1 SV=2 34 213 2.0E-41
sp|O73763|GCIP_LITPI Guanylyl cyclase inhibitory protein OS=Lithobates pipiens GN=GCIP PE=2 SV=3 52 205 7.0E-37
sp|O73762|GUC1B_LITPI Guanylyl cyclase-activating protein 2 OS=Lithobates pipiens GN=GUCA1B PE=2 SV=3 37 211 3.0E-36
sp|P79881|GUC1B_CHICK Guanylyl cyclase-activating protein 2 OS=Gallus gallus GN=GUCA1B PE=2 SV=3 46 211 1.0E-35
sp|Q9UMX6|GUC1B_HUMAN Guanylyl cyclase-activating protein 2 OS=Homo sapiens GN=GUCA1B PE=1 SV=4 41 211 4.0E-35
sp|P51177|GUC1B_BOVIN Guanylyl cyclase-activating protein 2 OS=Bos taurus GN=GUCA1B PE=1 SV=2 33 211 2.0E-34
sp|Q8VBV8|GUC1B_MOUSE Guanylyl cyclase-activating protein 2 OS=Mus musculus GN=Guca1b PE=2 SV=3 41 211 7.0E-33
sp|O73761|GUC1A_LITPI Guanylyl cyclase-activating protein 1 OS=Lithobates pipiens GN=GUCA1A PE=2 SV=3 52 210 3.0E-31
sp|P43080|GUC1A_HUMAN Guanylyl cyclase-activating protein 1 OS=Homo sapiens GN=GUCA1A PE=1 SV=3 52 210 4.0E-31
sp|P46065|GUC1A_BOVIN Guanylyl cyclase-activating protein 1 OS=Bos taurus GN=GUCA1A PE=1 SV=2 52 210 1.0E-30
sp|P43081|GUC1A_MOUSE Guanylyl cyclase-activating protein 1 OS=Mus musculus GN=Guca1a PE=2 SV=3 38 210 2.0E-30
sp|P79880|GUC1A_CHICK Guanylyl cyclase-activating protein 1 OS=Gallus gallus GN=GUCA1A PE=1 SV=3 52 210 8.0E-30
sp|O95843|GUC1C_HUMAN Guanylyl cyclase-activating protein 3 OS=Homo sapiens GN=GUCA1C PE=1 SV=3 51 206 8.0E-24
sp|P42322|CANB1_NAEGR Calcineurin subunit B OS=Naegleria gruberi GN=CNB1 PE=3 SV=1 32 195 2.0E-19
sp|Q54LX0|CBPM_DICDI Calcium-binding protein M OS=Dictyostelium discoideum GN=cbpM PE=1 SV=1 30 211 1.0E-18
sp|Q874T7|CANB_KLULA Calcineurin subunit B OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=CNB1 PE=3 SV=1 46 207 1.0E-18
sp|P25296|CANB_YEAST Calcineurin subunit B OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CNB1 PE=1 SV=3 42 213 2.0E-18
sp|Q757B7|CANB_ASHGO Calcineurin subunit B OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=CNB1 PE=3 SV=1 39 211 5.0E-18
sp|Q6BWS8|CANB_DEBHA Calcineurin subunit B OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=CNB1 PE=3 SV=1 35 211 7.0E-18
sp|Q6FLU4|CANB_CANGA Calcineurin subunit B OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=CNB1 PE=3 SV=1 42 211 9.0E-18
sp|Q86A72|Y4781_DICDI Recoverin family protein DDB_G0274781 OS=Dictyostelium discoideum GN=DDB_G0274781 PE=3 SV=1 24 206 3.0E-17
sp|Q3HRP0|CNBL7_ORYSJ Calcineurin B-like protein 7 OS=Oryza sativa subsp. japonica GN=CBL7 PE=2 SV=1 36 211 5.0E-17
sp|Q9UU93|CANB_SCHPO Calcineurin subunit B OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cnb1 PE=3 SV=1 35 197 9.0E-17
sp|Q3HRN9|CNBL8_ORYSJ Calcineurin B-like protein 8 OS=Oryza sativa subsp. japonica GN=CBL8 PE=2 SV=1 36 211 9.0E-16
sp|Q55G87|CANB1_DICDI Calcineurin subunit B type 1 OS=Dictyostelium discoideum GN=cnbA PE=1 SV=1 29 211 2.0E-15
sp|P0CM54|CANB_CRYNJ Calcineurin subunit B OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=CNB1 PE=2 SV=1 39 197 2.0E-15
sp|P0CM55|CANB_CRYNB Calcineurin subunit B OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=CNB1 PE=3 SV=1 39 197 2.0E-15
sp|Q7FRS8|CNBLA_ARATH Calcineurin B-like protein 10 OS=Arabidopsis thaliana GN=CBL10 PE=1 SV=1 1 211 3.0E-15
sp|Q63811|CANB2_MOUSE Calcineurin subunit B type 2 OS=Mus musculus GN=Ppp3r2 PE=1 SV=3 40 216 4.0E-15
sp|Q3HRN8|CNBL9_ORYSJ Calcineurin B-like protein 9 OS=Oryza sativa subsp. japonica GN=CBL9 PE=2 SV=2 27 211 4.0E-15
sp|Q43531|CCAMK_LILLO Calcium and calcium/calmodulin-dependent serine/threonine-protein kinase OS=Lilium longiflorum GN=CCAMK PE=1 SV=1 34 205 4.0E-15
sp|P63100|CANB1_RAT Calcineurin subunit B type 1 OS=Rattus norvegicus GN=Ppp3r1 PE=1 SV=2 34 195 5.0E-15
sp|Q63810|CANB1_MOUSE Calcineurin subunit B type 1 OS=Mus musculus GN=Ppp3r1 PE=1 SV=3 34 195 5.0E-15
sp|P63098|CANB1_HUMAN Calcineurin subunit B type 1 OS=Homo sapiens GN=PPP3R1 PE=1 SV=2 34 195 5.0E-15
sp|P63099|CANB1_BOVIN Calcineurin subunit B type 1 OS=Bos taurus GN=PPP3R1 PE=1 SV=2 34 195 5.0E-15
sp|P87072|CANB_NEUCR Calcineurin subunit B OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=cnb-1 PE=2 SV=2 39 195 8.0E-15
sp|P48451|CANB1_DROME Calcineurin subunit B type 1 OS=Drosophila melanogaster GN=CanB PE=2 SV=1 34 195 1.0E-14
sp|Q24214|CANB2_DROME Calcineurin subunit B type 2 OS=Drosophila melanogaster GN=CanB2 PE=1 SV=2 34 195 1.0E-14
sp|P28470|CANB2_RAT Calcineurin subunit B type 2 OS=Rattus norvegicus GN=Ppp3r2 PE=2 SV=2 45 216 1.0E-14
sp|Q6RET7|CCAMK_MEDTR Calcium and calcium/calmodulin-dependent serine/threonine-protein kinase DMI-3 OS=Medicago truncatula GN=DMI3 PE=2 SV=1 90 205 2.0E-14
sp|Q6DN52|CBPL_DICDI Calcium-binding protein L OS=Dictyostelium discoideum GN=cbpL PE=2 SV=1 31 212 2.0E-14
sp|O81223|CNBL4_ARATH Calcineurin B-like protein 4 OS=Arabidopsis thaliana GN=CBL4 PE=1 SV=3 42 211 4.0E-14
sp|Q9C5P6|CNBL6_ARATH Calcineurin B-like protein 6 OS=Arabidopsis thaliana GN=CBL6 PE=1 SV=2 41 211 4.0E-14
sp|Q6RET6|CCAMK_PEA Calcium and calcium/calmodulin-dependent serine/threonine-protein kinase (Fragment) OS=Pisum sativum GN=SYM9 PE=1 SV=2 34 205 4.0E-14
sp|Q3HRP1|CNBL6_ORYSJ Calcineurin B-like protein 6 OS=Oryza sativa subsp. japonica GN=CBL6 PE=2 SV=1 19 211 5.0E-14
sp|Q6CGE6|CANB_YARLI Calcineurin subunit B OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=CNB1 PE=3 SV=1 38 196 5.0E-14
sp|Q8LEM7|CNBL3_ARATH Calcineurin B-like protein 3 OS=Arabidopsis thaliana GN=CBL3 PE=1 SV=2 42 211 6.0E-14
sp|Q2TBI5|CANB2_BOVIN Calcineurin subunit B type 2 OS=Bos taurus GN=PPP3R2 PE=2 SV=3 45 216 7.0E-14
sp|Q6AVM3|CCAMK_ORYSJ Calcium and calcium/calmodulin-dependent serine/threonine-protein kinase OS=Oryza sativa subsp. japonica GN=CCAMK PE=2 SV=1 34 209 7.0E-14
sp|A0AAR7|CCAMK_LOTJA Calcium and calcium/calmodulin-dependent serine/threonine-protein kinase OS=Lotus japonicus GN=CCAMK PE=1 SV=1 34 205 9.0E-14
sp|Q9HAE3|EFCB1_HUMAN EF-hand calcium-binding domain-containing protein 1 OS=Homo sapiens GN=EFCAB1 PE=2 SV=1 40 206 2.0E-13
sp|Q75LU8|CNBL3_ORYSJ Calcineurin B-like protein 3 OS=Oryza sativa subsp. japonica GN=CBL3 PE=1 SV=1 42 211 3.0E-13
sp|O81445|CNBL1_ARATH Calcineurin B-like protein 1 OS=Arabidopsis thaliana GN=CBL1 PE=1 SV=3 36 211 3.0E-13
sp|Q96LZ3|CANB2_HUMAN Calcineurin subunit B type 2 OS=Homo sapiens GN=PPP3R2 PE=1 SV=3 45 195 3.0E-13
sp|Q9LTB8|CNBL9_ARATH Calcineurin B-like protein 9 OS=Arabidopsis thaliana GN=CBL9 PE=1 SV=3 36 211 4.0E-13
sp|Q3HRP5|CNBL2_ORYSJ Calcineurin B-like protein 2 OS=Oryza sativa subsp. japonica GN=CBL2 PE=2 SV=1 42 211 4.0E-13
sp|Q8LAS7|CNBL2_ARATH Calcineurin B-like protein 2 OS=Arabidopsis thaliana GN=CBL2 PE=1 SV=2 42 211 6.0E-13
sp|Q86IV8|CBPKL_DICDI Calcium-binding protein K-like OS=Dictyostelium discoideum GN=DDB_G0274357 PE=3 SV=1 31 161 1.0E-12
sp|Q7XC27|CNBL1_ORYSJ Calcineurin B-like protein 1 OS=Oryza sativa subsp. japonica GN=CBL1 PE=2 SV=2 29 211 1.0E-12
sp|Q32L26|EFCB1_BOVIN EF-hand calcium-binding domain-containing protein 1 OS=Bos taurus GN=EFCAB1 PE=2 SV=1 69 206 2.0E-12
sp|Q3HRN7|CNBLA_ORYSJ Calcineurin B-like protein 10 OS=Oryza sativa subsp. japonica GN=CBL10 PE=2 SV=1 48 211 2.0E-12
sp|Q9D3N2|EFCB1_MOUSE EF-hand calcium-binding domain-containing protein 1 OS=Mus musculus GN=Efcab1 PE=2 SV=1 40 210 2.0E-12
sp|Q3KQ77|EFCB1_XENLA EF-hand calcium-binding domain-containing protein 1 OS=Xenopus laevis GN=efcab1 PE=2 SV=1 37 209 6.0E-11
sp|Q75KU4|CNBL4_ORYSJ Calcineurin B-like protein 4 OS=Oryza sativa subsp. japonica GN=CBL4 PE=1 SV=1 67 211 9.0E-11
sp|Q86IV7|CBPK_DICDI Calcium-binding protein K OS=Dictyostelium discoideum GN=cbpK PE=3 SV=2 31 213 9.0E-11
sp|P19123|TNNC1_MOUSE Troponin C, slow skeletal and cardiac muscles OS=Mus musculus GN=Tnnc1 PE=1 SV=1 33 197 4.0E-10
sp|P61023|CHP1_RAT Calcineurin B homologous protein 1 OS=Rattus norvegicus GN=Chp1 PE=1 SV=2 34 159 5.0E-10
sp|P61022|CHP1_MOUSE Calcineurin B homologous protein 1 OS=Mus musculus GN=Chp1 PE=1 SV=2 34 159 5.0E-10
sp|Q86JE1|Y2130_DICDI Recoverin family protein DDB_G0272130 OS=Dictyostelium discoideum GN=DDB_G0272130 PE=1 SV=1 27 195 5.0E-10
sp|P02591|TNNC1_RABIT Troponin C, slow skeletal and cardiac muscles OS=Oryctolagus cuniculus GN=TNNC1 PE=1 SV=1 33 197 8.0E-10
sp|P63316|TNNC1_HUMAN Troponin C, slow skeletal and cardiac muscles OS=Homo sapiens GN=TNNC1 PE=1 SV=1 33 197 8.0E-10
sp|Q9FUQ7|CNBL8_ARATH Calcineurin B-like protein 8 OS=Arabidopsis thaliana GN=CBL8 PE=1 SV=1 42 211 9.0E-10
sp|Q3HRP2|CNBL5_ORYSJ Calcineurin B-like protein 5 OS=Oryza sativa subsp. japonica GN=CBL5 PE=2 SV=1 26 211 1.0E-09
sp|Q54WR4|PLDB_DICDI Phospholipase D B OS=Dictyostelium discoideum GN=pldB PE=2 SV=1 46 154 1.0E-09
sp|Q502J0|PCAT2_DANRE Lysophosphatidylcholine acyltransferase 2 OS=Danio rerio GN=lpcat2 PE=2 SV=1 50 196 2.0E-09
sp|Q3SYS6|CHP1_BOVIN Calcineurin B homologous protein 1 OS=Bos taurus GN=CHP1 PE=2 SV=1 34 159 2.0E-09
sp|Q5R7F0|CHP1_PONAB Calcineurin B homologous protein 1 OS=Pongo abelii GN=CHP1 PE=2 SV=3 34 159 3.0E-09
sp|Q99653|CHP1_HUMAN Calcineurin B homologous protein 1 OS=Homo sapiens GN=CHP1 PE=1 SV=3 34 159 3.0E-09
sp|Q9SUA6|CNBL7_ARATH Calcineurin B-like protein 7 OS=Arabidopsis thaliana GN=CBL7 PE=1 SV=1 64 211 3.0E-09
sp|P09860|TNNC1_CHICK Troponin C, slow skeletal and cardiac muscles OS=Gallus gallus GN=TNNC1 PE=1 SV=1 33 197 3.0E-09
sp|P63317|TNNC1_PIG Troponin C, slow skeletal and cardiac muscles OS=Sus scrofa GN=TNNC1 PE=1 SV=1 33 197 4.0E-09
sp|P63315|TNNC1_BOVIN Troponin C, slow skeletal and cardiac muscles OS=Bos taurus GN=TNNC1 PE=1 SV=1 33 197 4.0E-09
sp|Q55C62|CBPJ_DICDI Calcium-binding protein J OS=Dictyostelium discoideum GN=cbpJ PE=1 SV=1 31 151 7.0E-09
sp|Q8NFA0|UBP32_HUMAN Ubiquitin carboxyl-terminal hydrolase 32 OS=Homo sapiens GN=USP32 PE=1 SV=1 81 202 1.0E-08
sp|Q96PH1|NOX5_HUMAN NADPH oxidase 5 OS=Homo sapiens GN=NOX5 PE=1 SV=1 88 211 3.0E-08
sp|Q06850|CDPK1_ARATH Calcium-dependent protein kinase 1 OS=Arabidopsis thaliana GN=CPK1 PE=1 SV=1 66 195 5.0E-08
sp|P24044|CALM_PLAFA Calmodulin OS=Plasmodium falciparum PE=3 SV=4 33 195 5.0E-08
sp|P62203|CALM_PLAF7 Calmodulin OS=Plasmodium falciparum (isolate 3D7) GN=PF14_0323 PE=3 SV=2 33 195 5.0E-08
sp|P05936|TNNC1_COTJA Troponin C, slow skeletal and cardiac muscles OS=Coturnix coturnix japonica GN=TNNC1 PE=2 SV=1 33 195 5.0E-08
sp|P04352|CALM_CHLRE Calmodulin OS=Chlamydomonas reinhardtii PE=1 SV=2 37 195 6.0E-08
sp|P07463|CALM_PARTE Calmodulin OS=Paramecium tetraurelia GN=CAM PE=1 SV=3 37 195 8.0E-08
sp|P61859|CALM_NEUCR Calmodulin OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=cmd-1 PE=1 SV=2 34 195 1.0E-07
sp|Q9UWF0|CALM_MAGO7 Calmodulin OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=CMD1 PE=3 SV=4 34 195 1.0E-07
sp|P61860|CALM_COLTR Calmodulin OS=Colletotrichum trifolii PE=3 SV=2 34 195 1.0E-07
sp|P61861|CALM_COLGL Calmodulin OS=Colletotrichum gloeosporioides PE=2 SV=2 34 195 1.0E-07
sp|Q9LF55|CML32_ARATH Probable calcium-binding protein CML32 OS=Arabidopsis thaliana GN=CML32 PE=2 SV=1 67 196 1.0E-07
sp|Q9HFY6|CALM_BLAEM Calmodulin OS=Blastocladiella emersonii GN=CMD1 PE=3 SV=3 37 195 2.0E-07
sp|P60204|CALM_EMENI Calmodulin OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=camA PE=3 SV=2 34 195 2.0E-07
sp|P60205|CALM_ASPOR Calmodulin OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=cmdA PE=3 SV=2 34 195 2.0E-07
sp|P60206|CALM_AJECG Calmodulin OS=Ajellomyces capsulatus (strain G186AR / H82 / ATCC MYA-2454 / RMSCC 2432) GN=CAM1 PE=2 SV=2 34 195 2.0E-07
sp|Q5ZCK5|CML16_ORYSJ Probable calcium-binding protein CML16 OS=Oryza sativa subsp. japonica GN=CML16 PE=2 SV=1 31 202 2.0E-07
sp|Q9NJU9|CDPK3_PLAF7 Calcium-dependent protein kinase 3 OS=Plasmodium falciparum (isolate 3D7) GN=CPK3 PE=1 SV=1 67 197 2.0E-07
sp|P11118|CALM_EUGGR Calmodulin OS=Euglena gracilis PE=1 SV=2 34 195 3.0E-07
sp|Q8CIY2|DUOX1_RAT Dual oxidase 1 OS=Rattus norvegicus GN=Duox1 PE=1 SV=1 90 186 3.0E-07
sp|Q54MF3|CANB2_DICDI Calcineurin subunit B type 2 OS=Dictyostelium discoideum GN=cnbB PE=3 SV=1 48 160 4.0E-07
sp|O94739|CALM_PLEOS Calmodulin OS=Pleurotus ostreatus GN=CMD1 PE=2 SV=3 33 195 4.0E-07
sp|Q38870|CDPK2_ARATH Calcium-dependent protein kinase 2 OS=Arabidopsis thaliana GN=CPK2 PE=1 SV=1 53 195 5.0E-07
sp|Q9Z0F4|CIB1_MOUSE Calcium and integrin-binding protein 1 OS=Mus musculus GN=Cib1 PE=1 SV=3 29 211 5.0E-07
sp|Q8X187|CALM_PAXIN Calmodulin OS=Paxillus involutus GN=calA PE=2 SV=3 33 195 5.0E-07
sp|P11120|CALM_PLECO Calmodulin OS=Pleurotus cornucopiae GN=CMD1 PE=1 SV=2 33 195 5.0E-07
sp|Q5ZM44|CHP1_CHICK Calcineurin B homologous protein 1 OS=Gallus gallus GN=CHP1 PE=1 SV=3 34 159 6.0E-07
sp|O43745|CHP2_HUMAN Calcineurin B homologous protein 2 OS=Homo sapiens GN=CHP2 PE=1 SV=3 42 195 6.0E-07
sp|P02599|CALM_DICDI Calmodulin OS=Dictyostelium discoideum GN=calA PE=1 SV=3 35 195 7.0E-07
sp|Q8HZK2|DUOX2_PIG Dual oxidase 2 OS=Sus scrofa GN=DUOX2 PE=1 SV=2 90 157 7.0E-07
sp|A8CEP3|CALM_SACJA Calmodulin OS=Saccharina japonica GN=cam PE=2 SV=1 37 195 7.0E-07
sp|Q4V8A1|PCT2B_RAT Lysophosphatidylcholine acyltransferase 2B OS=Rattus norvegicus GN=Lpcat2b PE=2 SV=1 46 155 7.0E-07
sp|P84339|CALM_AGABI Calmodulin OS=Agaricus bisporus PE=1 SV=2 33 195 7.0E-07
sp|A8I1Q0|CALM_HETTR Calmodulin OS=Heterocapsa triquetra PE=2 SV=1 37 195 8.0E-07
sp|Q9NRD9|DUOX1_HUMAN Dual oxidase 1 OS=Homo sapiens GN=DUOX1 PE=1 SV=1 90 190 8.0E-07
sp|P10246|TNNC2_MELGA Troponin C, skeletal muscle OS=Meleagris gallopavo GN=TNNC2 PE=1 SV=2 92 195 9.0E-07
sp|Q9MZF4|DUOX1_CANLF Dual oxidase 1 OS=Canis lupus familiaris GN=DUOX1 PE=1 SV=1 90 186 9.0E-07
sp|P02598|CALM_TETPY Calmodulin OS=Tetrahymena pyriformis PE=1 SV=4 37 195 1.0E-06
sp|Q8HZK3|DUOX1_PIG Dual oxidase 1 OS=Sus scrofa GN=DUOX1 PE=2 SV=1 90 157 1.0E-06
sp|P69098|CALM_TRYBG Calmodulin OS=Trypanosoma brucei gambiense PE=3 SV=2 33 195 1.0E-06
sp|P69097|CALM_TRYBB Calmodulin OS=Trypanosoma brucei brucei PE=3 SV=2 33 195 1.0E-06
sp|Q0IUU4|CML2_ORYSJ Putative calmodulin-like protein 2 OS=Oryza sativa subsp. japonica GN=CML2 PE=3 SV=2 94 196 1.0E-06
sp|P20801|TNNC2_MOUSE Troponin C, skeletal muscle OS=Mus musculus GN=Tnnc2 PE=1 SV=2 92 195 1.0E-06
sp|Q9Y6T7|DGKB_HUMAN Diacylglycerol kinase beta OS=Homo sapiens GN=DGKB PE=2 SV=2 105 215 1.0E-06
sp|Q6NS52|DGKB_MOUSE Diacylglycerol kinase beta OS=Mus musculus GN=Dgkb PE=1 SV=2 105 215 1.0E-06
sp|Q9NZT1|CALL5_HUMAN Calmodulin-like protein 5 OS=Homo sapiens GN=CALML5 PE=1 SV=2 99 195 1.0E-06
sp|P49621|DGKB_RAT Diacylglycerol kinase beta OS=Rattus norvegicus GN=Dgkb PE=1 SV=1 105 215 1.0E-06
sp|Q7FZF1|CNBL5_ARATH Calcineurin B-like protein 5 OS=Arabidopsis thaliana GN=CBL5 PE=1 SV=3 36 196 1.0E-06
sp|Q8STF0|CALM_STRIE Calmodulin OS=Strongylocentrotus intermedius PE=2 SV=3 34 195 2.0E-06
sp|O97341|CALM_SUBDO Calmodulin OS=Suberites domuncula PE=2 SV=3 37 195 2.0E-06
sp|P14533|CABO_DORPE Squidulin OS=Doryteuthis pealeii PE=1 SV=1 94 197 2.0E-06
sp|A3E4D8|CALM_PROMN Calmodulin OS=Prorocentrum minimum PE=2 SV=1 37 195 2.0E-06
sp|A3E3H0|CALM_PFIPI Calmodulin OS=Pfiesteria piscicida PE=2 SV=1 37 195 2.0E-06
sp|A3E4F9|CALM_KARVE Calmodulin OS=Karlodinium veneficum PE=2 SV=1 37 195 2.0E-06
sp|A4UHC0|CALM_ALEFU Calmodulin OS=Alexandrium fundyense PE=2 SV=1 37 195 2.0E-06
sp|P21251|CALM_STIJA Calmodulin OS=Stichopus japonicus PE=1 SV=2 37 195 2.0E-06
sp|P18061|CALM_TRYCR Calmodulin OS=Trypanosoma cruzi GN=CALA2 PE=3 SV=2 33 195 2.0E-06
sp|P02588|TNNC2_CHICK Troponin C, skeletal muscle OS=Gallus gallus GN=TNNC2 PE=1 SV=3 92 195 2.0E-06
sp|P02595|CALM_PATSP Calmodulin OS=Patinopecten sp. PE=1 SV=2 37 195 2.0E-06
sp|P62184|CALM_RENRE Calmodulin OS=Renilla reniformis PE=1 SV=2 37 195 2.0E-06
sp|Q9D5U0|PCT2B_MOUSE Lysophosphatidylcholine acyltransferase 2B OS=Mus musculus GN=Lpcat2b PE=2 SV=1 17 155 2.0E-06
sp|Q9R010|CIB1_RAT Calcium and integrin-binding protein 1 OS=Rattus norvegicus GN=Cib1 PE=1 SV=3 29 211 2.0E-06
sp|A5A7I8|CDPK5_SOLTU Calcium-dependent protein kinase 5 OS=Solanum tuberosum GN=CPK5 PE=2 SV=1 66 195 2.0E-06
sp|B1A8Z2|CIB1_SHEEP Calcium and integrin-binding protein 1 OS=Ovis aries GN=CIB1 PE=2 SV=1 29 211 2.0E-06
sp|Q17QE5|CIB1_BOVIN Calcium and integrin-binding protein 1 OS=Bos taurus GN=CIB1 PE=2 SV=1 29 211 2.0E-06
sp|Q0IQB6|CML3_ORYSJ Calmodulin-like protein 3 OS=Oryza sativa subsp. japonica GN=CML3 PE=2 SV=1 94 196 2.0E-06
sp|P62146|CALMA_ARBPU Calmodulin-alpha (Fragment) OS=Arbacia punctulata PE=1 SV=2 37 195 2.0E-06
sp|P62155|CALM_XENLA Calmodulin OS=Xenopus laevis GN=calm1 PE=1 SV=2 37 195 2.0E-06
sp|P62151|CALM_TORCA Calmodulin OS=Torpedo californica PE=1 SV=2 37 195 2.0E-06
sp|Q6YNX6|CALM_SHEEP Calmodulin OS=Ovis aries GN=CALM2 PE=2 SV=3 37 195 2.0E-06
sp|P62161|CALM_RAT Calmodulin OS=Rattus norvegicus GN=Calm1 PE=1 SV=2 37 195 2.0E-06
sp|P62160|CALM_RABIT Calmodulin OS=Oryctolagus cuniculus GN=CALM PE=1 SV=2 37 195 2.0E-06
sp|Q5RAD2|CALM_PONAB Calmodulin OS=Pongo abelii GN=CALM PE=2 SV=3 37 195 2.0E-06
sp|Q71UH6|CALM_PERFV Calmodulin OS=Perca flavescens GN=calm PE=2 SV=3 37 195 2.0E-06
sp|P62156|CALM_ONCSP Calmodulin OS=Oncorhynchus sp. GN=calm PE=1 SV=2 37 195 2.0E-06
sp|P62204|CALM_MOUSE Calmodulin OS=Mus musculus GN=Calm1 PE=1 SV=2 37 195 2.0E-06
sp|P62158|CALM_HUMAN Calmodulin OS=Homo sapiens GN=CALM1 PE=1 SV=2 37 195 2.0E-06
sp|Q6PI52|CALM_DANRE Calmodulin OS=Danio rerio GN=calm1a PE=2 SV=3 37 195 2.0E-06
sp|Q6IT78|CALM_CTEID Calmodulin OS=Ctenopharyngodon idella GN=calm PE=2 SV=3 37 195 2.0E-06
sp|P62149|CALM_CHICK Calmodulin OS=Gallus gallus GN=CALM PE=1 SV=2 37 195 2.0E-06
sp|P62157|CALM_BOVIN Calmodulin OS=Bos taurus GN=CALM PE=1 SV=2 37 195 2.0E-06
sp|P62144|CALM_ANAPL Calmodulin OS=Anas platyrhynchos GN=CALM PE=2 SV=2 37 195 2.0E-06
sp|Q7T3T2|CALM_EPIAK Calmodulin OS=Epinephelus akaara GN=calm PE=2 SV=3 37 195 2.0E-06
sp|P02594|CALM_ELEEL Calmodulin OS=Electrophorus electricus GN=calm PE=2 SV=2 37 195 3.0E-06
sp|Q9UB37|CALM2_BRALA Calmodulin-2 OS=Branchiostoma lanceolatum GN=CAM2 PE=2 SV=3 37 197 3.0E-06
sp|Q9SJN6|CML31_ARATH Probable calcium-binding protein CML31 OS=Arabidopsis thaliana GN=CML31 PE=2 SV=2 67 196 3.0E-06
sp|Q99828|CIB1_HUMAN Calcium and integrin-binding protein 1 OS=Homo sapiens GN=CIB1 PE=1 SV=4 29 211 3.0E-06
sp|O02367|CALM_CIOIN Calmodulin OS=Ciona intestinalis PE=2 SV=3 37 195 3.0E-06
sp|P62154|CALM_LOCMI Calmodulin OS=Locusta migratoria PE=1 SV=2 37 195 3.0E-06
sp|P62152|CALM_DROME Calmodulin OS=Drosophila melanogaster GN=Cam PE=1 SV=2 37 195 3.0E-06
sp|P62145|CALM_APLCA Calmodulin OS=Aplysia californica GN=CAM PE=2 SV=2 37 195 3.0E-06
sp|P62153|CALMA_HALRO Calmodulin-A OS=Halocynthia roretzi PE=1 SV=2 37 195 3.0E-06
sp|P62148|CALM1_BRALA Calmodulin-1 OS=Branchiostoma lanceolatum PE=2 SV=2 37 195 3.0E-06
sp|P62147|CALM1_BRAFL Calmodulin-1 OS=Branchiostoma floridae PE=2 SV=2 37 195 3.0E-06
sp|O16305|CALM_CAEEL Calmodulin OS=Caenorhabditis elegans GN=cmd-1 PE=1 SV=3 37 195 3.0E-06
sp|Q9XZP2|CALM2_BRAFL Calmodulin-2 OS=Branchiostoma floridae GN=CAM2 PE=2 SV=4 37 195 3.0E-06
sp|Q09665|TNNC2_CAEEL Troponin C, isoform 2 OS=Caenorhabditis elegans GN=tnc-2 PE=2 SV=1 33 197 3.0E-06
sp|Q08AA9|NKD_ANOGA Protein naked cuticle homolog OS=Anopheles gambiae GN=nkd PE=2 SV=1 106 165 3.0E-06
sp|Q9GRJ1|CALM_LUMRU Calmodulin OS=Lumbricus rubellus PE=2 SV=3 37 195 3.0E-06
sp|P27166|CALM_STYLE Calmodulin OS=Stylonychia lemnae PE=3 SV=2 37 195 3.0E-06
sp|P25070|CML24_ARATH Calcium-binding protein CML24 OS=Arabidopsis thaliana GN=CML24 PE=2 SV=2 67 197 4.0E-06
sp|Q40302|CALM_MACPY Calmodulin OS=Macrocystis pyrifera PE=2 SV=3 37 195 4.0E-06
sp|Q95NR9|CALM_METSE Calmodulin OS=Metridium senile PE=1 SV=3 37 195 4.0E-06
sp|O96081|CALMB_HALRO Calmodulin-B OS=Halocynthia roretzi PE=3 SV=3 37 195 4.0E-06
sp|Q8BYI6|PCAT2_MOUSE Lysophosphatidylcholine acyltransferase 2 OS=Mus musculus GN=Lpcat2 PE=1 SV=1 17 196 4.0E-06
sp|Q9ZV15|CDPKK_ARATH Calcium-dependent protein kinase 20 OS=Arabidopsis thaliana GN=CPK20 PE=3 SV=1 66 195 4.0E-06
sp|P23286|CALM_CANAX Calmodulin OS=Candida albicans GN=CMD1 PE=3 SV=2 33 195 4.0E-06
sp|P02586|TNNC2_RABIT Troponin C, skeletal muscle OS=Oryctolagus cuniculus GN=TNNC2 PE=1 SV=2 92 195 5.0E-06
sp|Q5U206|CALL3_RAT Calmodulin-like protein 3 OS=Rattus norvegicus GN=Calml3 PE=2 SV=1 38 195 5.0E-06
sp|Q810D1|CHP2_RAT Calcineurin B homologous protein 2 OS=Rattus norvegicus GN=Chp2 PE=1 SV=1 32 195 5.0E-06
sp|Q71UH5|CALM_PYTSP Calmodulin OS=Pythium splendens PE=2 SV=1 37 195 5.0E-06
sp|P27165|CALM_PHYIN Calmodulin OS=Phytophthora infestans GN=CMD1 PE=3 SV=2 37 195 5.0E-06
sp|P41041|CALM_PNECA Calmodulin OS=Pneumocystis carinii PE=3 SV=1 30 195 5.0E-06
sp|P41210|CATR_ATRNU Caltractin OS=Atriplex nummularia PE=2 SV=1 94 190 6.0E-06
sp|P02587|TNNC2_PIG Troponin C, skeletal muscle OS=Sus scrofa GN=TNNC2 PE=1 SV=2 92 195 6.0E-06
sp|O96102|CALM_PHYPO Calmodulin OS=Physarum polycephalum PE=2 SV=3 39 195 6.0E-06
sp|O82659|CML20_ARATH Probable calcium-binding protein CML20 OS=Arabidopsis thaliana GN=CML20 PE=1 SV=1 94 200 6.0E-06
sp|O88673|DGKA_MOUSE Diacylglycerol kinase alpha OS=Mus musculus GN=Dgka PE=1 SV=2 34 195 6.0E-06
sp|A5A7I7|CDPK4_SOLTU Calcium-dependent protein kinase 4 OS=Solanum tuberosum GN=CPK4 PE=2 SV=1 53 195 6.0E-06
sp|P11121|CALM_PYUSP Calmodulin OS=Pyuridae sp. PE=1 SV=2 37 195 6.0E-06
sp|P05933|CALM_SCHPO Calmodulin OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cam1 PE=1 SV=1 33 195 7.0E-06
sp|P02585|TNNC2_HUMAN Troponin C, skeletal muscle OS=Homo sapiens GN=TNNC2 PE=1 SV=2 92 195 7.0E-06
sp|P53440|CALMF_NAEGR Calmodulin, flagellar OS=Naegleria gruberi GN=CAM1 PE=2 SV=1 34 151 8.0E-06
sp|Q9U6D3|CALM_MYXGL Calmodulin OS=Myxine glutinosa PE=2 SV=3 37 195 8.0E-06
sp|Q16HE8|NKD_AEDAE Protein naked cuticle homolog OS=Aedes aegypti GN=nkd PE=3 SV=1 110 165 8.0E-06
sp|Q11083|YT67_CAEEL Uncharacterized calcium-binding protein B0563.7 OS=Caenorhabditis elegans GN=B0563.7 PE=3 SV=1 94 196 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0005509 calcium ion binding Yes
GO:0046872 metal ion binding No
GO:0003674 molecular_function No
GO:0005488 binding No
GO:0043167 ion binding No
GO:0043169 cation binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|5953
MALNAAATTSLLRLGDQDCLLLTSPRRVGRQSKLSHEQLTELQKATHFDKKELQQWYKGFLKDCPSGMLTKEEFQ
KIYRQFFPFGDPSSFADYVFNVFDSDKSGTIDFKEFICALSVTSRGKMEDKLDWAFQLYDIDGDGKISYDEMLQI
VEAIYKMVGSMVKLPEDEDTPEKRVRKIFRMMDKDENGSLDMDEFKEGSKRDETIVSALSLYDGLV*
Coding >OphauB2|5953
ATGGCTCTCAATGCAGCTGCGACGACGTCATTGCTGCGGCTTGGGGACCAGGATTGTCTCTTGCTGACGTCGCCT
CGTCGTGTCGGCAGACAGTCCAAGCTCTCTCACGAGCAGCTGACCGAACTCCAAAAAGCCACGCATTTCGACAAG
AAGGAGCTGCAACAATGGTACAAGGGCTTCCTCAAGGACTGCCCCTCGGGCATGCTCACCAAGGAGGAGTTTCAA
AAAATATACCGCCAGTTCTTCCCCTTTGGCGACCCAAGCTCCTTTGCCGACTACGTCTTCAATGTCTTTGACAGC
GACAAGTCGGGCACCATTGACTTTAAAGAGTTTATCTGCGCCCTCAGCGTTACGAGCCGCGGCAAGATGGAAGAC
AAGCTCGACTGGGCCTTTCAGCTCTACGACATTGACGGCGATGGCAAGATAAGCTATGACGAGATGCTGCAGATT
GTCGAGGCCATTTACAAAATGGTGGGCTCCATGGTCAAGCTGCCAGAGGACGAGGACACGCCCGAGAAGCGGGTA
CGCAAAATCTTTCGCATGATGGACAAGGACGAGAATGGGTCTTTGGACATGGATGAGTTTAAAGAGGGGAGCAAA
CGCGACGAGACAATTGTCTCGGCCCTGTCTTTGTACGACGGACTTGTGTAG
Transcript >OphauB2|5953
ATGGCTCTCAATGCAGCTGCGACGACGTCATTGCTGCGGCTTGGGGACCAGGATTGTCTCTTGCTGACGTCGCCT
CGTCGTGTCGGCAGACAGTCCAAGCTCTCTCACGAGCAGCTGACCGAACTCCAAAAAGCCACGCATTTCGACAAG
AAGGAGCTGCAACAATGGTACAAGGGCTTCCTCAAGGACTGCCCCTCGGGCATGCTCACCAAGGAGGAGTTTCAA
AAAATATACCGCCAGTTCTTCCCCTTTGGCGACCCAAGCTCCTTTGCCGACTACGTCTTCAATGTCTTTGACAGC
GACAAGTCGGGCACCATTGACTTTAAAGAGTTTATCTGCGCCCTCAGCGTTACGAGCCGCGGCAAGATGGAAGAC
AAGCTCGACTGGGCCTTTCAGCTCTACGACATTGACGGCGATGGCAAGATAAGCTATGACGAGATGCTGCAGATT
GTCGAGGCCATTTACAAAATGGTGGGCTCCATGGTCAAGCTGCCAGAGGACGAGGACACGCCCGAGAAGCGGGTA
CGCAAAATCTTTCGCATGATGGACAAGGACGAGAATGGGTCTTTGGACATGGATGAGTTTAAAGAGGGGAGCAAA
CGCGACGAGACAATTGTCTCGGCCCTGTCTTTGTACGACGGACTTGTGTAG
Gene >OphauB2|5953
ATGGCTCTCAATGCAGCTGCGACGACGTCATTGCTGCGGCTTGGGGACCAGGATTGTCTCTTGCTGACGTCGCCT
CGTCGTGTCGGCAGACAGTCCAAGCTCTCTCACGAGCAGCTGACCGAACTCCAAAAAGCCACGCATTTCGACAAG
AAGGAGCTGCAACAATGGTACAAGGGTGAGTTGGCTCTCGTTGATGCATTATTTATTAGAGGCAGACTCTCTCCG
CCATGGACAGGACCAAAAAAAAAAAAAAAGGCCACGACTGTTGACCGCCATGCACACAGGCTTCCTCAAGGACTG
CCCCTCGGGCATGCTCACCAAGGAGGAGTTTCAAAAAATATACCGCCAGTTCTTCCCCTTTGGCGACCCAAGCTC
CTTTGCCGACTACGTCTTCAATGTCTTTGACAGCGACAAGTCGGGCACCATTGACTTTAAAGAGTTTATCTGCGC
CCTCAGCGTTACGAGCCGCGGCAAGATGGAAGACAAGCTCGACTGGGCCTTTCAGCTCTACGACATTGACGGCGA
TGGCAAGATAAGCTATGACGAGATGCTGCAGATTGTCGAGGCCATTTACAAAATGGTAGCCCCCGCCTGGTGTGT
TGCCCGTCTCGAGGCAGCGCGGAAAAGCTGACGCTTGTACAGGTGGGCTCCATGGTCAAGCTGCCAGAGGACGAG
GACACGCCCGAGAAGCGGGTACGCAAAATCTTTCGCATGATGGACAAGGACGAGAATGGGTCTTTGGACATGGAT
GAGTTTAAAGAGGGGAGCAAACGCGACGAGACAATTGTCTCGGCCCTGTCTTTGTACGACGGACTTGTGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail