Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|5951
Gene name
LocationContig_5:259339..261864
Strand+
Gene length (bp)2525
Transcript length (bp)2343
Coding sequence length (bp)2343
Protein length (aa) 781

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00330 Aconitase Aconitase family (aconitate hydratase) 6.8E-157 13 472
PF00694 Aconitase_C Aconitase C-terminal domain 1.6E-40 543 665

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P55251|LEUC_RHIPU 3-isopropylmalate dehydratase OS=Rhizomucor pusillus GN=LEUA PE=3 SV=1 9 780 0.0E+00
sp|P55811|LEUC_RHINI 3-isopropylmalate dehydratase OS=Rhizopus niveus GN=LEU1 PE=3 SV=1 8 780 0.0E+00
sp|P18250|LEUC_PHYB8 3-isopropylmalate dehydratase OS=Phycomyces blakesleeanus (strain ATCC 8743b / FGSC 10004 / NBRC 33097 / NRRL 1555) GN=leu1 PE=3 SV=2 8 748 0.0E+00
sp|P49601|LEUC_USTMA 3-isopropylmalate dehydratase OS=Ustilago maydis (strain 521 / FGSC 9021) GN=LEU1 PE=3 SV=1 9 748 0.0E+00
sp|O14289|LEUC_SCHPO 3-isopropylmalate dehydratase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=leu2 PE=1 SV=1 1 744 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P55251|LEUC_RHIPU 3-isopropylmalate dehydratase OS=Rhizomucor pusillus GN=LEUA PE=3 SV=1 9 780 0.0E+00
sp|P55811|LEUC_RHINI 3-isopropylmalate dehydratase OS=Rhizopus niveus GN=LEU1 PE=3 SV=1 8 780 0.0E+00
sp|P18250|LEUC_PHYB8 3-isopropylmalate dehydratase OS=Phycomyces blakesleeanus (strain ATCC 8743b / FGSC 10004 / NBRC 33097 / NRRL 1555) GN=leu1 PE=3 SV=2 8 748 0.0E+00
sp|P49601|LEUC_USTMA 3-isopropylmalate dehydratase OS=Ustilago maydis (strain 521 / FGSC 9021) GN=LEU1 PE=3 SV=1 9 748 0.0E+00
sp|O14289|LEUC_SCHPO 3-isopropylmalate dehydratase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=leu2 PE=1 SV=1 1 744 0.0E+00
sp|P07264|LEUC_YEAST 3-isopropylmalate dehydratase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=LEU1 PE=1 SV=3 9 751 0.0E+00
sp|Q74ZM9|LEUC_ASHGO 3-isopropylmalate dehydratase OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=LEU1 PE=3 SV=2 8 749 0.0E+00
sp|Q00464|LEUC_CANMA 3-isopropylmalate dehydratase OS=Candida maltosa GN=LEU1 PE=3 SV=1 9 757 0.0E+00
sp|P17279|LEUC_MUCCL 3-isopropylmalate dehydratase OS=Mucor circinelloides f. lusitanicus GN=LEUA PE=3 SV=1 7 602 0.0E+00
sp|B8GQD6|LEUC_THISH 3-isopropylmalate dehydratase large subunit OS=Thioalkalivibrio sulfidiphilus (strain HL-EbGR7) GN=leuC PE=3 SV=1 7 481 0.0E+00
sp|Q2RV55|LEUC_RHORT 3-isopropylmalate dehydratase large subunit OS=Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1) GN=leuC PE=3 SV=1 6 481 0.0E+00
sp|Q4FP15|LEUC_PELUB 3-isopropylmalate dehydratase large subunit OS=Pelagibacter ubique (strain HTCC1062) GN=leuC PE=3 SV=1 10 482 0.0E+00
sp|A5G0G6|LEUC_ACICJ 3-isopropylmalate dehydratase large subunit OS=Acidiphilium cryptum (strain JF-5) GN=leuC PE=3 SV=1 8 481 0.0E+00
sp|A4G4F5|LEUC_HERAR 3-isopropylmalate dehydratase large subunit OS=Herminiimonas arsenicoxydans GN=leuC PE=3 SV=1 8 480 0.0E+00
sp|Q1H0L4|LEUC_METFK 3-isopropylmalate dehydratase large subunit OS=Methylobacillus flagellatus (strain KT / ATCC 51484 / DSM 6875) GN=leuC PE=3 SV=1 7 480 0.0E+00
sp|A6T015|LEUC_JANMA 3-isopropylmalate dehydratase large subunit OS=Janthinobacterium sp. (strain Marseille) GN=leuC PE=3 SV=1 8 480 0.0E+00
sp|Q0BRH4|LEUC_GRABC 3-isopropylmalate dehydratase large subunit OS=Granulibacter bethesdensis (strain ATCC BAA-1260 / CGDNIH1) GN=leuC PE=3 SV=1 9 480 0.0E+00
sp|A7HT10|LEUC_PARL1 3-isopropylmalate dehydratase large subunit OS=Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966) GN=leuC PE=3 SV=1 9 482 0.0E+00
sp|Q2G958|LEUC_NOVAD 3-isopropylmalate dehydratase large subunit OS=Novosphingobium aromaticivorans (strain DSM 12444 / F199) GN=leuC PE=3 SV=1 9 480 0.0E+00
sp|Q07UU3|LEUC_RHOP5 3-isopropylmalate dehydratase large subunit OS=Rhodopseudomonas palustris (strain BisA53) GN=leuC PE=3 SV=1 10 479 0.0E+00
sp|B3Q851|LEUC_RHOPT 3-isopropylmalate dehydratase large subunit OS=Rhodopseudomonas palustris (strain TIE-1) GN=leuC PE=3 SV=1 10 478 0.0E+00
sp|Q13DU7|LEUC_RHOPS 3-isopropylmalate dehydratase large subunit OS=Rhodopseudomonas palustris (strain BisB5) GN=leuC PE=3 SV=1 10 479 0.0E+00
sp|Q6ND69|LEUC_RHOPA 3-isopropylmalate dehydratase large subunit OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=leuC PE=3 SV=1 10 478 0.0E+00
sp|Q0VPI0|LEUC_ALCBS 3-isopropylmalate dehydratase large subunit OS=Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2) GN=leuC PE=3 SV=2 9 480 0.0E+00
sp|Q3SHL1|LEUC_THIDA 3-isopropylmalate dehydratase large subunit OS=Thiobacillus denitrificans (strain ATCC 25259) GN=leuC PE=3 SV=1 9 480 0.0E+00
sp|Q2VZV4|LEUC_MAGSA 3-isopropylmalate dehydratase large subunit OS=Magnetospirillum magneticum (strain AMB-1 / ATCC 700264) GN=leuC PE=3 SV=1 9 480 0.0E+00
sp|Q2K376|LEUC_RHIEC 3-isopropylmalate dehydratase large subunit OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=leuC PE=3 SV=1 9 479 0.0E+00
sp|B3PR22|LEUC_RHIE6 3-isopropylmalate dehydratase large subunit OS=Rhizobium etli (strain CIAT 652) GN=leuC PE=3 SV=1 9 479 0.0E+00
sp|C3M9V0|LEUC_RHISN 3-isopropylmalate dehydratase large subunit OS=Rhizobium sp. (strain NGR234) GN=leuC PE=3 SV=1 9 479 0.0E+00
sp|B6JAQ9|LEUC_OLICO 3-isopropylmalate dehydratase large subunit OS=Oligotropha carboxidovorans (strain ATCC 49405 / DSM 1227 / OM5) GN=leuC PE=3 SV=1 10 478 0.0E+00
sp|B9KMK4|LEUC_RHOSK 3-isopropylmalate dehydratase large subunit OS=Rhodobacter sphaeroides (strain KD131 / KCTC 12085) GN=leuC PE=3 SV=1 9 487 0.0E+00
sp|P58949|LEUC_XANCP 3-isopropylmalate dehydratase large subunit OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=leuC PE=3 SV=1 7 480 0.0E+00
sp|Q4UYG5|LEUC_XANC8 3-isopropylmalate dehydratase large subunit OS=Xanthomonas campestris pv. campestris (strain 8004) GN=leuC PE=3 SV=1 7 480 0.0E+00
sp|Q3SNV3|LEUC_NITWN 3-isopropylmalate dehydratase large subunit OS=Nitrobacter winogradskyi (strain Nb-255 / ATCC 25391) GN=leuC PE=3 SV=1 10 479 0.0E+00
sp|Q2J3A1|LEUC_RHOP2 3-isopropylmalate dehydratase large subunit OS=Rhodopseudomonas palustris (strain HaA2) GN=leuC PE=3 SV=1 10 478 0.0E+00
sp|Q884C2|LEUC_PSESM 3-isopropylmalate dehydratase large subunit OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=leuC PE=3 SV=1 9 480 0.0E+00
sp|Q21CT4|LEUC_RHOPB 3-isopropylmalate dehydratase large subunit OS=Rhodopseudomonas palustris (strain BisB18) GN=leuC PE=3 SV=1 10 478 0.0E+00
sp|A4WNV5|LEUC_RHOS5 3-isopropylmalate dehydratase large subunit OS=Rhodobacter sphaeroides (strain ATCC 17025 / ATH 2.4.3) GN=leuC PE=3 SV=1 9 480 0.0E+00
sp|Q3IZI8|LEUC_RHOS4 3-isopropylmalate dehydratase large subunit OS=Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158) GN=leuC PE=3 SV=1 9 487 0.0E+00
sp|Q89X34|LEUC2_BRADU 3-isopropylmalate dehydratase large subunit 2 OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=leuC2 PE=3 SV=1 10 479 0.0E+00
sp|A3PMQ9|LEUC_RHOS1 3-isopropylmalate dehydratase large subunit OS=Rhodobacter sphaeroides (strain ATCC 17029 / ATH 2.4.9) GN=leuC PE=3 SV=1 9 487 0.0E+00
sp|Q5FUG3|LEUC_GLUOX 3-isopropylmalate dehydratase large subunit OS=Gluconobacter oxydans (strain 621H) GN=leuC PE=3 SV=1 9 480 0.0E+00
sp|Q7NUB6|LEUC_CHRVO 3-isopropylmalate dehydratase large subunit OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=leuC PE=3 SV=1 7 481 0.0E+00
sp|Q11CQ6|LEUC_CHESB 3-isopropylmalate dehydratase large subunit OS=Chelativorans sp. (strain BNC1) GN=leuC PE=3 SV=1 9 479 0.0E+00
sp|Q92L76|LEUC_RHIME 3-isopropylmalate dehydratase large subunit OS=Rhizobium meliloti (strain 1021) GN=leuC PE=3 SV=1 9 479 0.0E+00
sp|B8EN95|LEUC_METSB 3-isopropylmalate dehydratase large subunit OS=Methylocella silvestris (strain BL2 / DSM 15510 / NCIMB 13906) GN=leuC PE=3 SV=1 9 478 0.0E+00
sp|A1B513|LEUC_PARDP 3-isopropylmalate dehydratase large subunit OS=Paracoccus denitrificans (strain Pd 1222) GN=leuC PE=3 SV=1 6 480 0.0E+00
sp|A8LKJ1|LEUC_DINSH 3-isopropylmalate dehydratase large subunit OS=Dinoroseobacter shibae (strain DSM 16493 / NCIMB 14021 / DFL 12) GN=leuC PE=3 SV=1 7 480 0.0E+00
sp|A0AZ60|LEUC_BURCH 3-isopropylmalate dehydratase large subunit OS=Burkholderia cenocepacia (strain HI2424) GN=leuC PE=3 SV=1 8 480 0.0E+00
sp|B1K377|LEUC_BURCC 3-isopropylmalate dehydratase large subunit OS=Burkholderia cenocepacia (strain MC0-3) GN=leuC PE=3 SV=1 8 480 0.0E+00
sp|Q1BM55|LEUC_BURCA 3-isopropylmalate dehydratase large subunit OS=Burkholderia cenocepacia (strain AU 1054) GN=leuC PE=3 SV=1 8 480 0.0E+00
sp|Q393X2|LEUC_BURL3 3-isopropylmalate dehydratase large subunit OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=leuC PE=3 SV=1 8 480 0.0E+00
sp|A6UE05|LEUC_SINMW 3-isopropylmalate dehydratase large subunit OS=Sinorhizobium medicae (strain WSM419) GN=leuC PE=3 SV=1 9 479 0.0E+00
sp|Q1QHI4|LEUC_NITHX 3-isopropylmalate dehydratase large subunit OS=Nitrobacter hamburgensis (strain X14 / DSM 10229) GN=leuC PE=3 SV=1 10 479 0.0E+00
sp|Q48K99|LEUC_PSE14 3-isopropylmalate dehydratase large subunit OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=leuC PE=3 SV=1 9 480 0.0E+00
sp|B1ZKX6|LEUC_METPB 3-isopropylmalate dehydratase large subunit OS=Methylobacterium populi (strain ATCC BAA-705 / NCIMB 13946 / BJ001) GN=leuC PE=3 SV=1 9 479 0.0E+00
sp|Q46YV7|LEUC_CUPPJ 3-isopropylmalate dehydratase large subunit OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=leuC PE=3 SV=1 8 480 0.0E+00
sp|Q1ICW0|LEUC_PSEE4 3-isopropylmalate dehydratase large subunit OS=Pseudomonas entomophila (strain L48) GN=leuC PE=3 SV=1 9 480 0.0E+00
sp|Q0BAC8|LEUC_BURCM 3-isopropylmalate dehydratase large subunit OS=Burkholderia ambifaria (strain ATCC BAA-244 / AMMD) GN=leuC PE=3 SV=1 8 480 0.0E+00
sp|B1Z1N0|LEUC_BURA4 3-isopropylmalate dehydratase large subunit OS=Burkholderia ambifaria (strain MC40-6) GN=leuC PE=3 SV=1 8 480 0.0E+00
sp|Q8UBY9|LEUC_AGRFC 3-isopropylmalate dehydratase large subunit OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=leuC PE=3 SV=2 9 479 0.0E+00
sp|Q5H4D1|LEUC_XANOR 3-isopropylmalate dehydratase large subunit OS=Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85) GN=leuC PE=3 SV=1 7 484 0.0E+00
sp|B2SNH4|LEUC_XANOP 3-isopropylmalate dehydratase large subunit OS=Xanthomonas oryzae pv. oryzae (strain PXO99A) GN=leuC PE=3 SV=1 7 484 0.0E+00
sp|Q2P765|LEUC_XANOM 3-isopropylmalate dehydratase large subunit OS=Xanthomonas oryzae pv. oryzae (strain MAFF 311018) GN=leuC PE=3 SV=1 7 484 0.0E+00
sp|Q2SJD8|LEUC_HAHCH 3-isopropylmalate dehydratase large subunit OS=Hahella chejuensis (strain KCTC 2396) GN=leuC PE=3 SV=1 9 480 0.0E+00
sp|A1K4A1|LEUC_AZOSB 3-isopropylmalate dehydratase large subunit OS=Azoarcus sp. (strain BH72) GN=leuC PE=3 SV=1 7 480 0.0E+00
sp|B2JQE1|LEUC_BURP8 3-isopropylmalate dehydratase large subunit OS=Burkholderia phymatum (strain DSM 17167 / STM815) GN=leuC PE=3 SV=1 8 480 0.0E+00
sp|A4JMB6|LEUC_BURVG 3-isopropylmalate dehydratase large subunit OS=Burkholderia vietnamiensis (strain G4 / LMG 22486) GN=leuC PE=3 SV=1 8 480 0.0E+00
sp|Q4ZUZ6|LEUC_PSEU2 3-isopropylmalate dehydratase large subunit OS=Pseudomonas syringae pv. syringae (strain B728a) GN=leuC PE=3 SV=1 9 483 0.0E+00
sp|B9JCN5|LEUC_AGRRK 3-isopropylmalate dehydratase large subunit OS=Agrobacterium radiobacter (strain K84 / ATCC BAA-868) GN=leuC PE=3 SV=1 9 479 0.0E+00
sp|Q6FEW0|LEUC_ACIAD 3-isopropylmalate dehydratase large subunit OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=leuC PE=3 SV=1 1 480 0.0E+00
sp|Q3BPJ6|LEUC_XANC5 3-isopropylmalate dehydratase large subunit OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) GN=leuC PE=3 SV=1 7 484 0.0E+00
sp|Q8FYG9|LEUC_BRUSU 3-isopropylmalate dehydratase large subunit OS=Brucella suis biovar 1 (strain 1330) GN=leuC PE=3 SV=1 9 478 0.0E+00
sp|B0CIF7|LEUC_BRUSI 3-isopropylmalate dehydratase large subunit OS=Brucella suis (strain ATCC 23445 / NCTC 10510) GN=leuC PE=3 SV=1 9 478 0.0E+00
sp|A5VSN3|LEUC_BRUO2 3-isopropylmalate dehydratase large subunit OS=Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512) GN=leuC PE=3 SV=1 9 478 0.0E+00
sp|A9M8P2|LEUC_BRUC2 3-isopropylmalate dehydratase large subunit OS=Brucella canis (strain ATCC 23365 / NCTC 10854) GN=leuC PE=3 SV=1 9 478 0.0E+00
sp|Q57AZ0|LEUC_BRUAB 3-isopropylmalate dehydratase large subunit OS=Brucella abortus biovar 1 (strain 9-941) GN=leuC PE=3 SV=1 9 478 0.0E+00
sp|Q2YLP7|LEUC_BRUA2 3-isopropylmalate dehydratase large subunit OS=Brucella abortus (strain 2308) GN=leuC PE=3 SV=1 9 478 0.0E+00
sp|B2S860|LEUC_BRUA1 3-isopropylmalate dehydratase large subunit OS=Brucella abortus (strain S19) GN=leuC PE=3 SV=1 9 478 0.0E+00
sp|B1LXK9|LEUC_METRJ 3-isopropylmalate dehydratase large subunit OS=Methylobacterium radiotolerans (strain ATCC 27329 / DSM 1819 / JCM 2831) GN=leuC PE=3 SV=1 9 479 0.0E+00
sp|Q8YJC9|LEUC_BRUME 3-isopropylmalate dehydratase large subunit OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=leuC PE=3 SV=1 9 478 0.0E+00
sp|C0RFF1|LEUC_BRUMB 3-isopropylmalate dehydratase large subunit OS=Brucella melitensis biotype 2 (strain ATCC 23457) GN=leuC PE=3 SV=1 9 478 0.0E+00
sp|B7KRK4|LEUC_METC4 3-isopropylmalate dehydratase large subunit OS=Methylobacterium extorquens (strain CM4 / NCIMB 13688) GN=leuC PE=3 SV=1 9 479 0.0E+00
sp|B9MDK8|LEUC_ACIET 3-isopropylmalate dehydratase large subunit OS=Acidovorax ebreus (strain TPSY) GN=leuC PE=3 SV=1 9 481 0.0E+00
sp|Q9JZI5|LEUC_NEIMB 3-isopropylmalate dehydratase large subunit OS=Neisseria meningitidis serogroup B (strain MC58) GN=leuC PE=3 SV=1 7 481 0.0E+00
sp|Q98EF1|LEUC_RHILO 3-isopropylmalate dehydratase large subunit OS=Rhizobium loti (strain MAFF303099) GN=leuC PE=3 SV=1 9 478 0.0E+00
sp|A6V2V3|LEUC_PSEA7 3-isopropylmalate dehydratase large subunit OS=Pseudomonas aeruginosa (strain PA7) GN=leuC PE=3 SV=1 9 480 0.0E+00
sp|Q28W60|LEUC_JANSC 3-isopropylmalate dehydratase large subunit OS=Jannaschia sp. (strain CCS1) GN=leuC PE=3 SV=1 7 480 0.0E+00
sp|B9JUD6|LEUC_AGRVS 3-isopropylmalate dehydratase large subunit OS=Agrobacterium vitis (strain S4 / ATCC BAA-846) GN=leuC PE=3 SV=1 9 479 0.0E+00
sp|B4RCC2|LEUC_PHEZH 3-isopropylmalate dehydratase large subunit OS=Phenylobacterium zucineum (strain HLK1) GN=leuC PE=3 SV=1 1 480 0.0E+00
sp|A1WAS7|LEUC_ACISJ 3-isopropylmalate dehydratase large subunit OS=Acidovorax sp. (strain JS42) GN=leuC PE=3 SV=1 9 481 0.0E+00
sp|C1DD59|LEUC_LARHH 3-isopropylmalate dehydratase large subunit OS=Laribacter hongkongensis (strain HLHK9) GN=leuC PE=3 SV=1 8 479 0.0E+00
sp|Q1MAJ9|LEUC_RHIL3 3-isopropylmalate dehydratase large subunit OS=Rhizobium leguminosarum bv. viciae (strain 3841) GN=leuC PE=3 SV=1 9 479 0.0E+00
sp|B4RM67|LEUC_NEIG2 3-isopropylmalate dehydratase large subunit OS=Neisseria gonorrhoeae (strain NCCP11945) GN=leuC PE=3 SV=1 7 481 0.0E+00
sp|Q8XXX3|LEUC_RALSO 3-isopropylmalate dehydratase large subunit OS=Ralstonia solanacearum (strain GMI1000) GN=leuC PE=3 SV=1 8 480 0.0E+00
sp|A4XVW2|LEUC_PSEMY 3-isopropylmalate dehydratase large subunit OS=Pseudomonas mendocina (strain ymp) GN=leuC PE=3 SV=1 9 480 0.0E+00
sp|B5ZTI5|LEUC_RHILW 3-isopropylmalate dehydratase large subunit OS=Rhizobium leguminosarum bv. trifolii (strain WSM2304) GN=leuC PE=3 SV=1 9 479 0.0E+00
sp|Q2T7H8|LEUC_BURTA 3-isopropylmalate dehydratase large subunit OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=leuC PE=3 SV=1 8 480 0.0E+00
sp|Q606F2|LEUC_METCA 3-isopropylmalate dehydratase large subunit OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) GN=leuC PE=3 SV=1 7 477 0.0E+00
sp|A6WXG4|LEUC_OCHA4 3-isopropylmalate dehydratase large subunit OS=Ochrobactrum anthropi (strain ATCC 49188 / DSM 6882 / NCTC 12168) GN=leuC PE=3 SV=1 9 479 0.0E+00
sp|A9LZF7|LEUC_NEIM0 3-isopropylmalate dehydratase large subunit OS=Neisseria meningitidis serogroup C (strain 053442) GN=leuC PE=3 SV=1 7 481 0.0E+00
sp|A1TLH6|LEUC_ACIAC 3-isopropylmalate dehydratase large subunit OS=Acidovorax citrulli (strain AAC00-1) GN=leuC PE=3 SV=1 9 481 0.0E+00
sp|A1KU80|LEUC_NEIMF 3-isopropylmalate dehydratase large subunit OS=Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18) GN=leuC PE=3 SV=1 7 481 0.0E+00
sp|Q9JU82|LEUC_NEIMA 3-isopropylmalate dehydratase large subunit OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=leuC PE=3 SV=1 7 481 0.0E+00
sp|Q9HZA3|LEUC_PSEAE 3-isopropylmalate dehydratase large subunit OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=leuC PE=3 SV=1 9 480 0.0E+00
sp|Q02PT4|LEUC_PSEAB 3-isopropylmalate dehydratase large subunit OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=leuC PE=3 SV=1 9 480 0.0E+00
sp|B7VBP9|LEUC_PSEA8 3-isopropylmalate dehydratase large subunit OS=Pseudomonas aeruginosa (strain LESB58) GN=leuC PE=3 SV=1 9 480 0.0E+00
sp|B0KF81|LEUC_PSEPG 3-isopropylmalate dehydratase large subunit OS=Pseudomonas putida (strain GB-1) GN=leuC PE=3 SV=1 9 480 0.0E+00
sp|Q9ABN0|LEUC_CAUCR 3-isopropylmalate dehydratase large subunit OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=leuC PE=3 SV=1 7 480 0.0E+00
sp|B8GY66|LEUC_CAUCN 3-isopropylmalate dehydratase large subunit OS=Caulobacter crescentus (strain NA1000 / CB15N) GN=leuC PE=3 SV=1 7 480 0.0E+00
sp|Q88LE8|LEUC_PSEPK 3-isopropylmalate dehydratase large subunit OS=Pseudomonas putida (strain KT2440) GN=leuC PE=3 SV=1 9 480 0.0E+00
sp|Q3J716|LEUC_NITOC 3-isopropylmalate dehydratase large subunit OS=Nitrosococcus oceani (strain ATCC 19707 / NCIMB 11848) GN=leuC PE=3 SV=1 9 480 0.0E+00
sp|Q63JK9|LEUC_BURPS 3-isopropylmalate dehydratase large subunit OS=Burkholderia pseudomallei (strain K96243) GN=leuC PE=3 SV=1 8 480 0.0E+00
sp|A3NM77|LEUC_BURP6 3-isopropylmalate dehydratase large subunit OS=Burkholderia pseudomallei (strain 668) GN=leuC PE=3 SV=1 8 480 0.0E+00
sp|Q3JKG6|LEUC_BURP1 3-isopropylmalate dehydratase large subunit OS=Burkholderia pseudomallei (strain 1710b) GN=leuC PE=3 SV=2 8 480 0.0E+00
sp|A3P7N9|LEUC_BURP0 3-isopropylmalate dehydratase large subunit OS=Burkholderia pseudomallei (strain 1106a) GN=leuC PE=3 SV=1 8 480 0.0E+00
sp|A1UZ32|LEUC_BURMS 3-isopropylmalate dehydratase large subunit OS=Burkholderia mallei (strain SAVP1) GN=leuC PE=3 SV=1 8 480 0.0E+00
sp|Q62AI6|LEUC_BURMA 3-isopropylmalate dehydratase large subunit OS=Burkholderia mallei (strain ATCC 23344) GN=leuC PE=3 SV=1 8 480 0.0E+00
sp|A2S127|LEUC_BURM9 3-isopropylmalate dehydratase large subunit OS=Burkholderia mallei (strain NCTC 10229) GN=leuC PE=3 SV=1 8 480 0.0E+00
sp|A3MBT5|LEUC_BURM7 3-isopropylmalate dehydratase large subunit OS=Burkholderia mallei (strain NCTC 10247) GN=leuC PE=3 SV=1 8 480 0.0E+00
sp|Q5F8T1|LEUC_NEIG1 3-isopropylmalate dehydratase large subunit OS=Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) GN=leuC PE=3 SV=1 7 481 0.0E+00
sp|Q31HI2|LEUC_THICR 3-isopropylmalate dehydratase large subunit OS=Thiomicrospira crunogena (strain XCL-2) GN=leuC PE=3 SV=1 7 480 0.0E+00
sp|Q0A9B0|LEUC_ALKEH 3-isopropylmalate dehydratase large subunit OS=Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1) GN=leuC PE=3 SV=1 7 478 0.0E+00
sp|Q1GDM6|LEUC_RUEST 3-isopropylmalate dehydratase large subunit OS=Ruegeria sp. (strain TM1040) GN=leuC PE=3 SV=1 9 480 0.0E+00
sp|Q4KF08|LEUC_PSEF5 3-isopropylmalate dehydratase large subunit OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=leuC PE=3 SV=1 9 480 0.0E+00
sp|Q67MJ2|LEUC_SYMTH 3-isopropylmalate dehydratase large subunit OS=Symbiobacterium thermophilum (strain T / IAM 14863) GN=leuC PE=3 SV=1 7 486 0.0E+00
sp|P58948|LEUC_XANAC 3-isopropylmalate dehydratase large subunit OS=Xanthomonas axonopodis pv. citri (strain 306) GN=leuC PE=3 SV=1 7 480 0.0E+00
sp|C1F700|LEUC_ACIC5 3-isopropylmalate dehydratase large subunit OS=Acidobacterium capsulatum (strain ATCC 51196 / DSM 11244 / JCM 7670 / NBRC 15755 / NCIMB 13165 / 161) GN=leuC PE=3 SV=1 8 478 0.0E+00
sp|Q1GR84|LEUC_SPHAL 3-isopropylmalate dehydratase large subunit OS=Sphingopyxis alaskensis (strain DSM 13593 / LMG 18877 / RB2256) GN=leuC PE=3 SV=1 9 480 0.0E+00
sp|Q16CH7|LEUC_ROSDO 3-isopropylmalate dehydratase large subunit OS=Roseobacter denitrificans (strain ATCC 33942 / OCh 114) GN=leuC PE=3 SV=1 9 480 0.0E+00
sp|B2I359|LEUC_ACIBC 3-isopropylmalate dehydratase large subunit OS=Acinetobacter baumannii (strain ACICU) GN=leuC PE=3 SV=1 9 480 0.0E+00
sp|Q5LX06|LEUC_RUEPO 3-isopropylmalate dehydratase large subunit OS=Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) GN=leuC PE=3 SV=1 9 480 0.0E+00
sp|B7H0T7|LEUC_ACIB3 3-isopropylmalate dehydratase large subunit OS=Acinetobacter baumannii (strain AB307-0294) GN=leuC PE=3 SV=1 9 480 0.0E+00
sp|A4SWW8|LEUC_POLSQ 3-isopropylmalate dehydratase large subunit OS=Polynucleobacter necessarius subsp. asymbioticus (strain DSM 18221 / CIP 109841 / QLW-P1DMWA-1) GN=leuC PE=3 SV=1 8 481 0.0E+00
sp|A4VKE7|LEUC_PSEU5 3-isopropylmalate dehydratase large subunit OS=Pseudomonas stutzeri (strain A1501) GN=leuC PE=3 SV=1 9 480 0.0E+00
sp|B7I4E1|LEUC_ACIB5 3-isopropylmalate dehydratase large subunit OS=Acinetobacter baumannii (strain AB0057) GN=leuC PE=3 SV=1 9 480 0.0E+00
sp|B0U3M6|LEUC_XYLFM 3-isopropylmalate dehydratase large subunit OS=Xylella fastidiosa (strain M12) GN=leuC PE=3 SV=1 9 480 0.0E+00
sp|Q9PAX0|LEUC_XYLFA 3-isopropylmalate dehydratase large subunit OS=Xylella fastidiosa (strain 9a5c) GN=leuC PE=3 SV=1 9 480 0.0E+00
sp|B1J530|LEUC_PSEPW 3-isopropylmalate dehydratase large subunit OS=Pseudomonas putida (strain W619) GN=leuC PE=3 SV=1 9 480 0.0E+00
sp|B5ENJ1|LEUC_ACIF5 3-isopropylmalate dehydratase large subunit OS=Acidithiobacillus ferrooxidans (strain ATCC 53993) GN=leuC PE=3 SV=1 7 478 0.0E+00
sp|B7J5E0|LEUC_ACIF2 3-isopropylmalate dehydratase large subunit OS=Acidithiobacillus ferrooxidans (strain ATCC 23270 / DSM 14882 / CIP 104768 / NCIMB 8455) GN=leuC PE=3 SV=1 7 478 0.0E+00
sp|A3M1S8|LEUC_ACIBT 3-isopropylmalate dehydratase large subunit OS=Acinetobacter baumannii (strain ATCC 17978 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377) GN=leuC PE=3 SV=2 9 480 0.0E+00
sp|Q87BP9|LEUC_XYLFT 3-isopropylmalate dehydratase large subunit OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=leuC PE=3 SV=1 9 480 0.0E+00
sp|B2I6I6|LEUC_XYLF2 3-isopropylmalate dehydratase large subunit OS=Xylella fastidiosa (strain M23) GN=leuC PE=3 SV=1 9 480 0.0E+00
sp|Q5P1J8|LEUC_AROAE 3-isopropylmalate dehydratase large subunit OS=Aromatoleum aromaticum (strain EbN1) GN=leuC PE=3 SV=1 7 481 0.0E+00
sp|Q82WI9|LEUC_NITEU 3-isopropylmalate dehydratase large subunit OS=Nitrosomonas europaea (strain ATCC 19718 / NBRC 14298) GN=leuC PE=3 SV=1 9 480 0.0E+00
sp|A0L8J4|LEUC_MAGMM 3-isopropylmalate dehydratase large subunit OS=Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1) GN=leuC PE=3 SV=1 7 479 0.0E+00
sp|Q21IY3|LEUC_SACD2 3-isopropylmalate dehydratase large subunit OS=Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024) GN=leuC PE=3 SV=1 9 480 0.0E+00
sp|Q5NRC5|LEUC_ZYMMO 3-isopropylmalate dehydratase large subunit OS=Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4) GN=leuC PE=3 SV=1 7 480 0.0E+00
sp|B1XV55|LEUC_POLNS 3-isopropylmalate dehydratase large subunit OS=Polynucleobacter necessarius subsp. necessarius (strain STIR1) GN=leuC PE=3 SV=1 8 481 0.0E+00
sp|Q7W931|LEUC_BORPA 3-isopropylmalate dehydratase large subunit OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=leuC PE=3 SV=2 8 480 0.0E+00
sp|Q7WKH6|LEUC_BORBR 3-isopropylmalate dehydratase large subunit OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=leuC PE=3 SV=2 8 480 0.0E+00
sp|C5CSH5|LEUC_VARPS 3-isopropylmalate dehydratase large subunit OS=Variovorax paradoxus (strain S110) GN=leuC PE=3 SV=1 8 481 0.0E+00
sp|Q7VY75|LEUC_BORPE 3-isopropylmalate dehydratase large subunit OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=leuC PE=3 SV=1 8 480 0.0E+00
sp|Q126M9|LEUC_POLSJ 3-isopropylmalate dehydratase large subunit OS=Polaromonas sp. (strain JS666 / ATCC BAA-500) GN=leuC PE=3 SV=1 9 480 0.0E+00
sp|A1VRR0|LEUC_POLNA 3-isopropylmalate dehydratase large subunit OS=Polaromonas naphthalenivorans (strain CJ2) GN=leuC PE=3 SV=1 9 480 0.0E+00
sp|Q1IMI3|LEUC_KORVE 3-isopropylmalate dehydratase large subunit OS=Koribacter versatilis (strain Ellin345) GN=leuC PE=3 SV=1 9 479 0.0E+00
sp|A1JJH5|LEUC_YERE8 3-isopropylmalate dehydratase large subunit OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=leuC PE=3 SV=1 9 481 0.0E+00
sp|P44968|LEUC_HAEIN 3-isopropylmalate dehydratase large subunit OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=leuC PE=3 SV=2 8 478 0.0E+00
sp|A1WY14|LEUC_HALHL 3-isopropylmalate dehydratase large subunit OS=Halorhodospira halophila (strain DSM 244 / SL1) GN=leuC PE=3 SV=1 7 479 0.0E+00
sp|A1U0Y0|LEUC_MARHV 3-isopropylmalate dehydratase large subunit OS=Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8) GN=leuC PE=3 SV=1 8 482 0.0E+00
sp|A5UD83|LEUC_HAEIE 3-isopropylmalate dehydratase large subunit OS=Haemophilus influenzae (strain PittEE) GN=leuC PE=3 SV=1 9 481 0.0E+00
sp|A4W6H7|LEUC_ENT38 3-isopropylmalate dehydratase large subunit OS=Enterobacter sp. (strain 638) GN=leuC PE=3 SV=1 8 480 0.0E+00
sp|Q66EM3|LEUC_YERPS 3-isopropylmalate dehydratase large subunit OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=leuC PE=3 SV=1 1 481 0.0E+00
sp|B2K4C7|LEUC_YERPB 3-isopropylmalate dehydratase large subunit OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=leuC PE=3 SV=1 1 481 0.0E+00
sp|Q4QLS2|LEUC_HAEI8 3-isopropylmalate dehydratase large subunit OS=Haemophilus influenzae (strain 86-028NP) GN=leuC PE=3 SV=1 8 481 0.0E+00
sp|B1JKA0|LEUC_YERPY 3-isopropylmalate dehydratase large subunit OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=leuC PE=3 SV=1 1 481 0.0E+00
sp|A4TQA4|LEUC_YERPP 3-isopropylmalate dehydratase large subunit OS=Yersinia pestis (strain Pestoides F) GN=leuC PE=3 SV=1 1 481 0.0E+00
sp|Q1CMP7|LEUC_YERPN 3-isopropylmalate dehydratase large subunit OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=leuC PE=3 SV=1 1 481 0.0E+00
sp|A9R144|LEUC_YERPG 3-isopropylmalate dehydratase large subunit OS=Yersinia pestis bv. Antiqua (strain Angola) GN=leuC PE=3 SV=1 1 481 0.0E+00
sp|Q8ZIH0|LEUC_YERPE 3-isopropylmalate dehydratase large subunit OS=Yersinia pestis GN=leuC PE=3 SV=1 1 481 0.0E+00
sp|Q1C1Z4|LEUC_YERPA 3-isopropylmalate dehydratase large subunit OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=leuC PE=3 SV=1 1 481 0.0E+00
sp|A7FM86|LEUC_YERP3 3-isopropylmalate dehydratase large subunit OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=leuC PE=3 SV=1 1 481 0.0E+00
sp|A7MIC7|LEUC_CROS8 3-isopropylmalate dehydratase large subunit OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=leuC PE=3 SV=1 8 480 0.0E+00
sp|Q1BAQ4|LEUC_MYCSS 3-isopropylmalate dehydratase large subunit OS=Mycobacterium sp. (strain MCS) GN=leuC PE=3 SV=1 9 487 0.0E+00
sp|A1UEA8|LEUC_MYCSK 3-isopropylmalate dehydratase large subunit OS=Mycobacterium sp. (strain KMS) GN=leuC PE=3 SV=1 9 487 0.0E+00
sp|A5WGT5|LEUC_PSYWF 3-isopropylmalate dehydratase large subunit OS=Psychrobacter sp. (strain PRwf-1) GN=leuC PE=3 SV=1 8 480 0.0E+00
sp|A8ALM7|LEUC_CITK8 3-isopropylmalate dehydratase large subunit OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=leuC PE=3 SV=1 8 480 0.0E+00
sp|A4FMP2|LEUC_SACEN 3-isopropylmalate dehydratase large subunit OS=Saccharopolyspora erythraea (strain ATCC 11635 / DSM 40517 / JCM 4748 / NBRC 13426 / NCIMB 8594 / NRRL 2338) GN=leuC PE=3 SV=1 9 480 0.0E+00
sp|A3PXR2|LEUC_MYCSJ 3-isopropylmalate dehydratase large subunit OS=Mycobacterium sp. (strain JLS) GN=leuC PE=3 SV=1 9 487 0.0E+00
sp|A6T4L7|LEUC_KLEP7 3-isopropylmalate dehydratase large subunit OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=leuC PE=3 SV=1 8 480 0.0E+00
sp|Q326G3|LEUC_SHIBS 3-isopropylmalate dehydratase large subunit OS=Shigella boydii serotype 4 (strain Sb227) GN=leuC PE=3 SV=1 8 480 0.0E+00
sp|Q1QAF2|LEUC_PSYCK 3-isopropylmalate dehydratase large subunit OS=Psychrobacter cryohalolentis (strain K5) GN=leuC PE=3 SV=1 9 480 0.0E+00
sp|B7L4J3|LEUC_ECO55 3-isopropylmalate dehydratase large subunit OS=Escherichia coli (strain 55989 / EAEC) GN=leuC PE=3 SV=1 8 480 0.0E+00
sp|B7LWE0|LEUC_ESCF3 3-isopropylmalate dehydratase large subunit OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=leuC PE=3 SV=1 8 480 0.0E+00
sp|P56934|LEUC_BUCAI 3-isopropylmalate dehydratase large subunit OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=leuC PE=3 SV=2 9 482 0.0E+00
sp|B2U279|LEUC_SHIB3 3-isopropylmalate dehydratase large subunit OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=leuC PE=3 SV=1 8 480 0.0E+00
sp|Q1RGC5|LEUC_ECOUT 3-isopropylmalate dehydratase large subunit OS=Escherichia coli (strain UTI89 / UPEC) GN=leuC PE=3 SV=1 8 480 0.0E+00
sp|B1LG09|LEUC_ECOSM 3-isopropylmalate dehydratase large subunit OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=leuC PE=3 SV=1 8 480 0.0E+00
sp|B6HZ52|LEUC_ECOSE 3-isopropylmalate dehydratase large subunit OS=Escherichia coli (strain SE11) GN=leuC PE=3 SV=1 8 480 0.0E+00
sp|P0A6A6|LEUC_ECOLI 3-isopropylmalate dehydratase large subunit OS=Escherichia coli (strain K12) GN=leuC PE=1 SV=2 8 480 0.0E+00
sp|P0A6A7|LEUC_ECOL6 3-isopropylmalate dehydratase large subunit OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=leuC PE=3 SV=2 8 480 0.0E+00
sp|Q0TLR7|LEUC_ECOL5 3-isopropylmalate dehydratase large subunit OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=leuC PE=3 SV=1 8 480 0.0E+00
sp|A1A7C0|LEUC_ECOK1 3-isopropylmalate dehydratase large subunit OS=Escherichia coli O1:K1 / APEC GN=leuC PE=3 SV=1 8 480 0.0E+00
sp|C4ZPZ5|LEUC_ECOBW 3-isopropylmalate dehydratase large subunit OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=leuC PE=3 SV=1 8 480 0.0E+00
sp|B7M117|LEUC_ECO8A 3-isopropylmalate dehydratase large subunit OS=Escherichia coli O8 (strain IAI1) GN=leuC PE=3 SV=1 8 480 0.0E+00
sp|B7MNT0|LEUC_ECO81 3-isopropylmalate dehydratase large subunit OS=Escherichia coli O81 (strain ED1a) GN=leuC PE=3 SV=1 8 480 0.0E+00
sp|B7NHI0|LEUC_ECO7I 3-isopropylmalate dehydratase large subunit OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=leuC PE=3 SV=1 8 480 0.0E+00
sp|B7MAJ7|LEUC_ECO45 3-isopropylmalate dehydratase large subunit OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=leuC PE=3 SV=1 8 480 0.0E+00
sp|Q6D0G6|LEUC_PECAS 3-isopropylmalate dehydratase large subunit OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=leuC PE=3 SV=1 9 480 0.0E+00
sp|B1IRA6|LEUC_ECOLC 3-isopropylmalate dehydratase large subunit OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=leuC PE=3 SV=1 8 480 0.0E+00
sp|A7ZW23|LEUC_ECOHS 3-isopropylmalate dehydratase large subunit OS=Escherichia coli O9:H4 (strain HS) GN=leuC PE=3 SV=1 8 480 0.0E+00
sp|A0JXX8|LEUC_ARTS2 3-isopropylmalate dehydratase large subunit OS=Arthrobacter sp. (strain FB24) GN=leuC PE=3 SV=1 8 475 0.0E+00
sp|Q4FRU7|LEUC_PSYA2 3-isopropylmalate dehydratase large subunit OS=Psychrobacter arcticus (strain DSM 17307 / 273-4) GN=leuC PE=3 SV=1 9 480 0.0E+00
sp|Q3Z5T8|LEUC_SHISS 3-isopropylmalate dehydratase large subunit OS=Shigella sonnei (strain Ss046) GN=leuC PE=3 SV=1 8 480 0.0E+00
sp|B7N7U7|LEUC_ECOLU 3-isopropylmalate dehydratase large subunit OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=leuC PE=3 SV=1 8 480 0.0E+00
sp|B7UIC2|LEUC_ECO27 3-isopropylmalate dehydratase large subunit OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=leuC PE=3 SV=1 8 480 0.0E+00
sp|Q0T8C6|LEUC_SHIF8 3-isopropylmalate dehydratase large subunit OS=Shigella flexneri serotype 5b (strain 8401) GN=leuC PE=3 SV=1 8 480 0.0E+00
sp|A1T700|LEUC_MYCVP 3-isopropylmalate dehydratase large subunit OS=Mycobacterium vanbaalenii (strain DSM 7251 / PYR-1) GN=leuC PE=3 SV=1 9 481 0.0E+00
sp|B5Y1W4|LEUC_KLEP3 3-isopropylmalate dehydratase large subunit OS=Klebsiella pneumoniae (strain 342) GN=leuC PE=3 SV=1 8 480 0.0E+00
sp|A9MQE0|LEUC_SALAR 3-isopropylmalate dehydratase large subunit OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=leuC PE=3 SV=1 8 480 0.0E+00
sp|B0USF4|LEUC_HISS2 3-isopropylmalate dehydratase large subunit OS=Histophilus somni (strain 2336) GN=leuC PE=3 SV=1 9 480 0.0E+00
sp|Q0I2G3|LEUC_HAES1 3-isopropylmalate dehydratase large subunit OS=Haemophilus somnus (strain 129Pt) GN=leuC PE=3 SV=1 9 480 0.0E+00
sp|Q821C2|LEUC_SHIFL 3-isopropylmalate dehydratase large subunit OS=Shigella flexneri GN=leuC PE=3 SV=1 8 480 0.0E+00
sp|Q32K22|LEUC_SHIDS 3-isopropylmalate dehydratase large subunit OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=leuC PE=3 SV=1 8 480 0.0E+00
sp|C6DEW0|LEUC_PECCP 3-isopropylmalate dehydratase large subunit OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=leuC PE=3 SV=1 9 480 0.0E+00
sp|B3PFN2|LEUC_CELJU 3-isopropylmalate dehydratase large subunit OS=Cellvibrio japonicus (strain Ueda107) GN=leuC PE=3 SV=1 8 480 0.0E+00
sp|B5YZA8|LEUC_ECO5E 3-isopropylmalate dehydratase large subunit OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=leuC PE=3 SV=1 8 480 0.0E+00
sp|Q8XA00|LEUC_ECO57 3-isopropylmalate dehydratase large subunit OS=Escherichia coli O157:H7 GN=leuC PE=3 SV=3 8 480 0.0E+00
sp|A7ZHG4|LEUC_ECO24 3-isopropylmalate dehydratase large subunit OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=leuC PE=3 SV=1 8 480 0.0E+00
sp|B8HAC9|LEUC_ARTCA 3-isopropylmalate dehydratase large subunit OS=Arthrobacter chlorophenolicus (strain ATCC 700700 / DSM 12829 / JCM 12360 / NCIMB 13794 / A6) GN=leuC PE=3 SV=1 8 494 0.0E+00
sp|P15717|LEUC1_SALTY 3-isopropylmalate dehydratase large subunit 1 OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=leuC1 PE=1 SV=4 8 480 0.0E+00
sp|Q8Z9I2|LEUC_SALTI 3-isopropylmalate dehydratase large subunit OS=Salmonella typhi GN=leuC PE=3 SV=2 8 480 0.0E+00
sp|B4TWV9|LEUC_SALSV 3-isopropylmalate dehydratase large subunit OS=Salmonella schwarzengrund (strain CVM19633) GN=leuC PE=3 SV=1 8 480 0.0E+00
sp|B5F7U7|LEUC_SALA4 3-isopropylmalate dehydratase large subunit OS=Salmonella agona (strain SL483) GN=leuC PE=3 SV=1 8 480 0.0E+00
sp|Q57TE8|LEUC1_SALCH 3-isopropylmalate dehydratase large subunit 1 OS=Salmonella choleraesuis (strain SC-B67) GN=leuC1 PE=3 SV=1 8 480 0.0E+00
sp|B5BLB3|LEUC_SALPK 3-isopropylmalate dehydratase large subunit OS=Salmonella paratyphi A (strain AKU_12601) GN=leuC PE=3 SV=1 8 480 0.0E+00
sp|Q5PDG3|LEUC_SALPA 3-isopropylmalate dehydratase large subunit OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=leuC PE=3 SV=1 8 480 0.0E+00
sp|A4TE23|LEUC_MYCGI 3-isopropylmalate dehydratase large subunit OS=Mycobacterium gilvum (strain PYR-GCK) GN=leuC PE=3 SV=1 9 487 0.0E+00
sp|C5BL66|LEUC_TERTT 3-isopropylmalate dehydratase large subunit OS=Teredinibacter turnerae (strain ATCC 39867 / T7901) GN=leuC PE=3 SV=1 9 478 0.0E+00
sp|Q65V07|LEUC2_MANSM 3-isopropylmalate dehydratase large subunit 2 OS=Mannheimia succiniciproducens (strain MBEL55E) GN=leuC2 PE=3 SV=1 8 481 0.0E+00
sp|Q5KWJ5|LEUC_GEOKA 3-isopropylmalate dehydratase large subunit OS=Geobacillus kaustophilus (strain HTA426) GN=leuC PE=3 SV=1 9 480 0.0E+00
sp|A6VQL0|LEUC_ACTSZ 3-isopropylmalate dehydratase large subunit OS=Actinobacillus succinogenes (strain ATCC 55618 / 130Z) GN=leuC PE=3 SV=1 9 480 0.0E+00
sp|A1R7K0|LEUC_ARTAT 3-isopropylmalate dehydratase large subunit OS=Arthrobacter aurescens (strain TC1) GN=leuC PE=3 SV=1 9 475 0.0E+00
sp|A0LVA3|LEUC_ACIC1 3-isopropylmalate dehydratase large subunit OS=Acidothermus cellulolyticus (strain ATCC 43068 / 11B) GN=leuC PE=3 SV=1 3 475 0.0E+00
sp|Q8F4E6|LEUC_LEPIN 3-isopropylmalate dehydratase large subunit OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601) GN=leuC PE=3 SV=1 9 478 0.0E+00
sp|Q72RC4|LEUC_LEPIC 3-isopropylmalate dehydratase large subunit OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130) GN=leuC PE=3 SV=1 9 478 0.0E+00
sp|B4F196|LEUC_PROMH 3-isopropylmalate dehydratase large subunit OS=Proteus mirabilis (strain HI4320) GN=leuC PE=3 SV=1 9 481 0.0E+00
sp|A8G9Q9|LEUC_SERP5 3-isopropylmalate dehydratase large subunit OS=Serratia proteamaculans (strain 568) GN=leuC PE=3 SV=1 8 480 0.0E+00
sp|B7GH21|LEUC_ANOFW 3-isopropylmalate dehydratase large subunit OS=Anoxybacillus flavithermus (strain DSM 21510 / WK1) GN=leuC PE=3 SV=1 9 480 0.0E+00
sp|A3MYL1|LEUC_ACTP2 3-isopropylmalate dehydratase large subunit OS=Actinobacillus pleuropneumoniae serotype 5b (strain L20) GN=leuC PE=3 SV=1 8 480 0.0E+00
sp|B3GZY1|LEUC_ACTP7 3-isopropylmalate dehydratase large subunit OS=Actinobacillus pleuropneumoniae serotype 7 (strain AP76) GN=leuC PE=3 SV=1 8 480 0.0E+00
sp|Q82JR8|LEUC_STRAW 3-isopropylmalate dehydratase large subunit OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=leuC PE=3 SV=1 9 486 0.0E+00
sp|A6W7Q7|LEUC_KINRD 3-isopropylmalate dehydratase large subunit OS=Kineococcus radiotolerans (strain ATCC BAA-149 / DSM 14245 / SRS30216) GN=leuC PE=3 SV=1 8 475 0.0E+00
sp|B0BS44|LEUC_ACTPJ 3-isopropylmalate dehydratase large subunit OS=Actinobacillus pleuropneumoniae serotype 3 (strain JL03) GN=leuC PE=3 SV=1 8 480 0.0E+00
sp|Q4JUX2|LEUC_CORJK 3-isopropylmalate dehydratase large subunit OS=Corynebacterium jeikeium (strain K411) GN=leuC PE=3 SV=1 10 475 0.0E+00
sp|A5CX27|LEUC_VESOH 3-isopropylmalate dehydratase large subunit OS=Vesicomyosocius okutanii subsp. Calyptogena okutanii (strain HA) GN=leuC PE=3 SV=1 8 478 0.0E+00
sp|C5D5L8|LEUC_GEOSW 3-isopropylmalate dehydratase large subunit OS=Geobacillus sp. (strain WCH70) GN=leuC PE=3 SV=1 9 480 0.0E+00
sp|Q5WPZ8|LEUC_BUCCC 3-isopropylmalate dehydratase large subunit OS=Buchnera aphidicola subsp. Cinara cedri (strain Cc) GN=leuC PE=3 SV=1 10 477 0.0E+00
sp|A8M5I3|LEUC_SALAI 3-isopropylmalate dehydratase large subunit OS=Salinispora arenicola (strain CNS-205) GN=leuC PE=3 SV=1 1 475 0.0E+00
sp|Q8FPR3|LEUC_COREF 3-isopropylmalate dehydratase large subunit OS=Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395) GN=leuC PE=3 SV=1 10 475 0.0E+00
sp|B1MDQ1|LEUC_MYCA9 3-isopropylmalate dehydratase large subunit OS=Mycobacterium abscessus (strain ATCC 19977 / DSM 44196 / CIP 104536 / JCM 13569 / NCTC 13031 / TMC 1543) GN=leuC PE=3 SV=1 9 481 0.0E+00
sp|Q47SA3|LEUC_THEFY 3-isopropylmalate dehydratase large subunit OS=Thermobifida fusca (strain YX) GN=leuC PE=3 SV=1 8 475 0.0E+00
sp|A4X4C8|LEUC_SALTO 3-isopropylmalate dehydratase large subunit OS=Salinispora tropica (strain ATCC BAA-916 / DSM 44818 / CNB-440) GN=leuC PE=3 SV=1 1 475 0.0E+00
sp|Q7UIA7|LEUC_RHOBA 3-isopropylmalate dehydratase large subunit OS=Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1) GN=leuC PE=3 SV=2 8 483 0.0E+00
sp|Q07WH1|LEUC_SHEFN 3-isopropylmalate dehydratase large subunit OS=Shewanella frigidimarina (strain NCIMB 400) GN=leuC PE=3 SV=1 9 479 0.0E+00
sp|Q73VI7|LEUC_MYCPA 3-isopropylmalate dehydratase large subunit OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=leuC PE=3 SV=1 3 475 0.0E+00
sp|B8F3W8|LEUC_HAEPS 3-isopropylmalate dehydratase large subunit OS=Haemophilus parasuis serovar 5 (strain SH0165) GN=leuC PE=3 SV=1 9 480 0.0E+00
sp|A0QJB7|LEUC_MYCA1 3-isopropylmalate dehydratase large subunit OS=Mycobacterium avium (strain 104) GN=leuC PE=3 SV=1 3 475 0.0E+00
sp|A4IRH6|LEUC_GEOTN 3-isopropylmalate dehydratase large subunit OS=Geobacillus thermodenitrificans (strain NG80-2) GN=leuC PE=3 SV=2 9 480 0.0E+00
sp|A8FQ85|LEUC_SHESH 3-isopropylmalate dehydratase large subunit OS=Shewanella sediminis (strain HAW-EB3) GN=leuC PE=3 SV=1 8 479 0.0E+00
sp|B8E4K6|LEUC_SHEB2 3-isopropylmalate dehydratase large subunit OS=Shewanella baltica (strain OS223) GN=leuC PE=3 SV=1 7 479 0.0E+00
sp|Q7N127|LEUC_PHOLL 3-isopropylmalate dehydratase large subunit OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=leuC PE=3 SV=1 8 481 0.0E+00
sp|A9KY15|LEUC_SHEB9 3-isopropylmalate dehydratase large subunit OS=Shewanella baltica (strain OS195) GN=leuC PE=3 SV=1 7 479 0.0E+00
sp|A6WIB7|LEUC_SHEB8 3-isopropylmalate dehydratase large subunit OS=Shewanella baltica (strain OS185) GN=leuC PE=3 SV=1 7 479 0.0E+00
sp|Q47HR4|LEUC_DECAR 3-isopropylmalate dehydratase large subunit OS=Dechloromonas aromatica (strain RCB) GN=leuC PE=3 SV=1 8 480 0.0E+00
sp|B1KKZ2|LEUC_SHEWM 3-isopropylmalate dehydratase large subunit OS=Shewanella woodyi (strain ATCC 51908 / MS32) GN=leuC PE=3 SV=1 8 479 0.0E+00
sp|Q1AZC4|LEUC1_RUBXD 3-isopropylmalate dehydratase large subunit 1 OS=Rubrobacter xylanophilus (strain DSM 9941 / NBRC 16129) GN=leuC1 PE=3 SV=1 9 481 0.0E+00
sp|Q0HE67|LEUC_SHESM 3-isopropylmalate dehydratase large subunit OS=Shewanella sp. (strain MR-4) GN=leuC PE=3 SV=1 2 479 0.0E+00
sp|Q3IJS4|LEUC_PSEHT 3-isopropylmalate dehydratase large subunit OS=Pseudoalteromonas haloplanktis (strain TAC 125) GN=leuC PE=3 SV=1 8 478 0.0E+00
sp|A3CZK7|LEUC_SHEB5 3-isopropylmalate dehydratase large subunit OS=Shewanella baltica (strain OS155 / ATCC BAA-1091) GN=leuC PE=3 SV=1 7 479 0.0E+00
sp|A0L1Q8|LEUC_SHESA 3-isopropylmalate dehydratase large subunit OS=Shewanella sp. (strain ANA-3) GN=leuC PE=3 SV=1 2 479 0.0E+00
sp|B8CM41|LEUC_SHEPW 3-isopropylmalate dehydratase large subunit OS=Shewanella piezotolerans (strain WP3 / JCM 13877) GN=leuC PE=3 SV=1 8 479 0.0E+00
sp|A3QIN8|LEUC_SHELP 3-isopropylmalate dehydratase large subunit OS=Shewanella loihica (strain ATCC BAA-1088 / PV-4) GN=leuC PE=3 SV=1 8 479 0.0E+00
sp|O85072|LEUC_BUCDN 3-isopropylmalate dehydratase large subunit OS=Buchnera aphidicola subsp. Diuraphis noxia GN=leuC PE=3 SV=1 9 480 0.0E+00
sp|A0KGM7|LEUC_AERHH 3-isopropylmalate dehydratase large subunit OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / JCM 1027 / KCTC 2358 / NCIMB 9240) GN=leuC PE=3 SV=1 8 480 0.0E+00
sp|O86534|LEUC_STRCO 3-isopropylmalate dehydratase large subunit OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=leuC PE=3 SV=1 9 475 0.0E+00
sp|P80858|LEUC_BACSU 3-isopropylmalate dehydratase large subunit OS=Bacillus subtilis (strain 168) GN=leuC PE=1 SV=1 9 480 0.0E+00
sp|Q8E9N4|LEUC_SHEON 3-isopropylmalate dehydratase large subunit OS=Shewanella oneidensis (strain MR-1) GN=leuC PE=3 SV=1 9 479 0.0E+00
sp|A1REY2|LEUC_SHESW 3-isopropylmalate dehydratase large subunit OS=Shewanella sp. (strain W3-18-1) GN=leuC PE=3 SV=1 8 479 0.0E+00
sp|Q6NHL0|LEUC_CORDI 3-isopropylmalate dehydratase large subunit OS=Corynebacterium diphtheriae (strain ATCC 700971 / NCTC 13129 / Biotype gravis) GN=leuC PE=3 SV=1 10 475 0.0E+00
sp|A6VX34|LEUC_MARMS 3-isopropylmalate dehydratase large subunit OS=Marinomonas sp. (strain MWYL1) GN=leuC PE=3 SV=1 7 483 0.0E+00
sp|Q65GJ0|LEUC_BACLD 3-isopropylmalate dehydratase large subunit OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=leuC PE=3 SV=1 9 479 0.0E+00
sp|Q0HZT2|LEUC_SHESR 3-isopropylmalate dehydratase large subunit OS=Shewanella sp. (strain MR-7) GN=leuC PE=3 SV=1 11 479 0.0E+00
sp|Q87SS9|LEUC_VIBPA 3-isopropylmalate dehydratase large subunit OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=leuC PE=3 SV=1 9 480 0.0E+00
sp|A4Y2M2|LEUC_SHEPC 3-isopropylmalate dehydratase large subunit OS=Shewanella putrefaciens (strain CN-32 / ATCC BAA-453) GN=leuC PE=3 SV=1 8 479 0.0E+00
sp|B2HII1|LEUC_MYCMM 3-isopropylmalate dehydratase large subunit OS=Mycobacterium marinum (strain ATCC BAA-535 / M) GN=leuC PE=3 SV=1 8 475 0.0E+00
sp|C4LAV5|LEUC_TOLAT 3-isopropylmalate dehydratase large subunit OS=Tolumonas auensis (strain DSM 9187 / TA4) GN=leuC PE=3 SV=1 8 480 0.0E+00
sp|Q6AFK7|LEUC_LEIXX 3-isopropylmalate dehydratase large subunit OS=Leifsonia xyli subsp. xyli (strain CTCB07) GN=leuC PE=3 SV=1 10 475 0.0E+00
sp|Q47WG2|LEUC_COLP3 3-isopropylmalate dehydratase large subunit OS=Colwellia psychrerythraea (strain 34H / ATCC BAA-681) GN=leuC PE=3 SV=1 9 477 0.0E+00
sp|A4SR64|LEUC_AERS4 3-isopropylmalate dehydratase large subunit OS=Aeromonas salmonicida (strain A449) GN=leuC PE=3 SV=1 8 480 0.0E+00
sp|B0TQM2|LEUC_SHEHH 3-isopropylmalate dehydratase large subunit OS=Shewanella halifaxensis (strain HAW-EB4) GN=leuC PE=3 SV=1 8 479 0.0E+00
sp|B1VZ03|LEUC_STRGG 3-isopropylmalate dehydratase large subunit OS=Streptomyces griseus subsp. griseus (strain JCM 4626 / NBRC 13350) GN=leuC PE=3 SV=1 9 482 0.0E+00
sp|P58945|LEUC_BUCPS 3-isopropylmalate dehydratase large subunit OS=Buchnera aphidicola subsp. Pemphigus spyrothecae GN=leuC PE=3 SV=1 9 480 0.0E+00
sp|A7Z7B6|LEUC_BACMF 3-isopropylmalate dehydratase large subunit OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=leuC PE=3 SV=1 9 480 0.0E+00
sp|Q8DED9|LEUC_VIBVU 3-isopropylmalate dehydratase large subunit OS=Vibrio vulnificus (strain CMCP6) GN=leuC PE=3 SV=1 9 478 0.0E+00
sp|Q7MP79|LEUC_VIBVY 3-isopropylmalate dehydratase large subunit OS=Vibrio vulnificus (strain YJ016) GN=leuC PE=3 SV=1 9 478 0.0E+00
sp|Q5YRY0|LEUC_NOCFA 3-isopropylmalate dehydratase large subunit OS=Nocardia farcinica (strain IFM 10152) GN=leuC PE=3 SV=1 9 475 0.0E+00
sp|A0PPZ6|LEUC_MYCUA 3-isopropylmalate dehydratase large subunit OS=Mycobacterium ulcerans (strain Agy99) GN=leuC PE=3 SV=1 8 475 0.0E+00
sp|A8H999|LEUC_SHEPA 3-isopropylmalate dehydratase large subunit OS=Shewanella pealeana (strain ATCC 700345 / ANG-SQ1) GN=leuC PE=3 SV=1 8 479 0.0E+00
sp|O31293|LEUC_BUCTS 3-isopropylmalate dehydratase large subunit OS=Buchnera aphidicola subsp. Thelaxes suberi GN=leuC PE=3 SV=1 9 480 0.0E+00
sp|A7MWC3|LEUC_VIBCB 3-isopropylmalate dehydratase large subunit OS=Vibrio campbellii (strain ATCC BAA-1116 / BB120) GN=leuC PE=3 SV=1 9 480 0.0E+00
sp|A1AW36|LEUC_RUTMC 3-isopropylmalate dehydratase large subunit OS=Ruthia magnifica subsp. Calyptogena magnifica GN=leuC PE=3 SV=2 9 478 0.0E+00
sp|Q9CJN7|LEUC_PASMU 3-isopropylmalate dehydratase large subunit OS=Pasteurella multocida (strain Pm70) GN=leuC PE=3 SV=3 8 480 0.0E+00
sp|Q6LV26|LEUC_PHOPR 3-isopropylmalate dehydratase large subunit OS=Photobacterium profundum GN=leuC PE=3 SV=2 1 480 2.0E-180
sp|C1AGA3|LEUC_MYCBT 3-isopropylmalate dehydratase large subunit OS=Mycobacterium bovis (strain BCG / Tokyo 172 / ATCC 35737 / TMC 1019) GN=leuC PE=3 SV=1 6 475 3.0E-180
sp|A1KMY2|LEUC_MYCBP 3-isopropylmalate dehydratase large subunit OS=Mycobacterium bovis (strain BCG / Pasteur 1173P2) GN=leuC PE=3 SV=1 6 475 3.0E-180
sp|Q7TXH6|LEUC_MYCBO 3-isopropylmalate dehydratase large subunit OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=leuC PE=1 SV=1 6 475 3.0E-180
sp|A1SLW5|LEUC_NOCSJ 3-isopropylmalate dehydratase large subunit OS=Nocardioides sp. (strain BAA-499 / JS614) GN=leuC PE=3 SV=1 9 486 4.0E-180
sp|O33123|LEUC_MYCLE 3-isopropylmalate dehydratase large subunit OS=Mycobacterium leprae (strain TN) GN=leuC PE=3 SV=1 9 475 4.0E-180
sp|P9WQF5|LEUC_MYCTU 3-isopropylmalate dehydratase large subunit OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=leuC PE=1 SV=1 6 475 1.0E-179
sp|P9WQF4|LEUC_MYCTO 3-isopropylmalate dehydratase large subunit OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=leuC PE=3 SV=1 6 475 1.0E-179
sp|A5U6Z9|LEUC_MYCTA 3-isopropylmalate dehydratase large subunit OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) GN=leuC PE=3 SV=1 6 475 1.0E-179
sp|Q44427|LEUC_ACTTI 3-isopropylmalate dehydratase large subunit OS=Actinoplanes teichomyceticus GN=leuC PE=3 SV=1 6 475 1.0E-179
sp|A1S2E2|LEUC_SHEAM 3-isopropylmalate dehydratase large subunit OS=Shewanella amazonensis (strain ATCC BAA-1098 / SB2B) GN=leuC PE=3 SV=1 8 478 2.0E-179
sp|B5FGH2|LEUC_VIBFM 3-isopropylmalate dehydratase large subunit OS=Vibrio fischeri (strain MJ11) GN=leuC PE=3 SV=1 7 482 4.0E-179
sp|Q5E858|LEUC_VIBF1 3-isopropylmalate dehydratase large subunit OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=leuC PE=3 SV=1 7 482 6.0E-179
sp|Q2NVW5|LEUC_SODGM 3-isopropylmalate dehydratase large subunit OS=Sodalis glossinidius (strain morsitans) GN=leuC PE=3 SV=1 9 480 8.0E-179
sp|B6ELJ8|LEUC_ALISL 3-isopropylmalate dehydratase large subunit OS=Aliivibrio salmonicida (strain LFI1238) GN=leuC PE=3 SV=1 7 482 2.0E-178
sp|Q9K8F0|LEUC_BACHD 3-isopropylmalate dehydratase large subunit OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=leuC PE=3 SV=1 9 480 6.0E-178
sp|C3LR34|LEUC_VIBCM 3-isopropylmalate dehydratase large subunit OS=Vibrio cholerae serotype O1 (strain M66-2) GN=leuC PE=3 SV=1 7 480 1.0E-177
sp|Q9KP81|LEUC_VIBCH 3-isopropylmalate dehydratase large subunit OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=leuC PE=3 SV=1 7 480 1.0E-177
sp|A5F5E2|LEUC_VIBC3 3-isopropylmalate dehydratase large subunit OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) GN=leuC PE=3 SV=1 7 480 1.0E-177
sp|C5B7R2|LEUC_EDWI9 3-isopropylmalate dehydratase large subunit OS=Edwardsiella ictaluri (strain 93-146) GN=leuC PE=3 SV=1 9 482 1.0E-177
sp|O85065|LEUC_BUCAP 3-isopropylmalate dehydratase large subunit OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=leuC PE=3 SV=1 9 480 2.0E-177
sp|A7NJH2|LEUC_ROSCS 3-isopropylmalate dehydratase large subunit OS=Roseiflexus castenholzii (strain DSM 13941 / HLO8) GN=leuC PE=3 SV=1 9 479 5.0E-177
sp|Q9EVI0|LEUC_BUCUO 3-isopropylmalate dehydratase large subunit (Fragment) OS=Buchnera aphidicola subsp. Uroleucon obscurum GN=leuC PE=3 SV=1 8 458 8.0E-177
sp|P59519|LEUC_BUCBP 3-isopropylmalate dehydratase large subunit OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=leuC PE=3 SV=1 9 482 1.0E-176
sp|Q2J6W9|LEUC_FRASC 3-isopropylmalate dehydratase large subunit OS=Frankia sp. (strain CcI3) GN=leuC PE=3 SV=1 9 474 1.0E-176
sp|A8FFW3|LEUC_BACP2 3-isopropylmalate dehydratase large subunit OS=Bacillus pumilus (strain SAFR-032) GN=leuC PE=3 SV=1 9 480 1.0E-176
sp|Q0RDK7|LEUC_FRAAA 3-isopropylmalate dehydratase large subunit OS=Frankia alni (strain ACN14a) GN=leuC PE=3 SV=1 9 474 1.0E-176
sp|P58946|LEUC_CORGL 3-isopropylmalate dehydratase large subunit OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=leuC PE=2 SV=1 10 475 2.0E-176
sp|Q8EN69|LEUC_OCEIH 3-isopropylmalate dehydratase large subunit OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=leuC PE=3 SV=1 9 481 2.0E-175
sp|A4QDS8|LEUC_CORGB 3-isopropylmalate dehydratase large subunit OS=Corynebacterium glutamicum (strain R) GN=leuC PE=3 SV=1 10 475 3.0E-175
sp|P48573|LEUC_BUCRP 3-isopropylmalate dehydratase large subunit OS=Buchnera aphidicola subsp. Rhopalosiphum padi GN=leuC PE=3 SV=1 9 480 4.0E-175
sp|A5UUP5|LEUC_ROSS1 3-isopropylmalate dehydratase large subunit OS=Roseiflexus sp. (strain RS-1) GN=leuC PE=3 SV=1 9 479 2.0E-174
sp|Q493R2|LEUC_BLOPB 3-isopropylmalate dehydratase large subunit OS=Blochmannia pennsylvanicus (strain BPEN) GN=leuC PE=3 SV=1 9 480 2.0E-174
sp|A8L567|LEUC_FRASN 3-isopropylmalate dehydratase large subunit OS=Frankia sp. (strain EAN1pec) GN=leuC PE=3 SV=1 9 474 6.0E-174
sp|B4RVU9|LEUC_ALTMD 3-isopropylmalate dehydratase large subunit OS=Alteromonas macleodii (strain DSM 17117 / Deep ecotype) GN=leuC PE=3 SV=1 8 478 1.0E-173
sp|B7GNM7|LEUC_BIFLS 3-isopropylmalate dehydratase large subunit OS=Bifidobacterium longum subsp. infantis (strain ATCC 15697 / DSM 20088 / JCM 1222 / NCTC 11817 / S12) GN=leuC PE=3 SV=1 10 475 1.0E-173
sp|Q15QR2|LEUC_PSEA6 3-isopropylmalate dehydratase large subunit OS=Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087) GN=leuC PE=3 SV=1 10 480 2.0E-173
sp|Q9PLW1|LEUC_CAMJE 3-isopropylmalate dehydratase large subunit OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) GN=leuC PE=3 SV=1 8 479 3.0E-173
sp|Q5HS78|LEUC_CAMJR 3-isopropylmalate dehydratase large subunit OS=Campylobacter jejuni (strain RM1221) GN=leuC PE=3 SV=1 8 479 4.0E-173
sp|B1HR96|LEUC_LYSSC 3-isopropylmalate dehydratase large subunit OS=Lysinibacillus sphaericus (strain C3-41) GN=leuC PE=3 SV=1 9 480 5.0E-173
sp|Q8CNL1|LEUC_STAES 3-isopropylmalate dehydratase large subunit OS=Staphylococcus epidermidis (strain ATCC 12228) GN=leuC PE=3 SV=1 9 480 5.0E-173
sp|Q11NN8|LEUC_CYTH3 3-isopropylmalate dehydratase large subunit OS=Cytophaga hutchinsonii (strain ATCC 33406 / NCIMB 9469) GN=leuC PE=3 SV=1 9 482 2.0E-172
sp|A7H665|LEUC_CAMJD 3-isopropylmalate dehydratase large subunit OS=Campylobacter jejuni subsp. doylei (strain ATCC BAA-1458 / RM4099 / 269.97) GN=leuC PE=3 SV=1 8 479 2.0E-172
sp|A8FP33|LEUC_CAMJ8 3-isopropylmalate dehydratase large subunit OS=Campylobacter jejuni subsp. jejuni serotype O:6 (strain 81116 / NCTC 11828) GN=leuC PE=3 SV=1 8 479 3.0E-172
sp|A1W1X0|LEUC_CAMJJ 3-isopropylmalate dehydratase large subunit OS=Campylobacter jejuni subsp. jejuni serotype O:23/36 (strain 81-176) GN=leuC PE=3 SV=1 8 479 5.0E-172
sp|Q9EVI3|LEUC_BUCUS 3-isopropylmalate dehydratase large subunit (Fragment) OS=Buchnera aphidicola subsp. Uroleucon solidaginis GN=leuC PE=3 SV=1 8 457 5.0E-171
sp|Q9EVG8|LEUC_BUCUM 3-isopropylmalate dehydratase large subunit (Fragment) OS=Buchnera aphidicola subsp. Uroleucon ambrosiae GN=leuC PE=3 SV=2 8 458 1.0E-170
sp|Q9EVI6|LEUC_BUCUN 3-isopropylmalate dehydratase large subunit (Fragment) OS=Buchnera aphidicola subsp. Uroleucon sonchi GN=leuC PE=3 SV=1 8 458 2.0E-170
sp|Q9EVH7|LEUC_BUCUH 3-isopropylmalate dehydratase large subunit (Fragment) OS=Buchnera aphidicola subsp. Uroleucon helianthicola GN=leuC PE=3 SV=1 8 457 3.0E-170
sp|Q5WEN5|LEUC_BACSK 3-isopropylmalate dehydratase large subunit OS=Bacillus clausii (strain KSM-K16) GN=leuC PE=3 SV=1 8 484 4.0E-170
sp|Q9EVG5|LEUC_BUCUA 3-isopropylmalate dehydratase large subunit (Fragment) OS=Buchnera aphidicola subsp. Uroleucon aeneum GN=leuC PE=3 SV=1 8 458 1.0E-169
sp|Q01Z81|LEUC_SOLUE 3-isopropylmalate dehydratase large subunit OS=Solibacter usitatus (strain Ellin6076) GN=leuC PE=3 SV=1 9 480 1.0E-169
sp|Q7VQJ8|LEUC_BLOFL 3-isopropylmalate dehydratase large subunit OS=Blochmannia floridanus GN=leuC PE=3 SV=1 9 478 2.0E-169
sp|Q49Z14|LEUC_STAS1 3-isopropylmalate dehydratase large subunit OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=leuC PE=3 SV=1 8 481 5.0E-169
sp|A0ZZS7|LEUC_BIFAA 3-isopropylmalate dehydratase large subunit OS=Bifidobacterium adolescentis (strain ATCC 15703 / DSM 20083 / NCTC 11814 / E194a) GN=leuC PE=3 SV=1 10 474 1.0E-168
sp|Q9EVH4|LEUC_BUCUE 3-isopropylmalate dehydratase large subunit (Fragment) OS=Buchnera aphidicola subsp. Uroleucon erigeronensis GN=leuC PE=3 SV=1 8 458 1.0E-168
sp|B8DVN0|LEUC_BIFA0 3-isopropylmalate dehydratase large subunit OS=Bifidobacterium animalis subsp. lactis (strain AD011) GN=leuC PE=3 SV=1 10 475 2.0E-168
sp|Q73B98|LEUC_BACC1 3-isopropylmalate dehydratase large subunit OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=leuC PE=3 SV=1 11 485 3.0E-168
sp|A7HBI2|LEUC_ANADF 3-isopropylmalate dehydratase large subunit OS=Anaeromyxobacter sp. (strain Fw109-5) GN=leuC PE=3 SV=1 8 482 3.0E-168
sp|A9VLG9|LEUC_BACWK 3-isopropylmalate dehydratase large subunit OS=Bacillus weihenstephanensis (strain KBAB4) GN=leuC PE=3 SV=1 8 479 5.0E-168
sp|Q5HMF7|LEUC_STAEQ 3-isopropylmalate dehydratase large subunit OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=leuC PE=3 SV=1 8 480 1.0E-167
sp|Q6GF14|LEUC_STAAR 3-isopropylmalate dehydratase large subunit OS=Staphylococcus aureus (strain MRSA252) GN=leuC PE=3 SV=1 8 481 2.0E-167
sp|Q81T66|LEUC_BACAN 3-isopropylmalate dehydratase large subunit OS=Bacillus anthracis GN=leuC PE=3 SV=1 8 485 4.0E-167
sp|C3L9Q5|LEUC_BACAC 3-isopropylmalate dehydratase large subunit OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=leuC PE=3 SV=1 8 485 4.0E-167
sp|C3P4Z8|LEUC_BACAA 3-isopropylmalate dehydratase large subunit OS=Bacillus anthracis (strain A0248) GN=leuC PE=3 SV=1 8 485 4.0E-167
sp|Q63DX6|LEUC_BACCZ 3-isopropylmalate dehydratase large subunit OS=Bacillus cereus (strain ZK / E33L) GN=leuC PE=3 SV=1 8 485 5.0E-167
sp|Q8G4W2|LEUC_BIFLO 3-isopropylmalate dehydratase large subunit OS=Bifidobacterium longum (strain NCC 2705) GN=leuC PE=3 SV=1 10 475 7.0E-167
sp|B3DPI2|LEUC_BIFLD 3-isopropylmalate dehydratase large subunit OS=Bifidobacterium longum (strain DJO10A) GN=leuC PE=3 SV=1 10 475 7.0E-167
sp|B9IUZ2|LEUC_BACCQ 3-isopropylmalate dehydratase large subunit OS=Bacillus cereus (strain Q1) GN=leuC PE=3 SV=1 11 485 1.0E-166
sp|B7HKC6|LEUC_BACC7 3-isopropylmalate dehydratase large subunit OS=Bacillus cereus (strain AH187) GN=leuC PE=3 SV=1 11 485 1.0E-166
sp|A0RBL4|LEUC_BACAH 3-isopropylmalate dehydratase large subunit OS=Bacillus thuringiensis (strain Al Hakam) GN=leuC PE=3 SV=1 8 485 1.0E-166
sp|Q81G10|LEUC_BACCR 3-isopropylmalate dehydratase large subunit OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=leuC PE=3 SV=1 9 485 1.0E-166
sp|C1EMB1|LEUC_BACC3 3-isopropylmalate dehydratase large subunit OS=Bacillus cereus (strain 03BB102) GN=leuC PE=3 SV=1 11 485 1.0E-166
sp|B7HHF7|LEUC_BACC4 3-isopropylmalate dehydratase large subunit OS=Bacillus cereus (strain B4264) GN=leuC PE=3 SV=1 9 485 2.0E-166
sp|B7JFY7|LEUC_BACC0 3-isopropylmalate dehydratase large subunit OS=Bacillus cereus (strain AH820) GN=leuC PE=3 SV=1 8 485 3.0E-166
sp|Q8Y5R7|LEUC_LISMO 3-isopropylmalate dehydratase large subunit OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=leuC PE=3 SV=1 8 481 3.0E-166
sp|B8DBU2|LEUC_LISMH 3-isopropylmalate dehydratase large subunit OS=Listeria monocytogenes serotype 4a (strain HCC23) GN=leuC PE=3 SV=1 8 481 4.0E-166
sp|Q71Y33|LEUC_LISMF 3-isopropylmalate dehydratase large subunit OS=Listeria monocytogenes serotype 4b (strain F2365) GN=leuC PE=3 SV=1 8 481 4.0E-166
sp|C1KWT3|LEUC_LISMC 3-isopropylmalate dehydratase large subunit OS=Listeria monocytogenes serotype 4b (strain CLIP80459) GN=leuC PE=3 SV=1 8 481 4.0E-166
sp|A8Z4W2|LEUC_STAAT 3-isopropylmalate dehydratase large subunit OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=leuC PE=3 SV=1 8 481 7.0E-166
sp|P63436|LEUC_STAAN 3-isopropylmalate dehydratase large subunit OS=Staphylococcus aureus (strain N315) GN=leuC PE=3 SV=1 8 481 7.0E-166
sp|P63435|LEUC_STAAM 3-isopropylmalate dehydratase large subunit OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=leuC PE=3 SV=1 8 481 7.0E-166
sp|A6QIQ5|LEUC_STAAE 3-isopropylmalate dehydratase large subunit OS=Staphylococcus aureus (strain Newman) GN=leuC PE=3 SV=1 8 481 7.0E-166
sp|Q5HEE2|LEUC_STAAC 3-isopropylmalate dehydratase large subunit OS=Staphylococcus aureus (strain COL) GN=leuC PE=3 SV=1 8 481 7.0E-166
sp|Q2YUF0|LEUC_STAAB 3-isopropylmalate dehydratase large subunit OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=leuC PE=3 SV=1 8 481 7.0E-166
sp|A5IUK5|LEUC_STAA9 3-isopropylmalate dehydratase large subunit OS=Staphylococcus aureus (strain JH9) GN=leuC PE=3 SV=1 8 481 7.0E-166
sp|Q2FWK1|LEUC_STAA8 3-isopropylmalate dehydratase large subunit OS=Staphylococcus aureus (strain NCTC 8325) GN=leuC PE=3 SV=1 8 481 7.0E-166
sp|Q2FF65|LEUC_STAA3 3-isopropylmalate dehydratase large subunit OS=Staphylococcus aureus (strain USA300) GN=leuC PE=3 SV=1 8 481 7.0E-166
sp|A6U3E4|LEUC_STAA2 3-isopropylmalate dehydratase large subunit OS=Staphylococcus aureus (strain JH1) GN=leuC PE=3 SV=1 8 481 7.0E-166
sp|A7X4N3|LEUC_STAA1 3-isopropylmalate dehydratase large subunit OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=leuC PE=3 SV=1 8 481 7.0E-166
sp|Q6HLF1|LEUC_BACHK 3-isopropylmalate dehydratase large subunit OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=leuC PE=3 SV=1 8 485 1.0E-165
sp|P58947|LEUC_STAAW 3-isopropylmalate dehydratase large subunit OS=Staphylococcus aureus (strain MW2) GN=leuC PE=3 SV=1 8 481 2.0E-165
sp|Q6G7P9|LEUC_STAAS 3-isopropylmalate dehydratase large subunit OS=Staphylococcus aureus (strain MSSA476) GN=leuC PE=3 SV=1 8 481 2.0E-165
sp|Q9EVE0|LEUC_BUCUD 3-isopropylmalate dehydratase large subunit (Fragment) OS=Buchnera aphidicola subsp. Uroleucon rudbeckiae GN=leuC PE=3 SV=1 8 458 4.0E-165
sp|B7IN95|LEUC_BACC2 3-isopropylmalate dehydratase large subunit OS=Bacillus cereus (strain G9842) GN=leuC PE=3 SV=1 9 485 6.0E-165
sp|A0AK94|LEUC_LISW6 3-isopropylmalate dehydratase large subunit OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=leuC PE=3 SV=1 8 481 2.0E-164
sp|Q92A26|LEUC_LISIN 3-isopropylmalate dehydratase large subunit OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=leuC PE=3 SV=1 8 481 2.0E-164
sp|A7GMU3|LEUC_BACCN 3-isopropylmalate dehydratase large subunit OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=leuC PE=3 SV=1 9 485 1.0E-163
sp|B8J825|LEUC_ANAD2 3-isopropylmalate dehydratase large subunit OS=Anaeromyxobacter dehalogenans (strain 2CP-1 / ATCC BAA-258) GN=leuC PE=3 SV=1 4 480 8.0E-163
sp|B4UAN0|LEUC_ANASK 3-isopropylmalate dehydratase large subunit OS=Anaeromyxobacter sp. (strain K) GN=leuC PE=3 SV=1 4 480 3.0E-162
sp|Q2IJC2|LEUC_ANADE 3-isopropylmalate dehydratase large subunit OS=Anaeromyxobacter dehalogenans (strain 2CP-C) GN=leuC PE=3 SV=1 4 480 4.0E-162
sp|B1WZV3|LEUC_CYAA5 3-isopropylmalate dehydratase large subunit OS=Cyanothece sp. (strain ATCC 51142) GN=leuC PE=3 SV=1 10 481 5.0E-162
sp|Q4L7U2|LEUC_STAHJ 3-isopropylmalate dehydratase large subunit OS=Staphylococcus haemolyticus (strain JCSC1435) GN=leuC PE=3 SV=1 8 481 1.0E-161
sp|Q57SN1|LEUC2_SALCH 3-isopropylmalate dehydratase large subunit 2 OS=Salmonella choleraesuis (strain SC-B67) GN=leuC2 PE=3 SV=1 7 484 2.0E-161
sp|Q8ZRJ0|LEUC2_SALTY 3-isopropylmalate dehydratase large subunit 2 OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=leuC2 PE=3 SV=1 7 484 2.0E-161
sp|Q9EVG2|LEUC_BUCML 3-isopropylmalate dehydratase large subunit (Fragment) OS=Buchnera aphidicola subsp. Macrosiphoniella ludovicianae GN=leuC PE=3 SV=1 9 457 4.0E-161
sp|B7K213|LEUC_CYAP8 3-isopropylmalate dehydratase large subunit OS=Cyanothece sp. (strain PCC 8801) GN=leuC PE=3 SV=1 10 480 1.0E-159
sp|B7KH96|LEUC_CYAP7 3-isopropylmalate dehydratase large subunit OS=Cyanothece sp. (strain PCC 7424) GN=leuC PE=3 SV=1 10 480 2.0E-159
sp|Q2JPG2|LEUC_SYNJB 3-isopropylmalate dehydratase large subunit OS=Synechococcus sp. (strain JA-2-3B'a(2-13)) GN=leuC PE=3 SV=1 9 480 7.0E-159
sp|Q0AT09|LEUC_MARMM 3-isopropylmalate dehydratase large subunit OS=Maricaulis maris (strain MCS10) GN=leuC PE=3 SV=1 9 482 4.0E-158
sp|Q65VS0|LEUC1_MANSM 3-isopropylmalate dehydratase large subunit 1 OS=Mannheimia succiniciproducens (strain MBEL55E) GN=leuC1 PE=3 SV=1 8 482 7.0E-158
sp|A9GL99|LEUC_SORC5 3-isopropylmalate dehydratase large subunit OS=Sorangium cellulosum (strain So ce56) GN=leuC PE=3 SV=1 9 480 1.0E-157
sp|Q2S0M6|LEUC_SALRD 3-isopropylmalate dehydratase large subunit OS=Salinibacter ruber (strain DSM 13855 / M31) GN=leuC PE=3 SV=1 10 480 5.0E-157
sp|B9DMJ8|LEUC_STACT 3-isopropylmalate dehydratase large subunit OS=Staphylococcus carnosus (strain TM300) GN=leuC PE=3 SV=1 8 479 9.0E-157
sp|B0JY97|LEUC_MICAN 3-isopropylmalate dehydratase large subunit OS=Microcystis aeruginosa (strain NIES-843) GN=leuC PE=3 SV=1 7 482 9.0E-157
sp|Q5MZY3|LEUC_SYNP6 3-isopropylmalate dehydratase large subunit OS=Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1) GN=leuC PE=3 SV=1 10 479 2.0E-156
sp|Q31LZ1|LEUC_SYNE7 3-isopropylmalate dehydratase large subunit OS=Synechococcus elongatus (strain PCC 7942) GN=leuC PE=3 SV=1 10 479 2.0E-156
sp|Q3AN00|LEUC_SYNSC 3-isopropylmalate dehydratase large subunit OS=Synechococcus sp. (strain CC9605) GN=leuC PE=3 SV=1 10 486 4.0E-156
sp|B1XLQ6|LEUC_SYNP2 3-isopropylmalate dehydratase large subunit OS=Synechococcus sp. (strain ATCC 27264 / PCC 7002 / PR-6) GN=leuC PE=3 SV=1 10 480 5.0E-156
sp|Q46HB8|LEUC_PROMT 3-isopropylmalate dehydratase large subunit OS=Prochlorococcus marinus (strain NATL2A) GN=leuC PE=3 SV=1 7 480 2.0E-155
sp|A2C088|LEUC_PROM1 3-isopropylmalate dehydratase large subunit OS=Prochlorococcus marinus (strain NATL1A) GN=leuC PE=3 SV=1 7 480 4.0E-155
sp|A1SVE7|LEUC_PSYIN 3-isopropylmalate dehydratase large subunit OS=Psychromonas ingrahamii (strain 37) GN=leuC PE=3 SV=1 9 481 4.0E-155
sp|Q2JQU3|LEUC_SYNJA 3-isopropylmalate dehydratase large subunit OS=Synechococcus sp. (strain JA-3-3Ab) GN=leuC PE=3 SV=1 9 480 1.0E-154
sp|A5GIG7|LEUC_SYNPW 3-isopropylmalate dehydratase large subunit OS=Synechococcus sp. (strain WH7803) GN=leuC PE=3 SV=1 10 480 1.0E-154
sp|B0CG35|LEUC_ACAM1 3-isopropylmalate dehydratase large subunit OS=Acaryochloris marina (strain MBIC 11017) GN=leuC PE=3 SV=1 10 480 2.0E-154
sp|Q0IDD5|LEUC_SYNS3 3-isopropylmalate dehydratase large subunit OS=Synechococcus sp. (strain CC9311) GN=leuC PE=3 SV=1 10 482 2.0E-154
sp|Q7ZAG7|LEUC_HALVD 3-isopropylmalate dehydratase large subunit OS=Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2) GN=leuC PE=3 SV=2 10 482 2.0E-153
sp|A3CMJ2|LEUC_STRSV 3-isopropylmalate dehydratase large subunit OS=Streptococcus sanguinis (strain SK36) GN=leuC PE=3 SV=1 9 482 3.0E-153
sp|Q64QP1|LEUC_BACFR 3-isopropylmalate dehydratase large subunit OS=Bacteroides fragilis (strain YCH46) GN=leuC PE=3 SV=1 9 480 4.0E-153
sp|Q5LAB1|LEUC_BACFN 3-isopropylmalate dehydratase large subunit OS=Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / JCM 11019 / NCTC 9343) GN=leuC PE=3 SV=1 9 480 4.0E-153
sp|B1ZUZ1|LEUC_OPITP 3-isopropylmalate dehydratase large subunit OS=Opitutus terrae (strain DSM 11246 / PB90-1) GN=leuC PE=3 SV=1 8 480 1.0E-152
sp|A8AWP5|LEUC_STRGC 3-isopropylmalate dehydratase large subunit OS=Streptococcus gordonii (strain Challis / ATCC 35105 / CH1 / DL1 / V288) GN=leuC PE=3 SV=1 9 482 1.0E-152
sp|Q9AIM3|LEUC_STRGN 3-isopropylmalate dehydratase large subunit (Fragment) OS=Streptococcus gordonii GN=leuC PE=3 SV=1 10 482 2.0E-152
sp|A9BDM7|LEUC_PROM4 3-isopropylmalate dehydratase large subunit OS=Prochlorococcus marinus (strain MIT 9211) GN=leuC PE=3 SV=1 7 484 3.0E-152
sp|A6L1V8|LEUC_BACV8 3-isopropylmalate dehydratase large subunit OS=Bacteroides vulgatus (strain ATCC 8482 / DSM 1447 / NCTC 11154) GN=leuC PE=3 SV=1 8 480 3.0E-152
sp|P54384|LEUC_SYNY3 3-isopropylmalate dehydratase large subunit OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=leuC PE=3 SV=2 7 480 4.0E-152
sp|A2CCJ0|LEUC_PROM3 3-isopropylmalate dehydratase large subunit OS=Prochlorococcus marinus (strain MIT 9303) GN=leuC PE=3 SV=1 10 480 9.0E-152
sp|Q8A6L7|LEUC_BACTN 3-isopropylmalate dehydratase large subunit OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482) GN=leuC PE=3 SV=1 9 480 2.0E-151
sp|Q3M614|LEUC_ANAVT 3-isopropylmalate dehydratase large subunit OS=Anabaena variabilis (strain ATCC 29413 / PCC 7937) GN=leuC PE=3 SV=1 10 480 2.0E-151
sp|Q7V4U5|LEUC_PROMM 3-isopropylmalate dehydratase large subunit OS=Prochlorococcus marinus (strain MIT 9313) GN=leuC PE=3 SV=1 10 480 4.0E-151
sp|A5FKC6|LEUC_FLAJ1 3-isopropylmalate dehydratase large subunit OS=Flavobacterium johnsoniae (strain ATCC 17061 / DSM 2064 / UW101) GN=leuC PE=3 SV=1 8 480 1.0E-150
sp|Q8DKF0|LEUC_THEEB 3-isopropylmalate dehydratase large subunit OS=Thermosynechococcus elongatus (strain BP-1) GN=leuC PE=3 SV=1 10 480 1.0E-150
sp|Q7VDT0|LEUC_PROMA 3-isopropylmalate dehydratase large subunit OS=Prochlorococcus marinus (strain SARG / CCMP1375 / SS120) GN=leuC PE=3 SV=1 7 480 1.0E-150
sp|B2GCB8|LEUC_LACF3 3-isopropylmalate dehydratase large subunit OS=Lactobacillus fermentum (strain NBRC 3956 / LMG 18251) GN=leuC PE=3 SV=1 8 480 3.0E-150
sp|Q8YX02|LEUC_NOSS1 3-isopropylmalate dehydratase large subunit OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=leuC PE=3 SV=1 10 480 6.0E-150
sp|Q7NFV7|LEUC_GLOVI 3-isopropylmalate dehydratase large subunit OS=Gloeobacter violaceus (strain PCC 7421) GN=leuC PE=3 SV=1 10 462 8.0E-150
sp|Q8DTG4|LEUC_STRMU 3-isopropylmalate dehydratase large subunit OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=leuC PE=3 SV=1 7 482 8.0E-150
sp|Q7U9J4|LEUC_SYNPX 3-isopropylmalate dehydratase large subunit OS=Synechococcus sp. (strain WH8102) GN=leuC PE=3 SV=1 10 481 1.0E-149
sp|B8HLN1|LEUC_CYAP4 3-isopropylmalate dehydratase large subunit OS=Cyanothece sp. (strain PCC 7425 / ATCC 29141) GN=leuC PE=3 SV=1 10 480 2.0E-149
sp|B2J3M9|LEUC_NOSP7 3-isopropylmalate dehydratase large subunit OS=Nostoc punctiforme (strain ATCC 29133 / PCC 73102) GN=leuC PE=3 SV=1 10 480 3.0E-149
sp|B9LUZ3|LEUC_HALLT 3-isopropylmalate dehydratase large subunit OS=Halorubrum lacusprofundi (strain ATCC 49239 / DSM 5036 / JCM 8891 / ACAM 34) GN=leuC PE=3 SV=1 10 480 4.0E-149
sp|B1MVR0|LEUC_LEUCK 3-isopropylmalate dehydratase large subunit OS=Leuconostoc citreum (strain KM20) GN=leuC PE=3 SV=1 9 480 5.0E-149
sp|Q5V518|LEUC_HALMA 3-isopropylmalate dehydratase large subunit OS=Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) GN=leuC PE=3 SV=1 10 482 5.0E-149
sp|Q03UM2|LEUC_LEUMM 3-isopropylmalate dehydratase large subunit OS=Leuconostoc mesenteroides subsp. mesenteroides (strain ATCC 8293 / NCDO 523) GN=leuC PE=3 SV=1 8 477 2.0E-148
sp|Q5LZF4|LEUC_STRT1 3-isopropylmalate dehydratase large subunit OS=Streptococcus thermophilus (strain CNRZ 1066) GN=leuC PE=3 SV=2 7 482 3.0E-148
sp|Q3AW21|LEUC_SYNS9 3-isopropylmalate dehydratase large subunit OS=Synechococcus sp. (strain CC9902) GN=leuC PE=3 SV=1 10 486 6.0E-148
sp|Q03KB3|LEUC_STRTD 3-isopropylmalate dehydratase large subunit OS=Streptococcus thermophilus (strain ATCC BAA-491 / LMD-9) GN=leuC PE=3 SV=1 7 482 1.0E-147
sp|Q5M406|LEUC_STRT2 3-isopropylmalate dehydratase large subunit OS=Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311) GN=leuC PE=3 SV=2 7 482 2.0E-147
sp|Q9ZND5|LEUC_THET8 3-isopropylmalate dehydratase large subunit OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=leuC PE=3 SV=1 9 480 6.0E-147
sp|Q72JB3|LEUC_THET2 3-isopropylmalate dehydratase large subunit OS=Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) GN=leuC PE=3 SV=1 9 480 6.0E-147
sp|Q89X98|LEUC1_BRADU 3-isopropylmalate dehydratase large subunit 1 OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=leuC1 PE=3 SV=2 5 480 6.0E-147
sp|Q3IRQ4|LEUC_NATPD 3-isopropylmalate dehydratase large subunit OS=Natronomonas pharaonis (strain ATCC 35678 / DSM 2160) GN=leuC PE=3 SV=1 10 480 2.0E-146
sp|A3PAX7|LEUC_PROM0 3-isopropylmalate dehydratase large subunit OS=Prochlorococcus marinus (strain MIT 9301) GN=leuC PE=3 SV=1 10 480 6.0E-146
sp|A2RKR3|LEUC_LACLM 3-isopropylmalate dehydratase large subunit OS=Lactococcus lactis subsp. cremoris (strain MG1363) GN=leuC PE=3 SV=1 7 480 2.0E-145
sp|A8G2R6|LEUC_PROM2 3-isopropylmalate dehydratase large subunit OS=Prochlorococcus marinus (strain MIT 9215) GN=leuC PE=3 SV=1 10 482 9.0E-145
sp|Q04DA3|LEUC_OENOB 3-isopropylmalate dehydratase large subunit OS=Oenococcus oeni (strain ATCC BAA-331 / PSU-1) GN=leuC PE=3 SV=1 9 479 1.0E-144
sp|Q9AQC6|LEUC_BUCUL 3-isopropylmalate dehydratase large subunit (Fragment) OS=Buchnera aphidicola subsp. Uroleucon rurale GN=leuC PE=3 SV=1 91 457 6.0E-144
sp|A2BUN7|LEUC_PROM5 3-isopropylmalate dehydratase large subunit OS=Prochlorococcus marinus (strain MIT 9515) GN=leuC PE=3 SV=1 10 482 3.0E-143
sp|Q02YY1|LEUC_LACLS 3-isopropylmalate dehydratase large subunit OS=Lactococcus lactis subsp. cremoris (strain SK11) GN=leuC PE=3 SV=1 8 480 4.0E-142
sp|A5GWH5|LEUC_SYNR3 3-isopropylmalate dehydratase large subunit OS=Synechococcus sp. (strain RCC307) GN=leuC PE=3 SV=1 10 480 2.0E-141
sp|Q02142|LEUC_LACLA 3-isopropylmalate dehydratase large subunit OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=leuC PE=3 SV=2 7 480 5.0E-141
sp|A2BP55|LEUC_PROMS 3-isopropylmalate dehydratase large subunit OS=Prochlorococcus marinus (strain AS9601) GN=leuC PE=3 SV=1 10 482 1.0E-139
sp|Q7V336|LEUC_PROMP 3-isopropylmalate dehydratase large subunit OS=Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / MED4) GN=leuC PE=3 SV=1 10 482 5.0E-138
sp|B2UPW8|LEUC_AKKM8 3-isopropylmalate dehydratase large subunit OS=Akkermansia muciniphila (strain ATCC BAA-835 / Muc) GN=leuC PE=3 SV=1 9 480 1.0E-137
sp|Q31CS6|LEUC_PROM9 3-isopropylmalate dehydratase large subunit OS=Prochlorococcus marinus (strain MIT 9312) GN=leuC PE=3 SV=1 9 482 1.0E-137
sp|P96195|LEUC_AZOVI 3-isopropylmalate dehydratase large subunit OS=Azotobacter vinelandii GN=leuC PE=3 SV=1 9 480 4.0E-132
sp|Q74BX5|LEUC_GEOSL 3-isopropylmalate dehydratase large subunit OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) GN=leuC PE=3 SV=1 9 479 2.0E-95
sp|A5G7U4|LEUC_GEOUR 3-isopropylmalate dehydratase large subunit OS=Geobacter uraniireducens (strain Rf4) GN=leuC PE=3 SV=1 9 479 8.0E-94
sp|B5EHU2|LEUC_GEOBB 3-isopropylmalate dehydratase large subunit OS=Geobacter bemidjiensis (strain Bem / ATCC BAA-1014 / DSM 16622) GN=leuC PE=3 SV=1 9 479 7.0E-92
sp|Q39W70|LEUC_GEOMG 3-isopropylmalate dehydratase large subunit OS=Geobacter metallireducens (strain GS-15 / ATCC 53774 / DSM 7210) GN=leuC PE=3 SV=1 9 479 8.0E-90
sp|A9A043|LEUC_DESOH 3-isopropylmalate dehydratase large subunit OS=Desulfococcus oleovorans (strain DSM 6200 / Hxd3) GN=leuC PE=3 SV=1 9 459 9.0E-80
sp|Q44023|LEUC_CUPNE 3-isopropylmalate dehydratase large subunit (Fragment) OS=Cupriavidus necator GN=leuC PE=3 SV=1 214 479 2.0E-78
sp|Q07UT6|LEUD_RHOP5 3-isopropylmalate dehydratase small subunit OS=Rhodopseudomonas palustris (strain BisA53) GN=leuD PE=3 SV=1 542 742 1.0E-74
sp|Q2VZV3|LEUD_MAGSA 3-isopropylmalate dehydratase small subunit OS=Magnetospirillum magneticum (strain AMB-1 / ATCC 700264) GN=leuD PE=3 SV=1 542 743 1.0E-74
sp|O67078|LEUC_AQUAE 3-isopropylmalate dehydratase large subunit OS=Aquifex aeolicus (strain VF5) GN=leuC PE=3 SV=1 10 475 9.0E-74
sp|Q13DV3|LEUD_RHOPS 3-isopropylmalate dehydratase small subunit OS=Rhodopseudomonas palustris (strain BisB5) GN=leuD PE=3 SV=1 542 742 9.0E-74
sp|Q1GDM5|LEUD_RUEST 3-isopropylmalate dehydratase small subunit OS=Ruegeria sp. (strain TM1040) GN=leuD PE=3 SV=1 542 743 2.0E-73
sp|Q2J3A7|LEUD_RHOP2 3-isopropylmalate dehydratase small subunit OS=Rhodopseudomonas palustris (strain HaA2) GN=leuD PE=3 SV=1 542 742 5.0E-73
sp|Q2RV54|LEUD_RHORT 3-isopropylmalate dehydratase small subunit OS=Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1) GN=leuD PE=3 SV=1 542 743 1.0E-72
sp|A7HT11|LEUD_PARL1 3-isopropylmalate dehydratase small subunit OS=Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966) GN=leuD PE=3 SV=1 542 743 1.0E-72
sp|Q28W72|LEUD_JANSC 3-isopropylmalate dehydratase small subunit OS=Jannaschia sp. (strain CCS1) GN=leuD PE=3 SV=1 542 743 3.0E-72
sp|Q8TVF2|LEUC1_METKA 3-isopropylmalate dehydratase large subunit 1 OS=Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938) GN=leuC1 PE=3 SV=1 9 478 8.0E-72
sp|B3Q845|LEUD_RHOPT 3-isopropylmalate dehydratase small subunit OS=Rhodopseudomonas palustris (strain TIE-1) GN=leuD PE=3 SV=1 542 742 9.0E-72
sp|Q6ND74|LEUD_RHOPA 3-isopropylmalate dehydratase small subunit OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=leuD PE=3 SV=1 542 742 9.0E-72
sp|A5E8Z8|LEUD_BRASB 3-isopropylmalate dehydratase small subunit OS=Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182) GN=leuD PE=3 SV=1 542 738 1.0E-71
sp|Q21CT1|LEUD_RHOPB 3-isopropylmalate dehydratase small subunit OS=Rhodopseudomonas palustris (strain BisB18) GN=leuD PE=3 SV=1 542 742 1.0E-71
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 67 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|5951
MPGSDGNAQTLYDKVLSRHIVDEKLDGTILLYIDRHLVHEVTSPQAFEGLKNARRSVRRPDCTLATTDHNVPTTS
RKALKDIASFIEEDDSRTQCVTLEENVKSFGLTYFGLGDKRQGIVHVIGPEQGFTLPGTTVVCGDSHTSTHGAFG
ALAFGIGTSEVEHVLATQCLITKRSKNMRIQIDGELAPGVSSKDVVLHAIGKIGTAGGTGAVIEFCGSVIRALSM
EARMSICNMSIEGGARAGMVAPDDITFNYLKNRPLAPKYGSDEWKAAVASWRDLQSDADARYDIDVFIDARDIVP
TVTWGTSPEDVVPITGRVPDPEAFLTESKKASGRRMLEYMGLTAGTPMEEIVVDKVFIGSCTNSRIEDLRAAAHV
VRGRHIASNVKRAMVVPGSGLVKTQAEKEGLDHVFIDAGFEWREAGCSMCLGMNPDILSPKERCASTSNRNFEGR
QGAGGRTHLMSPVMAAAAAIVGKLADVRKLADYGASPHVQAQVAPAACESPRVDDRVNGDDASQRDAIADQPQDL
QPHTNTSVQAGGASAGLPKFLTLKGVVAPLDMSNVDTDAIIPKQFLKTIKRTGLGVALFHSLRYNADGSENPSFV
LNKEPYRASKILVCTGPNFGCGSSREHAPWALLDFGIKCIIAPSFADIFFNNTFKNGMLPIVVENKADLEAIAAE
ARAGRDIEIDLPAQVIKNSAGDTICSFDVEEFRKHCLVNGLDDIGLTMQLEDKIAEYEARISQTTPWIDGSGFLR
RQGQGGKLATKAVPVPQTNRGEEKKEPLEW*
Coding >OphauB2|5951
ATGCCTGGTTCCGATGGAAACGCCCAGACCCTCTACGACAAGGTGCTCTCGCGCCACATTGTCGACGAGAAGCTC
GACGGCACAATCCTGCTCTATATTGATAGACATTTGGTCCATGAGGTGACATCACCGCAAGCATTCGAGGGCCTC
AAGAATGCCCGTCGCTCCGTCAGAAGACCAGATTGTACCCTGGCCACGACTGATCACAATGTTCCCACAACGTCG
CGCAAAGCCCTCAAGGACATTGCCTCTTTTATCGAAGAAGACGACTCGCGCACGCAGTGCGTCACGCTCGAGGAA
AACGTCAAGAGCTTTGGCCTGACATATTTTGGCCTCGGCGACAAGCGGCAGGGCATCGTCCACGTAATTGGGCCC
GAGCAGGGCTTTACTCTTCCCGGAACCACGGTTGTCTGCGGCGACAGCCATACCTCAACACATGGTGCCTTTGGC
GCCCTGGCCTTTGGCATTGGCACAAGCGAGGTTGAGCATGTTCTGGCAACGCAATGTCTCATCACCAAGCGCAGC
AAGAACATGCGCATCCAGATTGACGGCGAGCTGGCTCCTGGCGTCAGCTCCAAAGACGTTGTCCTCCATGCCATT
GGAAAGATTGGTACTGCTGGCGGCACCGGCGCCGTCATTGAGTTTTGCGGTTCCGTGATTCGGGCCCTGAGCATG
GAGGCCCGCATGTCCATTTGCAACATGTCGATTGAGGGCGGTGCCCGCGCAGGCATGGTGGCTCCCGACGACATC
ACCTTCAACTATCTCAAGAACCGGCCTCTGGCCCCCAAGTATGGCTCTGACGAGTGGAAGGCTGCCGTGGCCTCG
TGGCGAGATTTGCAGTCAGATGCTGATGCCCGCTACGACATTGATGTTTTTATTGACGCCCGCGACATTGTGCCA
ACAGTCACTTGGGGCACAAGTCCCGAGGATGTGGTGCCCATTACTGGCCGCGTTCCAGATCCCGAAGCGTTTTTG
ACTGAGTCCAAAAAGGCTTCTGGGCGGCGCATGCTGGAATACATGGGTCTCACGGCAGGTACCCCGATGGAAGAG
ATAGTTGTCGACAAGGTCTTTATCGGCTCCTGTACAAACTCGCGCATCGAGGACCTGCGTGCTGCTGCTCACGTG
GTGCGCGGTCGGCATATTGCTTCCAACGTCAAGCGCGCCATGGTTGTTCCCGGCTCGGGTCTGGTCAAGACGCAG
GCCGAGAAGGAGGGTCTGGATCACGTCTTCATAGACGCTGGCTTTGAGTGGCGCGAAGCAGGCTGTAGCATGTGT
CTTGGCATGAATCCAGACATTCTATCTCCCAAGGAGCGCTGCGCCAGCACCTCGAACCGCAACTTTGAGGGCCGG
CAGGGCGCCGGTGGCCGCACTCACCTCATGTCTCCCGTCATGGCCGCTGCTGCTGCCATTGTTGGCAAGCTGGCA
GATGTCCGCAAGCTCGCCGACTATGGCGCAAGCCCTCACGTACAAGCGCAGGTGGCGCCGGCTGCATGCGAGAGC
CCTCGCGTTGACGACAGAGTCAATGGTGATGATGCCAGCCAGCGCGACGCCATTGCCGATCAGCCGCAGGACTTG
CAGCCACATACAAACACGTCGGTCCAGGCTGGCGGTGCTTCAGCGGGACTGCCCAAGTTCTTGACACTCAAGGGC
GTTGTGGCACCGCTCGACATGTCCAATGTCGACACGGATGCCATTATTCCCAAGCAGTTTCTCAAGACGATTAAA
CGCACCGGGCTCGGCGTCGCACTCTTTCACAGCCTGCGGTATAATGCCGATGGGAGCGAAAACCCGAGTTTTGTG
TTGAATAAGGAGCCCTATCGAGCGTCCAAGATTCTTGTGTGTACGGGACCCAATTTTGGCTGTGGCAGCTCGCGG
GAGCATGCGCCTTGGGCGCTGCTCGACTTTGGCATCAAGTGCATCATTGCGCCGTCCTTTGCCGACATTTTTTTC
AACAACACCTTTAAGAATGGCATGCTGCCCATTGTAGTGGAGAACAAGGCAGACCTTGAGGCTATTGCGGCCGAG
GCACGGGCCGGACGTGACATTGAGATTGACTTGCCGGCTCAGGTAATCAAAAACTCGGCGGGCGACACCATTTGT
AGCTTTGATGTCGAAGAGTTCCGCAAGCACTGTCTAGTCAATGGGCTCGACGACATTGGGCTGACAATGCAGCTC
GAGGACAAGATTGCTGAATACGAGGCGCGCATTTCACAGACGACACCGTGGATCGATGGGTCAGGATTTCTGCGT
CGCCAAGGCCAAGGCGGAAAGCTGGCGACCAAGGCAGTGCCGGTGCCGCAGACGAACCGCGGCGAGGAGAAGAAG
GAACCTCTGGAGTGGTAG
Transcript >OphauB2|5951
ATGCCTGGTTCCGATGGAAACGCCCAGACCCTCTACGACAAGGTGCTCTCGCGCCACATTGTCGACGAGAAGCTC
GACGGCACAATCCTGCTCTATATTGATAGACATTTGGTCCATGAGGTGACATCACCGCAAGCATTCGAGGGCCTC
AAGAATGCCCGTCGCTCCGTCAGAAGACCAGATTGTACCCTGGCCACGACTGATCACAATGTTCCCACAACGTCG
CGCAAAGCCCTCAAGGACATTGCCTCTTTTATCGAAGAAGACGACTCGCGCACGCAGTGCGTCACGCTCGAGGAA
AACGTCAAGAGCTTTGGCCTGACATATTTTGGCCTCGGCGACAAGCGGCAGGGCATCGTCCACGTAATTGGGCCC
GAGCAGGGCTTTACTCTTCCCGGAACCACGGTTGTCTGCGGCGACAGCCATACCTCAACACATGGTGCCTTTGGC
GCCCTGGCCTTTGGCATTGGCACAAGCGAGGTTGAGCATGTTCTGGCAACGCAATGTCTCATCACCAAGCGCAGC
AAGAACATGCGCATCCAGATTGACGGCGAGCTGGCTCCTGGCGTCAGCTCCAAAGACGTTGTCCTCCATGCCATT
GGAAAGATTGGTACTGCTGGCGGCACCGGCGCCGTCATTGAGTTTTGCGGTTCCGTGATTCGGGCCCTGAGCATG
GAGGCCCGCATGTCCATTTGCAACATGTCGATTGAGGGCGGTGCCCGCGCAGGCATGGTGGCTCCCGACGACATC
ACCTTCAACTATCTCAAGAACCGGCCTCTGGCCCCCAAGTATGGCTCTGACGAGTGGAAGGCTGCCGTGGCCTCG
TGGCGAGATTTGCAGTCAGATGCTGATGCCCGCTACGACATTGATGTTTTTATTGACGCCCGCGACATTGTGCCA
ACAGTCACTTGGGGCACAAGTCCCGAGGATGTGGTGCCCATTACTGGCCGCGTTCCAGATCCCGAAGCGTTTTTG
ACTGAGTCCAAAAAGGCTTCTGGGCGGCGCATGCTGGAATACATGGGTCTCACGGCAGGTACCCCGATGGAAGAG
ATAGTTGTCGACAAGGTCTTTATCGGCTCCTGTACAAACTCGCGCATCGAGGACCTGCGTGCTGCTGCTCACGTG
GTGCGCGGTCGGCATATTGCTTCCAACGTCAAGCGCGCCATGGTTGTTCCCGGCTCGGGTCTGGTCAAGACGCAG
GCCGAGAAGGAGGGTCTGGATCACGTCTTCATAGACGCTGGCTTTGAGTGGCGCGAAGCAGGCTGTAGCATGTGT
CTTGGCATGAATCCAGACATTCTATCTCCCAAGGAGCGCTGCGCCAGCACCTCGAACCGCAACTTTGAGGGCCGG
CAGGGCGCCGGTGGCCGCACTCACCTCATGTCTCCCGTCATGGCCGCTGCTGCTGCCATTGTTGGCAAGCTGGCA
GATGTCCGCAAGCTCGCCGACTATGGCGCAAGCCCTCACGTACAAGCGCAGGTGGCGCCGGCTGCATGCGAGAGC
CCTCGCGTTGACGACAGAGTCAATGGTGATGATGCCAGCCAGCGCGACGCCATTGCCGATCAGCCGCAGGACTTG
CAGCCACATACAAACACGTCGGTCCAGGCTGGCGGTGCTTCAGCGGGACTGCCCAAGTTCTTGACACTCAAGGGC
GTTGTGGCACCGCTCGACATGTCCAATGTCGACACGGATGCCATTATTCCCAAGCAGTTTCTCAAGACGATTAAA
CGCACCGGGCTCGGCGTCGCACTCTTTCACAGCCTGCGGTATAATGCCGATGGGAGCGAAAACCCGAGTTTTGTG
TTGAATAAGGAGCCCTATCGAGCGTCCAAGATTCTTGTGTGTACGGGACCCAATTTTGGCTGTGGCAGCTCGCGG
GAGCATGCGCCTTGGGCGCTGCTCGACTTTGGCATCAAGTGCATCATTGCGCCGTCCTTTGCCGACATTTTTTTC
AACAACACCTTTAAGAATGGCATGCTGCCCATTGTAGTGGAGAACAAGGCAGACCTTGAGGCTATTGCGGCCGAG
GCACGGGCCGGACGTGACATTGAGATTGACTTGCCGGCTCAGGTAATCAAAAACTCGGCGGGCGACACCATTTGT
AGCTTTGATGTCGAAGAGTTCCGCAAGCACTGTCTAGTCAATGGGCTCGACGACATTGGGCTGACAATGCAGCTC
GAGGACAAGATTGCTGAATACGAGGCGCGCATTTCACAGACGACACCGTGGATCGATGGGTCAGGATTTCTGCGT
CGCCAAGGCCAAGGCGGAAAGCTGGCGACCAAGGCAGTGCCGGTGCCGCAGACGAACCGCGGCGAGGAGAAGAAG
GAACCTCTGGAGTGGTAG
Gene >OphauB2|5951
ATGCCTGGTTCCGATGGAAACGCCCAGACCCTCTACGACAAGGTGCTCTCGCGCCACATTGTCGACGAGAAGCTC
GACGGCACAATCCTGCTCTATATTGGTGCGTCGCAGTTGCAGCTCAAGGTGCCATTGGCATGCCTGCTAACGTTT
GCTCGCAGATAGACATTTGGTCCATGAGGTGACATCACCGGTACGCCGCAGCAACCCCATTCTGCTACCCTCCGC
CACCAGTGTGCCGCTGACGAAGCTGTTGCTTGTAGCAAGCATTCGAGGGCCTCAAGAATGCCCGTCGCTCCGTCA
GAAGACCAGATTGTACCCTGGCCACGACTGATCACGTATGTGCTGCTTGGACTTGTTGCGCCTCGTCTTGGCTGA
TGATGGGACTATAGAATGTTCCCACAACGTCGCGCAAAGCCCTCAAGGACATTGCCTCTTTTATCGAAGAAGACG
ACTCGCGCACGCAGTGCGTCACGCTCGAGGAAAACGTCAAGAGCTTTGGCCTGACATATTTTGGCCTCGGCGACA
AGCGGCAGGGCATCGTCCACGTAATTGGGCCCGAGCAGGGCTTTACTCTTCCCGGAACCACGGTTGTCTGCGGCG
ACAGCCATACCTCAACACATGGTGCCTTTGGCGCCCTGGCCTTTGGCATTGGCACAAGCGAGGTTGAGCATGTTC
TGGCAACGCAATGTCTCATCACCAAGCGCAGCAAGAACATGCGCATCCAGATTGACGGCGAGCTGGCTCCTGGCG
TCAGCTCCAAAGACGTTGTCCTCCATGCCATTGGAAAGATTGGTACTGCTGGCGGCACCGGCGCCGTCATTGAGT
TTTGCGGTTCCGTGATTCGGGCCCTGAGCATGGAGGCCCGCATGTCCATTTGCAACATGTCGATTGAGGGCGGTG
CCCGCGCAGGCATGGTGGCTCCCGACGACATCACCTTCAACTATCTCAAGAACCGGCCTCTGGCCCCCAAGTATG
GCTCTGACGAGTGGAAGGCTGCCGTGGCCTCGTGGCGAGATTTGCAGTCAGATGCTGATGCCCGCTACGACATTG
ATGTTTTTATTGACGCCCGCGACATTGTGCCAACAGTCACTTGGGGCACAAGTCCCGAGGATGTGGTGCCCATTA
CTGGCCGCGTTCCAGATCCCGAAGCGTTTTTGACTGAGTCCAAAAAGGCTTCTGGGCGGCGCATGCTGGAATACA
TGGGTCTCACGGCAGGTACCCCGATGGAAGAGATAGTTGTCGACAAGGTCTTTATCGGCTCCTGTACAAACTCGC
GCATCGAGGACCTGCGTGCTGCTGCTCACGTGGTGCGCGGTCGGCATATTGCTTCCAACGTCAAGCGCGCCATGG
TTGTTCCCGGCTCGGGTCTGGTCAAGACGCAGGCCGAGAAGGAGGGTCTGGATCACGTCTTCATAGACGCTGGCT
TTGAGTGGCGCGAAGCAGGCTGTAGCATGTGTCTTGGCATGAATCCAGACATTCTATCTCCCAAGGAGCGCTGCG
CCAGCACCTCGAACCGCAACTTTGAGGGCCGGCAGGGCGCCGGTGGCCGCACTCACCTCATGTCTCCCGTCATGG
CCGCTGCTGCTGCCATTGTTGGCAAGCTGGCAGATGTCCGCAAGCTCGCCGACTATGGCGCAAGCCCTCACGTAC
AAGCGCAGGTGGCGCCGGCTGCATGCGAGAGCCCTCGCGTTGACGACAGAGTCAATGGTGATGATGCCAGCCAGC
GCGACGCCATTGCCGATCAGCCGCAGGACTTGCAGCCACATACAAACACGTCGGTCCAGGCTGGCGGTGCTTCAG
CGGGACTGCCCAAGTTCTTGACACTCAAGGGCGTTGTGGCACCGCTCGACATGTCCAATGTCGACACGGATGCCA
TTATTCCCAAGCAGTTTCTCAAGACGATTAAACGCACCGGGCTCGGCGTCGCACTCTTTCACAGCCTGCGGTATA
ATGCCGATGGGAGCGAAAACCCGAGTTTTGTGTTGAATAAGGAGCCCTATCGAGCGTCCAAGATTCTTGTGTGTA
CGGGACCCAATTTTGGCTGTGGCAGCTCGCGGGAGCATGCGCCTTGGGCGCTGCTCGACTTTGGCATCAAGTGCA
TCATTGCGCCGTCCTTTGCCGACATTTTTTTCAACAACACCTTTAAGAATGGCATGCTGCCCATTGTAGTGGAGA
ACAAGGCAGACCTTGAGGCTATTGCGGCCGAGGCACGGGCCGGACGTGACATTGAGATTGACTTGCCGGCTCAGG
TAATCAAAAACTCGGCGGGCGACACCATTTGTAGCTTTGATGTCGAAGAGTTCCGCAAGCACTGTCTAGTCAATG
GGCTCGACGACATTGGGCTGACAATGCAGCTCGAGGACAAGATTGCTGAATACGAGGCGCGCATTTCACAGACGA
CACCGTGGATCGATGGGTCAGGATTTCTGCGTCGCCAAGGCCAAGGCGGAAAGCTGGCGACCAAGGCAGTGCCGG
TGCCGCAGACGAACCGCGGCGAGGAGAAGAAGGAACCTCTGGAGTGGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail