Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|5946
Gene name
LocationContig_5:245678..248417
Strand-
Gene length (bp)2739
Transcript length (bp)2739
Coding sequence length (bp)2739
Protein length (aa) 913

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00628 PHD PHD-finger 7.7E-08 49 97

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q10362|SET3_SCHPO SET domain-containing protein 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=set3 PE=1 SV=1 45 477 1.0E-22
sp|P42948|SET4_YEAST SET domain-containing protein 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SET4 PE=3 SV=1 315 495 1.0E-12
sp|P36124|SET3_YEAST SET domain-containing protein 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SET3 PE=1 SV=1 302 486 1.0E-10
sp|Q8IZD2|KMT2E_HUMAN Histone-lysine N-methyltransferase 2E OS=Homo sapiens GN=KMT2E PE=1 SV=1 48 113 7.0E-08
sp|Q3UG20|KMT2E_MOUSE Histone-lysine N-methyltransferase 2E OS=Mus musculus GN=Kmt2e PE=1 SV=2 301 410 1.0E-07

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 22 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|5946
MTDRLVPLSTQTALPSQAALAAPPARVLKDEAAIHAAETADEEPYTIKCICNFSDDDGNTIYCETCDTWQHIDCF
YPDNREEAIREDFAHSCAECKPRPLNRQKAIERTLRLRNAVFQEQPVDKKPKRPPSKSHKKKSKPADLHTNGHHG
TQESGKHLDQPSASKKSKVSHRPSHSISSQPSKRSPSYGNSRSNNGHPPSPATTPPDLPDDFQIHHYSAGFCSLY
NEHEVPCTQYNSFVNLAIPTALSRWLREPDAMKHQVGRSQSDVFQSETLLTNHEMPKLELQDCTRSLSAETVLRW
RFVKSTASIGKDMPLLELNGVIGFQKDYCANPDNLWADLSSPLPFVFFHPILPLYIDTRREGSLARYVRRSCKPN
AQLDTYLSAGSEYHFWLVSDRYISDNEQITLPWDFRLEKSVHARWLHLLGLSDDDAAAQSEPELNETEYIAISNW
IDRILSEYGGCACDLDNNCAFARFHRHYIHTKNHGRQAKKKTRKSRNHTISPTSTGHATNSRAASEGNADDGGDN
DARQESISRSKPPSRDRTPLQGQFDQLGILTEPTDRDKRKVAMVEVSFRRMEQHPPTRKKKRASDGSVAPMTAKS
KTRAVSSQQNQCINGANDNRIEVFADLQSPKFANLAKAVGARKALPAGQPKQIHSAPRPIYCNASVQTEPVPGEW
FSKPGVVVTDLRKKILPLSRRLLSNNARNRALLEELQQQNIASPSSCNEMAMNIDEPGFGESMQPKSPKSPLASI
QSPLSQSEDIQMPDAPSETMISVVNSAESDDIKPTPCEVKLQLPPVPAFDGGANNAIAQSVSITSPKPLHSPGNI
PSPFAPLAVNGIAMNPNPSPSPVKKKLSLSDYTKSRMNKAAGKVATGHTAIKSGASLEEIKADLSIVGKTNDEPV
SPSRSTMTANSL*
Coding >OphauB2|5946
ATGACAGACAGACTAGTCCCGCTGTCGACGCAGACCGCACTTCCTAGTCAGGCCGCTCTCGCTGCGCCACCGGCA
CGCGTCCTCAAGGACGAAGCCGCTATCCACGCTGCCGAGACGGCCGACGAAGAACCCTATACTATCAAGTGCATC
TGCAACTTCTCTGATGATGATGGCAACACAATTTATTGCGAGACGTGCGATACATGGCAGCACATTGACTGTTTT
TATCCCGACAACAGGGAAGAGGCTATTCGTGAAGACTTTGCTCATTCCTGTGCAGAGTGTAAGCCGCGACCTTTG
AATCGACAAAAGGCAATTGAGCGCACACTCCGTCTTCGAAATGCCGTCTTTCAAGAGCAGCCTGTCGACAAGAAG
CCTAAACGGCCTCCTTCCAAGAGCCACAAGAAGAAGTCCAAGCCTGCCGACTTGCACACAAACGGTCATCATGGC
ACCCAAGAGAGCGGCAAGCACCTGGACCAGCCTTCAGCATCGAAAAAGAGCAAAGTATCCCATCGCCCGTCACAT
TCTATTAGCTCTCAACCCTCAAAGCGCAGCCCTTCGTACGGCAACTCGCGGTCAAACAATGGGCACCCGCCCAGT
CCCGCAACAACACCTCCCGATCTTCCCGACGATTTTCAAATCCATCACTATTCCGCAGGCTTCTGTTCCTTATAC
AATGAACATGAGGTGCCGTGTACCCAATACAATTCTTTCGTTAACCTTGCCATTCCAACCGCCCTGTCACGATGG
CTGCGAGAGCCTGATGCGATGAAGCACCAAGTTGGCCGCTCACAGTCGGACGTCTTTCAAAGCGAAACTCTACTC
ACTAACCACGAAATGCCCAAGCTGGAACTCCAAGACTGCACCCGGTCCTTGAGCGCGGAGACAGTGCTTCGATGG
CGCTTCGTGAAATCCACGGCGTCCATTGGAAAGGACATGCCTCTTTTGGAACTCAACGGAGTAATTGGCTTCCAA
AAGGACTACTGCGCCAATCCTGACAATTTGTGGGCCGATCTCTCTTCTCCCCTCCCGTTTGTCTTTTTCCACCCC
ATTCTTCCTCTATACATTGACACGCGGCGAGAGGGCTCCCTTGCCCGCTATGTGCGGAGGAGCTGCAAGCCGAAT
GCTCAATTGGACACGTATTTATCCGCGGGCTCCGAGTATCATTTTTGGCTTGTCAGCGACCGGTATATATCTGAC
AATGAGCAAATCACTTTGCCGTGGGATTTTCGGCTCGAAAAGTCTGTCCACGCTCGGTGGCTTCATTTGCTTGGC
CTCAGCGACGATGACGCTGCCGCACAAAGCGAGCCTGAACTCAATGAGACCGAGTATATAGCCATTTCGAACTGG
ATAGATCGCATCTTGTCCGAGTACGGAGGATGTGCGTGCGACTTGGACAACAATTGCGCCTTCGCTCGCTTCCAC
CGACACTACATTCACACGAAAAATCATGGTCGCCAAGCAAAGAAGAAGACGCGCAAATCCAGAAACCATACCATC
TCACCCACCAGCACCGGTCATGCCACCAATAGTCGAGCCGCTAGTGAAGGAAATGCCGACGATGGGGGAGACAAC
GATGCAAGGCAAGAGTCAATATCTCGAAGCAAGCCTCCAAGCCGGGACAGAACTCCGCTTCAAGGACAGTTTGAT
CAACTTGGGATCTTGACTGAGCCGACGGATCGAGACAAGAGAAAGGTGGCCATGGTGGAGGTTTCGTTTCGCCGA
ATGGAACAGCATCCACCCACGAGAAAGAAGAAGCGTGCCTCTGATGGCTCCGTGGCACCCATGACAGCCAAGTCA
AAGACACGGGCCGTCTCTAGTCAGCAGAATCAATGTATCAATGGCGCCAATGACAATCGAATCGAAGTCTTTGCA
GATTTGCAGTCGCCAAAGTTTGCAAATCTTGCCAAGGCTGTGGGTGCGAGGAAAGCACTACCCGCGGGCCAGCCC
AAACAGATCCATTCAGCTCCTCGACCAATTTACTGTAATGCCAGTGTCCAAACAGAACCCGTTCCTGGCGAGTGG
TTCAGCAAACCGGGTGTCGTGGTGACTGACCTCAGGAAGAAGATATTACCACTTTCGAGACGGTTACTGAGCAAC
AATGCCAGAAATCGAGCATTGTTGGAAGAACTTCAGCAGCAGAATATTGCGTCTCCTTCGTCGTGCAATGAGATG
GCCATGAATATTGATGAGCCAGGATTTGGAGAGTCAATGCAACCAAAGAGCCCAAAGAGCCCTCTGGCCTCGATT
CAGTCACCCTTGTCGCAATCTGAAGACATTCAAATGCCAGACGCACCTTCAGAGACGATGATATCGGTCGTCAAC
TCAGCAGAGTCGGATGATATAAAGCCCACACCATGTGAGGTGAAGCTACAATTACCTCCTGTTCCGGCTTTTGAT
GGCGGTGCAAACAATGCAATAGCGCAATCGGTATCAATAACAAGCCCAAAGCCGCTCCATTCGCCCGGAAATATA
CCAAGCCCTTTTGCTCCGCTTGCAGTCAACGGCATTGCCATGAATCCCAACCCGAGCCCTAGTCCGGTAAAGAAG
AAGCTGAGTCTAAGCGACTACACAAAAAGCCGCATGAACAAGGCCGCTGGCAAGGTTGCTACAGGACACACTGCC
ATCAAATCCGGTGCGAGTCTAGAGGAAATCAAAGCCGACCTATCAATTGTGGGGAAGACGAATGATGAGCCAGTC
TCGCCATCACGTTCAACGATGACCGCCAACAGCCTTTAA
Transcript >OphauB2|5946
ATGACAGACAGACTAGTCCCGCTGTCGACGCAGACCGCACTTCCTAGTCAGGCCGCTCTCGCTGCGCCACCGGCA
CGCGTCCTCAAGGACGAAGCCGCTATCCACGCTGCCGAGACGGCCGACGAAGAACCCTATACTATCAAGTGCATC
TGCAACTTCTCTGATGATGATGGCAACACAATTTATTGCGAGACGTGCGATACATGGCAGCACATTGACTGTTTT
TATCCCGACAACAGGGAAGAGGCTATTCGTGAAGACTTTGCTCATTCCTGTGCAGAGTGTAAGCCGCGACCTTTG
AATCGACAAAAGGCAATTGAGCGCACACTCCGTCTTCGAAATGCCGTCTTTCAAGAGCAGCCTGTCGACAAGAAG
CCTAAACGGCCTCCTTCCAAGAGCCACAAGAAGAAGTCCAAGCCTGCCGACTTGCACACAAACGGTCATCATGGC
ACCCAAGAGAGCGGCAAGCACCTGGACCAGCCTTCAGCATCGAAAAAGAGCAAAGTATCCCATCGCCCGTCACAT
TCTATTAGCTCTCAACCCTCAAAGCGCAGCCCTTCGTACGGCAACTCGCGGTCAAACAATGGGCACCCGCCCAGT
CCCGCAACAACACCTCCCGATCTTCCCGACGATTTTCAAATCCATCACTATTCCGCAGGCTTCTGTTCCTTATAC
AATGAACATGAGGTGCCGTGTACCCAATACAATTCTTTCGTTAACCTTGCCATTCCAACCGCCCTGTCACGATGG
CTGCGAGAGCCTGATGCGATGAAGCACCAAGTTGGCCGCTCACAGTCGGACGTCTTTCAAAGCGAAACTCTACTC
ACTAACCACGAAATGCCCAAGCTGGAACTCCAAGACTGCACCCGGTCCTTGAGCGCGGAGACAGTGCTTCGATGG
CGCTTCGTGAAATCCACGGCGTCCATTGGAAAGGACATGCCTCTTTTGGAACTCAACGGAGTAATTGGCTTCCAA
AAGGACTACTGCGCCAATCCTGACAATTTGTGGGCCGATCTCTCTTCTCCCCTCCCGTTTGTCTTTTTCCACCCC
ATTCTTCCTCTATACATTGACACGCGGCGAGAGGGCTCCCTTGCCCGCTATGTGCGGAGGAGCTGCAAGCCGAAT
GCTCAATTGGACACGTATTTATCCGCGGGCTCCGAGTATCATTTTTGGCTTGTCAGCGACCGGTATATATCTGAC
AATGAGCAAATCACTTTGCCGTGGGATTTTCGGCTCGAAAAGTCTGTCCACGCTCGGTGGCTTCATTTGCTTGGC
CTCAGCGACGATGACGCTGCCGCACAAAGCGAGCCTGAACTCAATGAGACCGAGTATATAGCCATTTCGAACTGG
ATAGATCGCATCTTGTCCGAGTACGGAGGATGTGCGTGCGACTTGGACAACAATTGCGCCTTCGCTCGCTTCCAC
CGACACTACATTCACACGAAAAATCATGGTCGCCAAGCAAAGAAGAAGACGCGCAAATCCAGAAACCATACCATC
TCACCCACCAGCACCGGTCATGCCACCAATAGTCGAGCCGCTAGTGAAGGAAATGCCGACGATGGGGGAGACAAC
GATGCAAGGCAAGAGTCAATATCTCGAAGCAAGCCTCCAAGCCGGGACAGAACTCCGCTTCAAGGACAGTTTGAT
CAACTTGGGATCTTGACTGAGCCGACGGATCGAGACAAGAGAAAGGTGGCCATGGTGGAGGTTTCGTTTCGCCGA
ATGGAACAGCATCCACCCACGAGAAAGAAGAAGCGTGCCTCTGATGGCTCCGTGGCACCCATGACAGCCAAGTCA
AAGACACGGGCCGTCTCTAGTCAGCAGAATCAATGTATCAATGGCGCCAATGACAATCGAATCGAAGTCTTTGCA
GATTTGCAGTCGCCAAAGTTTGCAAATCTTGCCAAGGCTGTGGGTGCGAGGAAAGCACTACCCGCGGGCCAGCCC
AAACAGATCCATTCAGCTCCTCGACCAATTTACTGTAATGCCAGTGTCCAAACAGAACCCGTTCCTGGCGAGTGG
TTCAGCAAACCGGGTGTCGTGGTGACTGACCTCAGGAAGAAGATATTACCACTTTCGAGACGGTTACTGAGCAAC
AATGCCAGAAATCGAGCATTGTTGGAAGAACTTCAGCAGCAGAATATTGCGTCTCCTTCGTCGTGCAATGAGATG
GCCATGAATATTGATGAGCCAGGATTTGGAGAGTCAATGCAACCAAAGAGCCCAAAGAGCCCTCTGGCCTCGATT
CAGTCACCCTTGTCGCAATCTGAAGACATTCAAATGCCAGACGCACCTTCAGAGACGATGATATCGGTCGTCAAC
TCAGCAGAGTCGGATGATATAAAGCCCACACCATGTGAGGTGAAGCTACAATTACCTCCTGTTCCGGCTTTTGAT
GGCGGTGCAAACAATGCAATAGCGCAATCGGTATCAATAACAAGCCCAAAGCCGCTCCATTCGCCCGGAAATATA
CCAAGCCCTTTTGCTCCGCTTGCAGTCAACGGCATTGCCATGAATCCCAACCCGAGCCCTAGTCCGGTAAAGAAG
AAGCTGAGTCTAAGCGACTACACAAAAAGCCGCATGAACAAGGCCGCTGGCAAGGTTGCTACAGGACACACTGCC
ATCAAATCCGGTGCGAGTCTAGAGGAAATCAAAGCCGACCTATCAATTGTGGGGAAGACGAATGATGAGCCAGTC
TCGCCATCACGTTCAACGATGACCGCCAACAGCCTTTAA
Gene >OphauB2|5946
ATGACAGACAGACTAGTCCCGCTGTCGACGCAGACCGCACTTCCTAGTCAGGCCGCTCTCGCTGCGCCACCGGCA
CGCGTCCTCAAGGACGAAGCCGCTATCCACGCTGCCGAGACGGCCGACGAAGAACCCTATACTATCAAGTGCATC
TGCAACTTCTCTGATGATGATGGCAACACAATTTATTGCGAGACGTGCGATACATGGCAGCACATTGACTGTTTT
TATCCCGACAACAGGGAAGAGGCTATTCGTGAAGACTTTGCTCATTCCTGTGCAGAGTGTAAGCCGCGACCTTTG
AATCGACAAAAGGCAATTGAGCGCACACTCCGTCTTCGAAATGCCGTCTTTCAAGAGCAGCCTGTCGACAAGAAG
CCTAAACGGCCTCCTTCCAAGAGCCACAAGAAGAAGTCCAAGCCTGCCGACTTGCACACAAACGGTCATCATGGC
ACCCAAGAGAGCGGCAAGCACCTGGACCAGCCTTCAGCATCGAAAAAGAGCAAAGTATCCCATCGCCCGTCACAT
TCTATTAGCTCTCAACCCTCAAAGCGCAGCCCTTCGTACGGCAACTCGCGGTCAAACAATGGGCACCCGCCCAGT
CCCGCAACAACACCTCCCGATCTTCCCGACGATTTTCAAATCCATCACTATTCCGCAGGCTTCTGTTCCTTATAC
AATGAACATGAGGTGCCGTGTACCCAATACAATTCTTTCGTTAACCTTGCCATTCCAACCGCCCTGTCACGATGG
CTGCGAGAGCCTGATGCGATGAAGCACCAAGTTGGCCGCTCACAGTCGGACGTCTTTCAAAGCGAAACTCTACTC
ACTAACCACGAAATGCCCAAGCTGGAACTCCAAGACTGCACCCGGTCCTTGAGCGCGGAGACAGTGCTTCGATGG
CGCTTCGTGAAATCCACGGCGTCCATTGGAAAGGACATGCCTCTTTTGGAACTCAACGGAGTAATTGGCTTCCAA
AAGGACTACTGCGCCAATCCTGACAATTTGTGGGCCGATCTCTCTTCTCCCCTCCCGTTTGTCTTTTTCCACCCC
ATTCTTCCTCTATACATTGACACGCGGCGAGAGGGCTCCCTTGCCCGCTATGTGCGGAGGAGCTGCAAGCCGAAT
GCTCAATTGGACACGTATTTATCCGCGGGCTCCGAGTATCATTTTTGGCTTGTCAGCGACCGGTATATATCTGAC
AATGAGCAAATCACTTTGCCGTGGGATTTTCGGCTCGAAAAGTCTGTCCACGCTCGGTGGCTTCATTTGCTTGGC
CTCAGCGACGATGACGCTGCCGCACAAAGCGAGCCTGAACTCAATGAGACCGAGTATATAGCCATTTCGAACTGG
ATAGATCGCATCTTGTCCGAGTACGGAGGATGTGCGTGCGACTTGGACAACAATTGCGCCTTCGCTCGCTTCCAC
CGACACTACATTCACACGAAAAATCATGGTCGCCAAGCAAAGAAGAAGACGCGCAAATCCAGAAACCATACCATC
TCACCCACCAGCACCGGTCATGCCACCAATAGTCGAGCCGCTAGTGAAGGAAATGCCGACGATGGGGGAGACAAC
GATGCAAGGCAAGAGTCAATATCTCGAAGCAAGCCTCCAAGCCGGGACAGAACTCCGCTTCAAGGACAGTTTGAT
CAACTTGGGATCTTGACTGAGCCGACGGATCGAGACAAGAGAAAGGTGGCCATGGTGGAGGTTTCGTTTCGCCGA
ATGGAACAGCATCCACCCACGAGAAAGAAGAAGCGTGCCTCTGATGGCTCCGTGGCACCCATGACAGCCAAGTCA
AAGACACGGGCCGTCTCTAGTCAGCAGAATCAATGTATCAATGGCGCCAATGACAATCGAATCGAAGTCTTTGCA
GATTTGCAGTCGCCAAAGTTTGCAAATCTTGCCAAGGCTGTGGGTGCGAGGAAAGCACTACCCGCGGGCCAGCCC
AAACAGATCCATTCAGCTCCTCGACCAATTTACTGTAATGCCAGTGTCCAAACAGAACCCGTTCCTGGCGAGTGG
TTCAGCAAACCGGGTGTCGTGGTGACTGACCTCAGGAAGAAGATATTACCACTTTCGAGACGGTTACTGAGCAAC
AATGCCAGAAATCGAGCATTGTTGGAAGAACTTCAGCAGCAGAATATTGCGTCTCCTTCGTCGTGCAATGAGATG
GCCATGAATATTGATGAGCCAGGATTTGGAGAGTCAATGCAACCAAAGAGCCCAAAGAGCCCTCTGGCCTCGATT
CAGTCACCCTTGTCGCAATCTGAAGACATTCAAATGCCAGACGCACCTTCAGAGACGATGATATCGGTCGTCAAC
TCAGCAGAGTCGGATGATATAAAGCCCACACCATGTGAGGTGAAGCTACAATTACCTCCTGTTCCGGCTTTTGAT
GGCGGTGCAAACAATGCAATAGCGCAATCGGTATCAATAACAAGCCCAAAGCCGCTCCATTCGCCCGGAAATATA
CCAAGCCCTTTTGCTCCGCTTGCAGTCAACGGCATTGCCATGAATCCCAACCCGAGCCCTAGTCCGGTAAAGAAG
AAGCTGAGTCTAAGCGACTACACAAAAAGCCGCATGAACAAGGCCGCTGGCAAGGTTGCTACAGGACACACTGCC
ATCAAATCCGGTGCGAGTCTAGAGGAAATCAAAGCCGACCTATCAATTGTGGGGAAGACGAATGATGAGCCAGTC
TCGCCATCACGTTCAACGATGACCGCCAACAGCCTTTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail