Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|5945
Gene name
LocationContig_5:243528..244991
Strand+
Gene length (bp)1463
Transcript length (bp)1401
Coding sequence length (bp)1401
Protein length (aa) 467

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00953 Glycos_transf_4 Glycosyl transferase family 4 3.1E-29 147 320

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P07286|GPT_YEAST UDP-N-acetylglucosamine--dolichyl-phosphate N-acetylglucosaminephosphotransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ALG7 PE=3 SV=1 38 460 2.0E-142
sp|P42881|GPT_SCHPO UDP-N-acetylglucosamine--dolichyl-phosphate N-acetylglucosaminephosphotransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=gpt2 PE=3 SV=1 24 460 9.0E-123
sp|Q5EA65|GPT_BOVIN UDP-N-acetylglucosamine--dolichyl-phosphate N-acetylglucosaminephosphotransferase OS=Bos taurus GN=DPAGT1 PE=2 SV=1 37 457 3.0E-96
sp|Q9H3H5|GPT_HUMAN UDP-N-acetylglucosamine--dolichyl-phosphate N-acetylglucosaminephosphotransferase OS=Homo sapiens GN=DPAGT1 PE=1 SV=2 37 426 5.0E-95
sp|P42867|GPT_MOUSE UDP-N-acetylglucosamine--dolichyl-phosphate N-acetylglucosaminephosphotransferase OS=Mus musculus GN=Dpagt1 PE=1 SV=2 63 426 1.0E-93
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P07286|GPT_YEAST UDP-N-acetylglucosamine--dolichyl-phosphate N-acetylglucosaminephosphotransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ALG7 PE=3 SV=1 38 460 2.0E-142
sp|P42881|GPT_SCHPO UDP-N-acetylglucosamine--dolichyl-phosphate N-acetylglucosaminephosphotransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=gpt2 PE=3 SV=1 24 460 9.0E-123
sp|Q5EA65|GPT_BOVIN UDP-N-acetylglucosamine--dolichyl-phosphate N-acetylglucosaminephosphotransferase OS=Bos taurus GN=DPAGT1 PE=2 SV=1 37 457 3.0E-96
sp|Q9H3H5|GPT_HUMAN UDP-N-acetylglucosamine--dolichyl-phosphate N-acetylglucosaminephosphotransferase OS=Homo sapiens GN=DPAGT1 PE=1 SV=2 37 426 5.0E-95
sp|P42867|GPT_MOUSE UDP-N-acetylglucosamine--dolichyl-phosphate N-acetylglucosaminephosphotransferase OS=Mus musculus GN=Dpagt1 PE=1 SV=2 63 426 1.0E-93
sp|P24140|GPT_CRIGR UDP-N-acetylglucosamine--dolichyl-phosphate N-acetylglucosaminephosphotransferase OS=Cricetulus griseus GN=DPAGT1 PE=2 SV=1 37 426 3.0E-93
sp|P23338|GPT_CRILO UDP-N-acetylglucosamine--dolichyl-phosphate N-acetylglucosaminephosphotransferase OS=Cricetulus longicaudatus GN=DPAGT1 PE=2 SV=1 37 426 9.0E-92
sp|P0CD61|GPT_DICDI UDP-N-acetylglucosamine--dolichyl-phosphate N-acetylglucosaminephosphotransferase OS=Dictyostelium discoideum GN=alg7 PE=3 SV=1 45 450 1.0E-69
sp|P42864|GPT_LEIAM UDP-N-acetylglucosamine--dolichyl-phosphate N-acetylglucosaminephosphotransferase OS=Leishmania amazonensis GN=NAGT PE=3 SV=1 78 458 1.0E-42
sp|P39465|GPT_SULAC Putative UDP-N-acetylglucosamine--dolichyl-phosphate N-acetylglucosaminephosphotransferase OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=gnpTA PE=3 SV=1 48 345 8.0E-13
sp|P96000|GPT_SULSO Putative UDP-N-acetylglucosamine--dolichyl-phosphate N-acetylglucosaminephosphotransferase OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=gnpTA PE=3 SV=1 147 338 7.0E-11
[Show less]

GO

GO Term Description Terminal node
GO:0016021 integral component of membrane Yes
GO:0008963 phospho-N-acetylmuramoyl-pentapeptide-transferase activity Yes
GO:0003824 catalytic activity No
GO:0110165 cellular anatomical entity No
GO:0003674 molecular_function No
GO:0016772 transferase activity, transferring phosphorus-containing groups No
GO:0016780 phosphotransferase activity, for other substituted phosphate groups No
GO:0031224 intrinsic component of membrane No
GO:0016740 transferase activity No
GO:0005575 cellular_component No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

Domain # Start End Length
1 7 29 22
2 39 61 22
3 84 106 22
4 142 161 19
5 173 190 17
6 205 227 22
7 234 253 19
8 273 295 22
9 308 330 22

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup3489
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|6659
Ophiocordyceps australis map64 (Brazil) OphauB2|5945 (this protein)
Ophiocordyceps camponoti-floridani Ophcf2|03968
Ophiocordyceps camponoti-rufipedis Ophun1|7017
Ophiocordyceps kimflemingae Ophio5|2922
Ophiocordyceps subramaniannii Hirsu2|666
Ophiocordyceps subramaniannii Hirsu2|7770

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|5945
MAYPTTLSLAESLGLGSLSAAAFAVAAANTLHGDGEPLVALVALSTAAFALCYAMIRWLGPTFVQAGLRGRDLSK
ATRPEIPECMGAVCAAVYLLTVIVFVPFPFYKDIVAATSGGGNRDVVVEIHHVNQGRFLHRFPHNKLASYLSAII
SLQTIALLGIGDDLFDIRWRHKWWIPGLACIPLLVVYFVDFDVTSIVIPLQLQPYLGQLFDLGALYYVYMACVAM
FCPQSINMFAGINGIEVSQCLVVALLLAFNDCLYLLTPYPHPATDSHLFSLYFLLPWIGVSLALLCHNWYPANVF
VGDTYCYFSGMVFAVVGILGHFSKTLGLLLVPQIFNFVYSCPQIFGLIPCPRHRLPSFNATSGLLQPSVTSWPPG
RQPHPLVAQALYILDRLRLVRLVTDDKGHIVQTTNLTIINLWLVWRGPLREDRLAWELTLVQLIVGLFGLFARHR
LALLVFKEDNWGTPQS*
Coding >OphauB2|5945
ATGGCATACCCAACCACGCTCTCCTTGGCCGAGTCGCTGGGCCTCGGCTCCCTTTCCGCAGCTGCCTTTGCCGTC
GCCGCAGCAAACACGCTCCATGGCGACGGCGAGCCTCTAGTCGCCCTCGTGGCCCTGTCCACTGCCGCCTTTGCC
CTGTGCTACGCCATGATTCGATGGCTGGGCCCAACCTTTGTCCAGGCCGGTCTGCGTGGCCGCGACTTGAGCAAG
GCGACGCGCCCCGAGATTCCAGAGTGCATGGGCGCCGTCTGTGCTGCCGTCTACCTGCTGACCGTCATCGTCTTT
GTCCCCTTTCCCTTTTACAAGGACATTGTCGCCGCCACGAGCGGTGGCGGAAATCGCGACGTCGTTGTCGAGATT
CACCACGTCAACCAAGGTCGCTTCCTGCACCGCTTCCCCCACAACAAGCTTGCCTCGTATCTCAGCGCCATCATC
TCTCTCCAGACCATTGCCCTGCTCGGCATCGGCGACGACCTCTTTGACATTCGCTGGCGTCACAAGTGGTGGATT
CCCGGTCTGGCCTGCATCCCCCTGCTCGTTGTCTACTTTGTCGACTTTGATGTCACCTCGATTGTCATTCCTCTG
CAGCTGCAGCCCTATCTCGGCCAGCTCTTCGACCTCGGCGCCCTCTACTACGTCTACATGGCTTGCGTCGCCATG
TTCTGTCCCCAGAGCATCAACATGTTTGCTGGCATCAACGGCATCGAAGTCTCGCAGTGCCTCGTCGTTGCCCTC
CTCCTCGCCTTCAACGACTGTCTCTATCTTCTCACCCCTTACCCCCATCCAGCCACCGACTCGCATCTCTTCTCT
CTATATTTTCTTCTCCCCTGGATCGGCGTCTCTTTGGCTCTACTCTGCCACAACTGGTATCCCGCAAACGTCTTC
GTCGGCGACACCTATTGTTACTTTTCCGGCATGGTCTTTGCCGTCGTTGGCATCCTCGGCCATTTTTCCAAGACC
CTCGGTCTCTTGCTTGTTCCTCAAATCTTCAACTTTGTCTACTCGTGCCCTCAGATCTTTGGTCTTATTCCCTGT
CCACGCCACCGACTGCCCAGCTTCAATGCCACTTCTGGCCTCCTCCAGCCCTCTGTCACCTCGTGGCCCCCCGGA
CGTCAGCCACATCCCCTCGTTGCTCAGGCTCTCTACATCCTGGACCGATTACGTCTTGTACGTCTTGTTACTGAT
GACAAGGGCCACATTGTCCAAACTACCAACCTGACCATTATCAATCTCTGGCTCGTCTGGCGTGGGCCCTTGCGC
GAGGACCGCCTCGCCTGGGAACTAACCCTGGTGCAGCTAATTGTCGGCCTCTTTGGTCTCTTTGCCAGGCATCGT
CTTGCCCTTCTTGTCTTTAAGGAAGACAATTGGGGCACACCACAGTCTTGA
Transcript >OphauB2|5945
ATGGCATACCCAACCACGCTCTCCTTGGCCGAGTCGCTGGGCCTCGGCTCCCTTTCCGCAGCTGCCTTTGCCGTC
GCCGCAGCAAACACGCTCCATGGCGACGGCGAGCCTCTAGTCGCCCTCGTGGCCCTGTCCACTGCCGCCTTTGCC
CTGTGCTACGCCATGATTCGATGGCTGGGCCCAACCTTTGTCCAGGCCGGTCTGCGTGGCCGCGACTTGAGCAAG
GCGACGCGCCCCGAGATTCCAGAGTGCATGGGCGCCGTCTGTGCTGCCGTCTACCTGCTGACCGTCATCGTCTTT
GTCCCCTTTCCCTTTTACAAGGACATTGTCGCCGCCACGAGCGGTGGCGGAAATCGCGACGTCGTTGTCGAGATT
CACCACGTCAACCAAGGTCGCTTCCTGCACCGCTTCCCCCACAACAAGCTTGCCTCGTATCTCAGCGCCATCATC
TCTCTCCAGACCATTGCCCTGCTCGGCATCGGCGACGACCTCTTTGACATTCGCTGGCGTCACAAGTGGTGGATT
CCCGGTCTGGCCTGCATCCCCCTGCTCGTTGTCTACTTTGTCGACTTTGATGTCACCTCGATTGTCATTCCTCTG
CAGCTGCAGCCCTATCTCGGCCAGCTCTTCGACCTCGGCGCCCTCTACTACGTCTACATGGCTTGCGTCGCCATG
TTCTGTCCCCAGAGCATCAACATGTTTGCTGGCATCAACGGCATCGAAGTCTCGCAGTGCCTCGTCGTTGCCCTC
CTCCTCGCCTTCAACGACTGTCTCTATCTTCTCACCCCTTACCCCCATCCAGCCACCGACTCGCATCTCTTCTCT
CTATATTTTCTTCTCCCCTGGATCGGCGTCTCTTTGGCTCTACTCTGCCACAACTGGTATCCCGCAAACGTCTTC
GTCGGCGACACCTATTGTTACTTTTCCGGCATGGTCTTTGCCGTCGTTGGCATCCTCGGCCATTTTTCCAAGACC
CTCGGTCTCTTGCTTGTTCCTCAAATCTTCAACTTTGTCTACTCGTGCCCTCAGATCTTTGGTCTTATTCCCTGT
CCACGCCACCGACTGCCCAGCTTCAATGCCACTTCTGGCCTCCTCCAGCCCTCTGTCACCTCGTGGCCCCCCGGA
CGTCAGCCACATCCCCTCGTTGCTCAGGCTCTCTACATCCTGGACCGATTACGTCTTGTACGTCTTGTTACTGAT
GACAAGGGCCACATTGTCCAAACTACCAACCTGACCATTATCAATCTCTGGCTCGTCTGGCGTGGGCCCTTGCGC
GAGGACCGCCTCGCCTGGGAACTAACCCTGGTGCAGCTAATTGTCGGCCTCTTTGGTCTCTTTGCCAGGCATCGT
CTTGCCCTTCTTGTCTTTAAGGAAGACAATTGGGGCACACCACAGTCTTGA
Gene >OphauB2|5945
ATGGCATACCCAACCACGCTCTCCTTGGCCGAGTCGCTGGGCCTCGGCTCCCTTTCCGCAGCTGCCTTTGCCGTC
GCCGCAGCAAACACGCTCCATGGCGACGGCGAGCCTCTAGTCGCCCTCGTGGCCCTGTCCACTGCCGCCTTTGCC
CTGTGCTACGCCATGATTCGATGGCTGGGCCCAACCTTTGTCCAGGCCGGTCTGCGTGGCCGCGACTTGAGCAAG
GCGACGCGCCCCGAGATTCCAGAGTGCATGGGCGCCGTCTGTGCTGCCGTCTACCTGCTGACCGTCATCGTCTTT
GTCCCCTTTCCCTTTTACAAGGACATTGTCGCCGCCACGAGCGGTGGCGGAAATCGCGACGTCGTTGTCGAGATT
CACCACGTCAACCAAGGTCGCTTCCTGCACCGCTTCCCCCACAACAAGGTGTGTCCTGCTTTGCTCCACTCCACG
GCCCATCTCTGCTCGGGGCCTGCTGACATGACCAGCTTGCCTCGTATCTCAGCGCCATCATCTCTCTCCAGACCA
TTGCCCTGCTCGGCATCGGCGACGACCTCTTTGACATTCGCTGGCGTCACAAGTGGTGGATTCCCGGTCTGGCCT
GCATCCCCCTGCTCGTTGTCTACTTTGTCGACTTTGATGTCACCTCGATTGTCATTCCTCTGCAGCTGCAGCCCT
ATCTCGGCCAGCTCTTCGACCTCGGCGCCCTCTACTACGTCTACATGGCTTGCGTCGCCATGTTCTGTCCCCAGA
GCATCAACATGTTTGCTGGCATCAACGGCATCGAAGTCTCGCAGTGCCTCGTCGTTGCCCTCCTCCTCGCCTTCA
ACGACTGTCTCTATCTTCTCACCCCTTACCCCCATCCAGCCACCGACTCGCATCTCTTCTCTCTATATTTTCTTC
TCCCCTGGATCGGCGTCTCTTTGGCTCTACTCTGCCACAACTGGTATCCCGCAAACGTCTTCGTCGGCGACACCT
ATTGTTACTTTTCCGGCATGGTCTTTGCCGTCGTTGGCATCCTCGGCCATTTTTCCAAGACCCTCGGTCTCTTGC
TTGTTCCTCAAATCTTCAACTTTGTCTACTCGTGCCCTCAGATCTTTGGTCTTATTCCCTGTCCACGCCACCGAC
TGCCCAGCTTCAATGCCACTTCTGGCCTCCTCCAGCCCTCTGTCACCTCGTGGCCCCCCGGACGTCAGCCACATC
CCCTCGTTGCTCAGGCTCTCTACATCCTGGACCGATTACGTCTTGTACGTCTTGTTACTGATGACAAGGGCCACA
TTGTCCAAACTACCAACCTGACCATTATCAATCTCTGGCTCGTCTGGCGTGGGCCCTTGCGCGAGGACCGCCTCG
CCTGGGAACTAACCCTGGTGCAGCTAATTGTCGGCCTCTTTGGTCTCTTTGCCAGGCATCGTCTTGCCCTTCTTG
TCTTTAAGGAAGACAATTGGGGCACACCACAGTCTTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail