Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|594
Gene name
LocationContig_11:196223..197217
Strand-
Gene length (bp)994
Transcript length (bp)927
Coding sequence length (bp)927
Protein length (aa) 309

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00106 adh_short short chain dehydrogenase 2.1E-28 33 230
PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase 9.6E-21 39 232
PF08659 KR KR domain 4.2E-15 35 155
PF02719 Polysacc_synt_2 Polysaccharide biosynthesis protein 2.1E-08 35 156
PF01370 Epimerase NAD dependent epimerase/dehydratase family 1.5E-07 35 215

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P31808|YCIK_ECOLI Uncharacterized oxidoreductase YciK OS=Escherichia coli (strain K12) GN=yciK PE=1 SV=3 33 225 2.0E-19
sp|Q9X248|FABG_THEMA 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=fabG PE=3 SV=1 28 263 1.0E-15
sp|Q05016|YM71_YEAST NADP-dependent 3-hydroxy acid dehydrogenase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YMR226C PE=1 SV=1 33 224 3.0E-13
sp|Q8R536|SPRE_MERUN Sepiapterin reductase OS=Meriones unguiculatus GN=SPR PE=2 SV=1 34 233 1.0E-12
sp|Q8RJB2|BZRD_BACCE Benzil reductase ((S)-benzoin forming) OS=Bacillus cereus GN=yueD PE=1 SV=1 33 262 2.0E-12
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P31808|YCIK_ECOLI Uncharacterized oxidoreductase YciK OS=Escherichia coli (strain K12) GN=yciK PE=1 SV=3 33 225 2.0E-19
sp|Q9X248|FABG_THEMA 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=fabG PE=3 SV=1 28 263 1.0E-15
sp|Q05016|YM71_YEAST NADP-dependent 3-hydroxy acid dehydrogenase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YMR226C PE=1 SV=1 33 224 3.0E-13
sp|Q8R536|SPRE_MERUN Sepiapterin reductase OS=Meriones unguiculatus GN=SPR PE=2 SV=1 34 233 1.0E-12
sp|Q8RJB2|BZRD_BACCE Benzil reductase ((S)-benzoin forming) OS=Bacillus cereus GN=yueD PE=1 SV=1 33 262 2.0E-12
sp|Q4A054|Y0419_STAS1 Uncharacterized oxidoreductase SSP0419 OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=SSP0419 PE=3 SV=1 31 224 3.0E-12
sp|P25145|Y432_LISMO Uncharacterized oxidoreductase Lmo0432 OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=lmo0432 PE=3 SV=2 28 223 7.0E-12
sp|P9WGR7|Y945_MYCTU Uncharacterized oxidoreductase Rv0945 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv0945 PE=1 SV=1 35 230 1.0E-11
sp|P9WGR6|Y945_MYCTO Uncharacterized oxidoreductase MT0971 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT0971 PE=3 SV=1 35 230 1.0E-11
sp|Q9P7B4|YI13_SCHPO NADP-dependent 3-hydroxy acid dehydrogenase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC521.03 PE=1 SV=1 32 224 1.0E-11
sp|Q92EK7|Y452_LISIN Uncharacterized oxidoreductase Lin0452 OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=lin0452 PE=3 SV=1 28 223 1.0E-11
sp|P07999|DHGB_BACME Glucose 1-dehydrogenase B OS=Bacillus megaterium GN=gdhB PE=1 SV=2 31 264 1.0E-11
sp|P12310|DHG_BACSU Glucose 1-dehydrogenase OS=Bacillus subtilis (strain 168) GN=gdh PE=2 SV=2 31 264 8.0E-11
sp|P0C0Y4|MTDH_ALTAL Probable NADP-dependent mannitol dehydrogenase OS=Alternaria alternata PE=1 SV=2 28 224 1.0E-10
sp|Q7Q732|DHRS7_ANOGA Dehydrogenase/reductase SDR family protein 7-like OS=Anopheles gambiae GN=AGAP005532 PE=3 SV=3 32 239 1.0E-10
sp|P0A0I0|FABG_STAAW 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Staphylococcus aureus (strain MW2) GN=fabG PE=3 SV=1 33 258 2.0E-10
sp|Q6G9Y2|FABG_STAAS 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Staphylococcus aureus (strain MSSA476) GN=fabG PE=3 SV=1 33 258 2.0E-10
sp|Q6GHK4|FABG_STAAR 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Staphylococcus aureus (strain MRSA252) GN=fabG PE=3 SV=1 33 258 2.0E-10
sp|P99093|FABG_STAAN 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Staphylococcus aureus (strain N315) GN=fabG PE=1 SV=1 33 258 2.0E-10
sp|P0A0H9|FABG_STAAM 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=fabG PE=1 SV=1 33 258 2.0E-10
sp|Q5HGK2|FABG_STAAC 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Staphylococcus aureus (strain COL) GN=fabG PE=3 SV=2 33 258 2.0E-10
sp|Q9STY7|HSD3_ARATH 11-beta-hydroxysteroid dehydrogenase-like 3 OS=Arabidopsis thaliana GN=HSD3 PE=3 SV=1 33 224 2.0E-10
sp|Q9STY8|HSD2_ARATH 11-beta-hydroxysteroid dehydrogenase-like 2 OS=Arabidopsis thaliana GN=HSD2 PE=2 SV=1 32 224 3.0E-10
sp|A0R518|Y6031_MYCS2 Putative short-chain type dehydrogenase/reductase MSMEG_6031/MSMEI_5872 OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=MSMEG_6031 PE=1 SV=1 31 221 4.0E-10
sp|Q8CPI3|FABG_STAES 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Staphylococcus epidermidis (strain ATCC 12228) GN=fabG PE=3 SV=1 33 232 5.0E-10
sp|Q5HPW0|FABG_STAEQ 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=fabG PE=3 SV=1 33 232 5.0E-10
sp|P40288|DHG_BACME Glucose 1-dehydrogenase OS=Bacillus megaterium PE=1 SV=1 31 264 7.0E-10
sp|P55541|Y4LA_RHISN Uncharacterized short-chain type dehydrogenase/reductase y4lA OS=Rhizobium sp. (strain NGR234) GN=NGR_a02730 PE=3 SV=1 31 263 8.0E-10
sp|A0PJE2|DHR12_HUMAN Dehydrogenase/reductase SDR family member 12 OS=Homo sapiens GN=DHRS12 PE=2 SV=2 8 221 8.0E-10
sp|P39483|DHG2_BACME Glucose 1-dehydrogenase 2 OS=Bacillus megaterium GN=gdhII PE=3 SV=1 31 226 2.0E-09
sp|Q45219|Y2146_BRADU Probable short-chain type dehydrogenase/reductase blr2146 OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=blr2146 PE=3 SV=2 31 263 3.0E-09
sp|P33207|FABG_ARATH 3-oxoacyl-[acyl-carrier-protein] reductase, chloroplastic OS=Arabidopsis thaliana GN=At1g24360 PE=1 SV=2 4 229 4.0E-09
sp|Q17QK8|SPRE_BOVIN Sepiapterin reductase OS=Bos taurus GN=SPR PE=2 SV=1 34 231 4.0E-09
sp|Q3T0R4|DRS7B_BOVIN Dehydrogenase/reductase SDR family member 7B OS=Bos taurus GN=DHRS7B PE=2 SV=1 31 224 4.0E-09
sp|Q59787|DHSO_RHOSH Sorbitol dehydrogenase OS=Rhodobacter sphaeroides GN=polS PE=1 SV=1 28 258 6.0E-09
sp|Q9S9W2|SDRA_ARATH Short-chain dehydrogenase/reductase SDRA OS=Arabidopsis thaliana GN=SDRA PE=1 SV=1 31 242 6.0E-09
sp|Q8VCR2|DHB13_MOUSE 17-beta-hydroxysteroid dehydrogenase 13 OS=Mus musculus GN=Hsd17b13 PE=1 SV=2 29 205 7.0E-09
sp|P18297|SPRE_RAT Sepiapterin reductase OS=Rattus norvegicus GN=Spr PE=1 SV=1 34 233 1.0E-08
sp|P39482|DHG1_BACME Glucose 1-dehydrogenase 1 OS=Bacillus megaterium GN=gdhI PE=2 SV=1 31 264 1.0E-08
sp|A6QP05|DHR12_BOVIN Dehydrogenase/reductase SDR family member 12 OS=Bos taurus GN=DHRS12 PE=2 SV=1 8 221 1.0E-08
sp|Q84ST4|NOL_ORYSJ Chlorophyll(ide) b reductase NOL, chloroplastic OS=Oryza sativa subsp. japonica GN=NOL PE=1 SV=1 35 248 1.0E-08
sp|Q9Y140|DHRS7_DROME Dehydrogenase/reductase SDR family protein 7-like OS=Drosophila melanogaster GN=CG7601 PE=2 SV=1 32 224 1.0E-08
sp|Q5FPE5|GMDH_GLUOX Glucose 1-dehydrogenase OS=Gluconobacter oxydans (strain 621H) GN=GOX2015 PE=1 SV=1 32 224 2.0E-08
sp|Q9VLU5|WWOX_DROME WW domain-containing oxidoreductase OS=Drosophila melanogaster GN=Wwox PE=2 SV=1 32 230 2.0E-08
sp|Q949M3|FABG3_BRANA 3-oxoacyl-[acyl-carrier-protein] reductase 3, chloroplastic OS=Brassica napus GN=bkr3 PE=2 SV=1 34 258 2.0E-08
sp|Q9MA93|GRDH2_ARATH Glucose and ribitol dehydrogenase homolog 2 OS=Arabidopsis thaliana GN=At3g05260 PE=2 SV=1 25 217 2.0E-08
sp|O14351|YB45_SCHPO Uncharacterized oxidoreductase C30D10.05c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC30D10.05c PE=3 SV=1 29 227 2.0E-08
sp|Q988B7|PLDH_RHILO Pyridoxal 4-dehydrogenase OS=Rhizobium loti (strain MAFF303099) GN=pldh-t PE=1 SV=1 32 221 2.0E-08
sp|Q93X62|FABG1_BRANA 3-oxoacyl-[acyl-carrier-protein] reductase 1, chloroplastic OS=Brassica napus GN=gbkr1 PE=1 SV=1 34 258 3.0E-08
sp|P39484|DHG3_BACME Glucose 1-dehydrogenase 3 OS=Bacillus megaterium GN=gdhIII PE=3 SV=1 31 226 3.0E-08
sp|P40580|BZRD_YEAST Benzil reductase ((S)-benzoin forming) IRC24 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=IRC24 PE=1 SV=1 32 230 4.0E-08
sp|P0DKC6|HSD1B_ARATH 11-beta-hydroxysteroid dehydrogenase 1B OS=Arabidopsis thaliana GN=HSD1 PE=1 SV=1 32 224 4.0E-08
sp|P0DKC5|HSD1A_ARATH 11-beta-hydroxysteroid dehydrogenase 1A OS=Arabidopsis thaliana GN=HSD1 PE=1 SV=1 32 224 4.0E-08
sp|P0AEK3|FABG_SHIFL 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Shigella flexneri GN=fabG PE=3 SV=1 28 232 4.0E-08
sp|P0AEK2|FABG_ECOLI 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Escherichia coli (strain K12) GN=fabG PE=1 SV=1 28 232 4.0E-08
sp|Q93X68|FABG5_BRANA 3-oxoacyl-[acyl-carrier-protein] reductase 5, chloroplastic (Fragment) OS=Brassica napus GN=bkr1 PE=2 SV=1 34 229 4.0E-08
sp|P0A2D1|UCPA_SALTY Oxidoreductase UcpA OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=ucpA PE=3 SV=1 32 231 6.0E-08
sp|P0A2D2|UCPA_SALTI Oxidoreductase UcpA OS=Salmonella typhi GN=ucpA PE=3 SV=1 32 231 6.0E-08
sp|Q93X67|FABG2_BRANA 3-oxoacyl-[acyl-carrier-protein] reductase 2, chloroplastic OS=Brassica napus GN=bkr2 PE=2 SV=1 34 258 7.0E-08
sp|P9WGS7|Y0687_MYCTU Uncharacterized NAD-dependent oxidoreductase Rv0687 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv0687 PE=1 SV=1 29 223 7.0E-08
sp|P9WGS6|Y0687_MYCTO Uncharacterized NAD-dependent oxidoreductase MT0715 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT0715 PE=3 SV=1 29 223 7.0E-08
sp|Q8LEU3|NOL_ARATH Chlorophyll(ide) b reductase NOL, chloroplastic OS=Arabidopsis thaliana GN=NOL PE=1 SV=1 35 253 8.0E-08
sp|Q5HLD8|Y2049_STAEQ Uncharacterized oxidoreductase SERP2049 OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=SERP2049 PE=3 SV=1 31 224 8.0E-08
sp|Q8CN40|Y2036_STAES Uncharacterized oxidoreductase SE_2036 OS=Staphylococcus epidermidis (strain ATCC 12228) GN=SE_2036 PE=3 SV=1 31 224 8.0E-08
sp|Q8XBJ4|UCPA_ECO57 Oxidoreductase UcpA OS=Escherichia coli O157:H7 GN=ucpA PE=3 SV=2 32 231 8.0E-08
sp|P37440|UCPA_ECOLI Oxidoreductase UcpA OS=Escherichia coli (strain K12) GN=ucpA PE=3 SV=3 32 231 8.0E-08
sp|Q5P5I4|PED_AROAE (S)-1-Phenylethanol dehydrogenase OS=Aromatoleum aromaticum (strain EbN1) GN=ped PE=1 SV=1 31 224 9.0E-08
sp|O42866|FABG_SCHPO 3-oxoacyl-[acyl-carrier-protein] reductase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=oar2 PE=3 SV=1 33 236 1.0E-07
sp|P35270|SPRE_HUMAN Sepiapterin reductase OS=Homo sapiens GN=SPR PE=1 SV=1 34 231 1.0E-07
sp|Q9KQH7|FABG_VIBCH 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=fabG PE=1 SV=2 28 258 1.0E-07
sp|Q9ZNN8|BUDC_CORGT L-2,3-butanediol dehydrogenase OS=Corynebacterium glutamicum GN=budC PE=1 SV=1 33 236 1.0E-07
sp|Q53882|DNRE_STRS5 Aklaviketone reductase DauE OS=Streptomyces sp. (strain C5) GN=dauE PE=1 SV=1 33 257 1.0E-07
sp|Q64105|SPRE_MOUSE Sepiapterin reductase OS=Mus musculus GN=Spr PE=1 SV=1 34 234 1.0E-07
sp|Q5NVG2|DHB11_PONAB Estradiol 17-beta-dehydrogenase 11 OS=Pongo abelii GN=HSD17B11 PE=2 SV=1 29 221 1.0E-07
sp|P10528|DHGA_BACME Glucose 1-dehydrogenase A OS=Bacillus megaterium GN=gdhA PE=3 SV=1 31 226 1.0E-07
sp|P39485|DHG4_BACME Glucose 1-dehydrogenase 4 OS=Bacillus megaterium GN=gdhIV PE=1 SV=1 31 226 1.0E-07
sp|P80873|GS39_BACSU General stress protein 39 OS=Bacillus subtilis (strain 168) GN=ydaD PE=1 SV=3 31 238 1.0E-07
sp|Q8NBQ5|DHB11_HUMAN Estradiol 17-beta-dehydrogenase 11 OS=Homo sapiens GN=HSD17B11 PE=1 SV=3 29 221 2.0E-07
sp|P87219|SOU1_CANAL Sorbose reductase SOU1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SOU1 PE=1 SV=1 19 224 2.0E-07
sp|Q5M875|DHB13_RAT 17-beta-hydroxysteroid dehydrogenase 13 OS=Rattus norvegicus GN=Hsd17b13 PE=1 SV=1 25 205 2.0E-07
sp|O07575|YHDF_BACSU Uncharacterized oxidoreductase YhdF OS=Bacillus subtilis (strain 168) GN=yhdF PE=3 SV=1 31 217 2.0E-07
sp|P51831|FABG_BACSU 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Bacillus subtilis (strain 168) GN=fabG PE=3 SV=3 33 232 2.0E-07
sp|Q8MJY8|PGDH_MACFA 15-hydroxyprostaglandin dehydrogenase [NAD(+)] OS=Macaca fascicularis GN=HPGD PE=2 SV=1 28 233 2.0E-07
sp|P22414|FOX2_CANTR Peroxisomal hydratase-dehydrogenase-epimerase OS=Candida tropicalis PE=1 SV=2 8 224 3.0E-07
sp|Q949M2|FABG4_BRANA 3-oxoacyl-[acyl-carrier-protein] reductase 4 (Fragment) OS=Brassica napus GN=bkr4 PE=2 SV=1 34 258 3.0E-07
sp|P55575|Y4MP_RHISN Uncharacterized short-chain type dehydrogenase/reductase y4mP OS=Rhizobium sp. (strain NGR234) GN=NGR_a02430 PE=3 SV=1 31 224 3.0E-07
sp|Q9FZ42|GRDH1_ARATH Glucose and ribitol dehydrogenase homolog 1 OS=Arabidopsis thaliana GN=At1g54870 PE=2 SV=1 25 217 4.0E-07
sp|Q56840|HCDR_XANP2 2-(R)-hydroxypropyl-CoM dehydrogenase OS=Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2) GN=xecD PE=1 SV=3 33 224 4.0E-07
sp|Q6CEE9|SDR_YARLI Probable NADP-dependent mannitol dehydrogenase OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0B16192g PE=1 SV=1 28 232 4.0E-07
sp|P66780|Y1570_MYCBO Uncharacterized oxidoreductase Mb1570 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=Mb1570 PE=3 SV=1 2 234 4.0E-07
sp|P9WGS1|Y1543_MYCTU Uncharacterized oxidoreductase Rv1543 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv1543 PE=1 SV=1 2 234 4.0E-07
sp|P9WGS0|Y1543_MYCTO Uncharacterized oxidoreductase MT1595 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT1595 PE=3 SV=1 2 234 4.0E-07
sp|Q7TQA3|RDHE2_MOUSE Epidermal retinol dehydrogenase 2 OS=Mus musculus GN=Sdr16c5 PE=2 SV=1 24 234 5.0E-07
sp|Q5KTS5|GRDH_DAUCA Glucose and ribitol dehydrogenase OS=Daucus carota GN=CAISE5 PE=2 SV=1 25 217 5.0E-07
sp|O34782|YVRD_BACSU Uncharacterized oxidoreductase YvrD OS=Bacillus subtilis (strain 168) GN=yvrD PE=3 SV=1 28 217 5.0E-07
sp|Q9ERI6|RDH14_MOUSE Retinol dehydrogenase 14 OS=Mus musculus GN=Rdh14 PE=1 SV=1 32 227 5.0E-07
sp|Q94KL7|SILD_FORIN Secoisolariciresinol dehydrogenase (Fragment) OS=Forsythia intermedia PE=1 SV=1 31 228 6.0E-07
sp|Q02207|FOX2_YEAST Peroxisomal hydratase-dehydrogenase-epimerase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FOX2 PE=2 SV=1 27 216 6.0E-07
sp|Q6AYS8|DHB11_RAT Estradiol 17-beta-dehydrogenase 11 OS=Rattus norvegicus GN=Hsd17b11 PE=2 SV=1 29 221 7.0E-07
sp|Q46381|BPHB_COMTE Cis-2,3-dihydrobiphenyl-2,3-diol dehydrogenase OS=Comamonas testosteroni GN=bphB PE=1 SV=1 28 223 7.0E-07
sp|P15428|PGDH_HUMAN 15-hydroxyprostaglandin dehydrogenase [NAD(+)] OS=Homo sapiens GN=HPGD PE=1 SV=1 28 233 7.0E-07
sp|Q73SC8|Y4146_MYCPA Uncharacterized NAD-dependent oxidoreductase MAP_4146 OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=MAP_4146 PE=1 SV=1 29 223 8.0E-07
sp|Q9Y6Z9|SOU1_SCHPO Sorbose reductase sou1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sou1 PE=3 SV=1 28 224 8.0E-07
sp|Q9EQ06|DHB11_MOUSE Estradiol 17-beta-dehydrogenase 11 OS=Mus musculus GN=Hsd17b11 PE=1 SV=1 29 221 9.0E-07
sp|Q8N3Y7|RDHE2_HUMAN Epidermal retinol dehydrogenase 2 OS=Homo sapiens GN=SDR16C5 PE=2 SV=2 25 223 9.0E-07
sp|P28643|FABG_CUPLA 3-oxoacyl-[acyl-carrier-protein] reductase, chloroplastic OS=Cuphea lanceolata GN=CLKR27 PE=2 SV=1 29 227 9.0E-07
sp|P87218|SOU2_CANAL Sorbose reductase homolog SOU2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SOU2 PE=3 SV=2 27 224 1.0E-06
sp|Q9RA05|LIMC_RHOER (-)-trans-carveol dehydrogenase OS=Rhodococcus erythropolis GN=limC PE=1 SV=1 31 223 1.0E-06
sp|P0A2C9|FABG_SALTY 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=fabG PE=1 SV=1 28 232 1.0E-06
sp|P0A2D0|FABG_SALTI 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Salmonella typhi GN=fabG PE=3 SV=1 28 232 1.0E-06
sp|P47230|BPHB_RHOGO Cis-2,3-dihydrobiphenyl-2,3-diol dehydrogenase OS=Rhodococcus globerulus GN=bphB PE=3 SV=1 28 219 1.0E-06
sp|Q53217|Y4VI_RHISN Uncharacterized short-chain type dehydrogenase/reductase y4vI OS=Rhizobium sp. (strain NGR234) GN=NGR_a01150 PE=3 SV=2 32 233 1.0E-06
sp|O74959|YJCD_SCHPO Uncharacterized oxidoreductase C736.13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC736.13 PE=3 SV=1 32 224 1.0E-06
sp|Q556J2|KDSR_DICDI 3-ketodihydrosphingosine reductase OS=Dictyostelium discoideum GN=ksrA-1 PE=3 SV=1 25 205 2.0E-06
sp|Q7Z9I4|YCP6_SCHPO Uncharacterized oxidoreductase C663.06c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC663.06c PE=3 SV=1 28 221 2.0E-06
sp|Q53877|DNRU_STRS5 Putative daunorubicin C-13 ketoreductase DnrU OS=Streptomyces sp. (strain C5) PE=3 SV=1 17 258 2.0E-06
sp|Q05528|KDUD_DICD3 2-dehydro-3-deoxy-D-gluconate 5-dehydrogenase OS=Dickeya dadantii (strain 3937) GN=kduD PE=1 SV=2 27 227 2.0E-06
sp|G0RH19|LXR3_HYPJQ L-xylulose reductase OS=Hypocrea jecorina (strain QM6a) GN=lxr3 PE=1 SV=1 15 224 2.0E-06
sp|Q3KPT7|BDH2_XENLA 3-hydroxybutyrate dehydrogenase type 2 OS=Xenopus laevis GN=bdh2 PE=2 SV=1 32 221 2.0E-06
sp|P55336|FABG_VIBHA 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Vibrio harveyi GN=fabG PE=3 SV=1 28 258 2.0E-06
sp|P50206|BPHB_PSES1 Cis-2,3-dihydrobiphenyl-2,3-diol dehydrogenase OS=Pseudomonas sp. (strain KKS102) GN=bphB PE=3 SV=1 28 223 3.0E-06
sp|Q3T0C2|PGDH_BOVIN 15-hydroxyprostaglandin dehydrogenase [NAD(+)] OS=Bos taurus GN=HPGD PE=2 SV=1 28 233 3.0E-06
sp|Q4WZ66|CHADH_ASPFU Chanoclavine-I dehydrogenase OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=fgaDH PE=3 SV=1 29 240 3.0E-06
sp|D3J0Z1|CHADH_ASPFM Chanoclavine-I dehydrogenase OS=Neosartorya fumigata GN=fgaDH PE=1 SV=1 29 240 3.0E-06
sp|P9WGR5|Y484_MYCTU Uncharacterized oxidoreductase Rv0484c OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv0484c PE=1 SV=1 27 224 3.0E-06
sp|P9WGR4|Y484_MYCTO Uncharacterized oxidoreductase MT0502 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT0502 PE=3 SV=1 27 224 3.0E-06
sp|Q4JK73|DHB11_MACFA Estradiol 17-beta-dehydrogenase 11 OS=Macaca fascicularis GN=HSD17B11 PE=2 SV=1 29 221 3.0E-06
sp|Q96NR8|RDH12_HUMAN Retinol dehydrogenase 12 OS=Homo sapiens GN=RDH12 PE=1 SV=3 32 223 3.0E-06
sp|Q9QYF1|RDH11_MOUSE Retinol dehydrogenase 11 OS=Mus musculus GN=Rdh11 PE=1 SV=2 32 224 3.0E-06
sp|Q9ZAU1|DNRU_STRPE Putative daunorubicin C-13 ketoreductase DnrU OS=Streptomyces peucetius GN=dnrU PE=3 SV=1 26 258 4.0E-06
sp|O32229|YVAG_BACSU Uncharacterized oxidoreductase YvaG OS=Bacillus subtilis (strain 168) GN=yvaG PE=3 SV=1 28 217 4.0E-06
sp|P46331|YXBG_BACSU Uncharacterized oxidoreductase YxbG OS=Bacillus subtilis (strain 168) GN=yxbG PE=3 SV=2 31 236 5.0E-06
sp|P50198|LINX_SPHPI 2,5-dichloro-2,5-cyclohexadiene-1,4-diol dehydrogenase OS=Sphingomonas paucimobilis GN=linX PE=3 SV=1 32 258 5.0E-06
sp|Q8CQD2|BUTA_STAES Diacetyl reductase [(S)-acetoin forming] OS=Staphylococcus epidermidis (strain ATCC 12228) GN=butA PE=3 SV=1 33 223 5.0E-06
sp|Q9PKF7|FABG_CHLMU 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Chlamydia muridarum (strain MoPn / Nigg) GN=fabG PE=3 SV=1 33 232 5.0E-06
sp|Q05A13|S16C6_MOUSE Short-chain dehydrogenase/reductase family 16C member 6 OS=Mus musculus GN=Sdr16c6 PE=2 SV=1 32 223 5.0E-06
sp|P16542|DHK1_STRVN Granaticin polyketide synthase putative ketoacyl reductase 1 OS=Streptomyces violaceoruber GN=gra-orf5 PE=3 SV=1 34 259 6.0E-06
sp|Q9LBG2|LVR_LEIAQ Levodione reductase OS=Leifsonia aquatica GN=lvr PE=1 SV=1 24 223 6.0E-06
sp|P0C0Y5|MTDH_DAVTA Probable NADP-dependent mannitol dehydrogenase OS=Davidiella tassiana PE=1 SV=1 28 241 6.0E-06
sp|P50199|GNO_GLUOX Gluconate 5-dehydrogenase OS=Gluconobacter oxydans (strain 621H) GN=gno PE=1 SV=1 24 227 7.0E-06
sp|Q7Z9I3|YCP8_SCHPO Uncharacterized oxidoreductase C663.08c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC663.08c PE=3 SV=1 28 227 8.0E-06
sp|Q9WYG0|Y325_THEMA Uncharacterized oxidoreductase TM_0325 OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=TM_0325 PE=3 SV=1 28 217 9.0E-06
sp|C1C4R8|BDH2_LITCT 3-hydroxybutyrate dehydrogenase type 2 OS=Lithobates catesbeiana GN=bdh2 PE=2 SV=1 32 221 9.0E-06
sp|P37959|YUSZ_BACSU Uncharacterized oxidoreductase YusZ OS=Bacillus subtilis (strain 168) GN=yusZ PE=3 SV=2 33 205 9.0E-06
sp|Q17QU7|DHR13_BOVIN Dehydrogenase/reductase SDR family member 13 OS=Bos taurus GN=DHRS13 PE=2 SV=1 23 122 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0050662 coenzyme binding Yes
GO:0003824 catalytic activity Yes
GO:0005488 binding No
GO:0003674 molecular_function No
GO:0048037 cofactor binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 50 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|594
MAGQQPPSYTKVTHSATYPAINPSQPSLSTKGKVILITGASGGIGRSTACSFAVSGPRALVLLGRRSDALAETEK
LVKAKNGNVTVQTHAVDLCDAAGVRSVFEKVVSEFGAIDVLLHCAGVLAPVVPLVEADPATFMDGYKTTVVGTLV
VAQALVLANKAGSAKELTFVNLTTAGIFFPPFPGMGAYVSSKMAAVKLLQSFAAENPNVRMHNVHPGFLDTAMSA
QLSKTTKLPFGFDDISLPSDYLVWIVSPEADFLRNKLVFTAWDVDELKTRQKEIVGGPPGTGELWLNFSGFPRYV
GGNLLPGA*
Coding >OphauB2|594
ATGGCCGGCCAACAGCCCCCCTCGTACACCAAGGTGACGCACTCGGCCACCTATCCCGCCATCAACCCCAGCCAG
CCCAGCCTCTCCACCAAGGGCAAGGTTATCCTCATCACGGGCGCGTCTGGAGGCATTGGGCGCTCCACGGCGTGC
TCCTTTGCCGTGTCTGGCCCTCGCGCCCTGGTGCTGCTTGGGCGGCGCAGCGACGCGCTGGCGGAGACGGAGAAG
CTGGTCAAGGCCAAGAATGGCAACGTGACGGTGCAGACACACGCGGTTGACCTGTGCGACGCGGCGGGCGTGCGC
AGTGTCTTTGAAAAGGTCGTGAGCGAGTTTGGCGCCATTGACGTGTTGCTGCACTGCGCGGGTGTTTTGGCGCCC
GTGGTGCCGCTCGTCGAAGCTGACCCGGCCACCTTTATGGACGGCTACAAGACGACGGTTGTGGGCACCCTCGTG
GTGGCGCAGGCGCTCGTGCTGGCCAACAAGGCGGGCAGCGCAAAGGAGCTGACCTTTGTCAATCTCACCACGGCC
GGCATCTTTTTCCCCCCGTTTCCCGGCATGGGCGCCTATGTCAGCAGCAAGATGGCTGCCGTCAAGCTGCTGCAG
TCGTTTGCCGCTGAGAATCCCAACGTGCGCATGCATAATGTGCATCCGGGCTTCCTCGACACCGCCATGTCGGCC
CAGCTGTCCAAGACGACCAAGCTGCCCTTTGGCTTTGACGATATTTCTCTTCCATCCGACTATCTGGTCTGGATC
GTCTCACCAGAGGCAGACTTTCTCCGCAACAAGCTCGTCTTTACCGCGTGGGATGTGGATGAGCTCAAGACCCGC
CAGAAGGAGATTGTTGGCGGCCCGCCAGGAACGGGTGAGCTGTGGTTGAACTTTTCCGGCTTCCCGCGCTACGTT
GGCGGCAACCTGTTGCCTGGTGCTTGA
Transcript >OphauB2|594
ATGGCCGGCCAACAGCCCCCCTCGTACACCAAGGTGACGCACTCGGCCACCTATCCCGCCATCAACCCCAGCCAG
CCCAGCCTCTCCACCAAGGGCAAGGTTATCCTCATCACGGGCGCGTCTGGAGGCATTGGGCGCTCCACGGCGTGC
TCCTTTGCCGTGTCTGGCCCTCGCGCCCTGGTGCTGCTTGGGCGGCGCAGCGACGCGCTGGCGGAGACGGAGAAG
CTGGTCAAGGCCAAGAATGGCAACGTGACGGTGCAGACACACGCGGTTGACCTGTGCGACGCGGCGGGCGTGCGC
AGTGTCTTTGAAAAGGTCGTGAGCGAGTTTGGCGCCATTGACGTGTTGCTGCACTGCGCGGGTGTTTTGGCGCCC
GTGGTGCCGCTCGTCGAAGCTGACCCGGCCACCTTTATGGACGGCTACAAGACGACGGTTGTGGGCACCCTCGTG
GTGGCGCAGGCGCTCGTGCTGGCCAACAAGGCGGGCAGCGCAAAGGAGCTGACCTTTGTCAATCTCACCACGGCC
GGCATCTTTTTCCCCCCGTTTCCCGGCATGGGCGCCTATGTCAGCAGCAAGATGGCTGCCGTCAAGCTGCTGCAG
TCGTTTGCCGCTGAGAATCCCAACGTGCGCATGCATAATGTGCATCCGGGCTTCCTCGACACCGCCATGTCGGCC
CAGCTGTCCAAGACGACCAAGCTGCCCTTTGGCTTTGACGATATTTCTCTTCCATCCGACTATCTGGTCTGGATC
GTCTCACCAGAGGCAGACTTTCTCCGCAACAAGCTCGTCTTTACCGCGTGGGATGTGGATGAGCTCAAGACCCGC
CAGAAGGAGATTGTTGGCGGCCCGCCAGGAACGGGTGAGCTGTGGTTGAACTTTTCCGGCTTCCCGCGCTACGTT
GGCGGCAACCTGTTGCCTGGTGCTTGA
Gene >OphauB2|594
ATGGCCGGCCAACAGCCCCCCTCGTACACCAAGGTGACGCACTCGGCCACCTATCCCGCCATCAACCCCAGCCAG
CCCAGCCTCTCCACCAAGGGCAAGGTTATCCTCATCACGGGCGCGTCTGGAGGCATTGGGCGCTCCACGGCGTGC
TCCTTTGCCGTGTCTGGCCCTCGCGCCCTGGTGCTGCTTGGGCGGCGCAGCGACGCGCTGGCGGAGACGGAGAAG
CTGGTCAAGGCCAAGAATGGCAACGTGACGGTGCAGACACACGCGGTTGACCTGTGCGACGCGGCGGGCGTGCGC
AGTGTCTTTGAAAAGGTCGTGAGCGAGTTTGGCGCCATTGACGTGTTGCTGCACTGCGCGGGTGTTTTGGCGCCC
GTGGTGCCGCTCGTCGAAGCTGACCCGGCCACCTTTATGGACGGCTACAAGACGACGGTTGTGGGCACCCTCGTG
GTGGCGCAGGCGCTCGTGCTGGCCAACAAGGCGGGCAGCGCAAAGGAGCTGACCTTTGTCAATCTCACCACGGCC
GGCATCTTTTTCCCCCCGTTTCCCGGCATGGGCGCCTATGTCAGCAGCAAGATGGCTGCCGTCAAGCTGCTGCAG
TCGTTTGCCGCTGAGAATCCCAACGTGCGCATGCATAATGTGCATCCGGGCTTCCTCGACACCGCCATGTCGGCC
CAGCTGTCCAAGACGACCAAGCTGCCCTTTGGCTTTGACGATAGTAAGTATGAATGCAGCATGTTTGACCATGGG
GGAAAAAGACTGACCCTTGGGTGTTTTTTTTGCAGTTTCTCTTCCATCCGACTATCTGGTCTGGATCGTCTCACC
AGAGGCAGACTTTCTCCGCAACAAGCTCGTCTTTACCGCGTGGGATGTGGATGAGCTCAAGACCCGCCAGAAGGA
GATTGTTGGCGGCCCGCCAGGAACGGGTGAGCTGTGGTTGAACTTTTCCGGCTTCCCGCGCTACGTTGGCGGCAA
CCTGTTGCCTGGTGCTTGA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail