Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|5936
Gene name
LocationContig_5:209360..218929
Strand-
Gene length (bp)9569
Transcript length (bp)9495
Coding sequence length (bp)9495
Protein length (aa) 3165

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF20413 Kiaa1109_N Kiaa1109 N-terminal region 0.0E+00 39 1064

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q12150|CSF1_YEAST Protein CSF1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CSF1 PE=3 SV=1 18 1164 9.0E-121
sp|Q74ZX0|CSF1_ASHGO Protein CSF1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=CSF1 PE=3 SV=1 32 1146 1.0E-74
sp|Q12150|CSF1_YEAST Protein CSF1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CSF1 PE=3 SV=1 2463 3161 1.0E-65
sp|Q74ZX0|CSF1_ASHGO Protein CSF1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=CSF1 PE=3 SV=1 2522 3162 1.0E-63
sp|Q2LD37|K1109_HUMAN Uncharacterized protein KIAA1109 OS=Homo sapiens GN=KIAA1109 PE=1 SV=2 438 749 6.0E-18
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q12150|CSF1_YEAST Protein CSF1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CSF1 PE=3 SV=1 18 1164 9.0E-121
sp|Q74ZX0|CSF1_ASHGO Protein CSF1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=CSF1 PE=3 SV=1 32 1146 1.0E-74
sp|Q12150|CSF1_YEAST Protein CSF1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CSF1 PE=3 SV=1 2463 3161 1.0E-65
sp|Q74ZX0|CSF1_ASHGO Protein CSF1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=CSF1 PE=3 SV=1 2522 3162 1.0E-63
sp|Q2LD37|K1109_HUMAN Uncharacterized protein KIAA1109 OS=Homo sapiens GN=KIAA1109 PE=1 SV=2 438 749 6.0E-18
sp|A2AAE1|K1109_MOUSE Uncharacterized protein KIAA1109 OS=Mus musculus GN=Kiaa1109 PE=1 SV=4 405 749 7.0E-17
sp|Q12150|CSF1_YEAST Protein CSF1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CSF1 PE=3 SV=1 1425 1648 1.0E-07
sp|Q74ZX0|CSF1_ASHGO Protein CSF1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=CSF1 PE=3 SV=1 1286 1619 3.0E-07
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 20 0.5

Transmembrane Domains

Domain # Start End Length
1 21 40 19

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|5936
MSADVMLLQARSRPHPGFNYEFLIYLIVCGLVAVFFLLYFNRLFASLVSYAIRTYTWRRHQVWIDVKALQISLLG
GRIFFTGLRYHGSNETFLVQHGDITWRYWLRRVRKTELQASSDALHHPQRNAALPCRIKVRLVGLECFFYNRSPA
YDAVLAGLRDDGTSISTAHDALGRDGAEHGQVRMTQRDSTALPAPNSSRLASAKSEKAAHNQRQSVSSTSSLDSD
KANGADVSFLLQLLPIHVTCHKVAWVAGNENVRAVLVAKADSASAHIDASDTKTCDPYRQLYRVLLRHPTIDLRV
NEHFQEDQVTRVAKGHDSDAQPSPQKPWLRHRRQRVISSLRNLVPSWQRSVQSFRIGSRGREFGTAGSQIPGSSQ
WQGLSRYLQEPEQGNKSRWSEIEYAATSTIVDSPEATLTVYWDVVGRVENQTTLGANINGCEPPAWGMGLSVKGG
TINYGPWADRQRVHLQRFFFPSLAKDACPAQPLPIGATRVATQFTFLLELDDTATLRIPIREQSKDWRWQGMEPL
ARNDEGLKARTTKLQPQKTSKGEAGQSRQPGWLEFKVPANSSVSYHMDMVASASGFDSRVDVDLPNSELWSSVNH
DLLWRSGAQRVSCNLPSPLSWNSLRNWHFTVSSNALELFLLRDHIFLLIDLVDDWASGPPSDYLVFTPFKYHVHF
HFSHVRLYINVNDENIIDQATSLEDNHYLILSSPLLKAELAIPLDRYRPSTNAVPFDVKADTLDLSVNAPQSSPL
AAFLSSSAIGHAEGLTVTGSYQYNATTAPENTDTLILNVHGQSPQVYLYGFIVRYFLLLKDNYLGDYVHFKTINE
YQEQIQAQGLGLEPPVAPPRKKSNDLDVVLAIKVDDPRVMLPANLYSAGRYVQCELADLSLDLRFTNYYMDMELD
LSPLSLSLGSSDSCLESPGVSYSDTQLFLDGLRVYGHRVFGLPPSEPTYLCNWDVSLGALSGECTKEFLSSLIRG
ATAFGFTFDDVENALVPYSSLVFHDITFARVSVQSVHLWFHVDEAALFLSTDTIEINSNDWARSHYSKRADIIIP
NVQLSCVNIETATTHSSGRPQPAETEAYLHTDVRLSTVGRKYHFSEERKIQQDLVRREDQRTGRTPFFLLDWIRS
DIVPEQVDPPAQCSPFPPPPIVEMKHAGETEDLLHQHSTRRLKHQSSFLSFATSSSASVRRRPSPTVKKHGKTSM
SCGENSNSSGRGEPRLDHGQAAQFFESPQRSHPKKKAINHCSVAFSSQYFAPSFPLDKLEPEISNDTAQEPDRLG
DAFGPTSTHLSSIDPETLSEEHAYASTLVEFPSGVTAFIKPESVRHITSLIVALQPKDPEDILDSLQVDAIDRVY
ATKKPDRAHGKIQDLLVRLPQAKVQVINSSASSSSSSSHQEQDQYDLELSSVFLTTRTTTADAHSQSSRTSFHLR
LKSAEISASERLSAQDDPQAALLIEIDNVVASLGAKDVSYFDVDVGSVIGSTASGKVEYLASLIHRTASLATDLE
KLFSETMSRQRDRVRLLVHRLVREGQSTPDASFLIRPSAILRSSRGHVRSFDSWKLMMRLRQLWVTTTKGQNQQL
LRACKESSPATTPDAAAQVLSEFQKWRGWDLDNVPEAILYRLIFGNDDKASAQAKDGHALLGACRMAELQLVLDP
GPKQNHVGFINVNMRVQEKLDVASMHLTDASVKGPLTVVTLLCGEAAVNLNWTLCELADDVLRLYSRSMTSVNNS
RTRKSHGEAEIWSSSMFHFVLELSRGSMDLETINLVSNSLSDEIRTSIIMYKTETGWSCENMAMSCDAATSRLHS
HSQLLGMYQLRQPSIFFAHEANKAADMSHHNMNVIARSQELQIIIKEAPTSLLESLDFVIKDEVAQLYRLKSYFP
KSSKSQKPIKTDEGMANSRIHVVLFLERYKISIPLLQSLTYTISGHMAQAVCAIEPDNEAVLNVDVDKNSHNIQI
NVRDNPQSISLVQMPPLHGRIERRKSATGHVLDVMFSMDLVELDASAIYSLLAALNRPQISGAIKEIEQQTAIIR
GHVAEVLGPAKPAASAETQTSSSRMAYKAYLTFAGLRISAKTALGSQGEPWAQILFSLEQVSLRARNQDKPGEVA
LKYPDLHVDLRQIGLDIGRGRKEEMRSCGSFGASVTVNASSRRGKDGKEDWNFTFCSDGSEVKLSPETVSTVIDV
MGYLGAKIKNLDSSRELEYLRRLRQSKPRITINDKEEAAEEADIIDSVLASVVYRFELRNIGLSWDVAREYHDRD
STKEDLVLSIRLIEFGTRTRKSARLTIEDLQLQTVPCGQNKNVRSPHSAVLPHVMFNFAYVTTTEGRRMAFQATG
ESLDLRLTSGFIIPAANLAESISLSIDNIQQASAQWSAELPGSDDKADEGLPAEPRRSMFGNKRLESLLIDADFA
GAVVYMSSLRSTQQGAGPSTVGKYGQFSAGDSGSGAIFQTPGLAWKAEYRDSGGDDATLYIEIKIDASSNVLYPS
VMPLILDIMSSVKEVVRDDSEGHQSESGETAAQAQEKASEDERLLTADPSAVLGRLKLNLGLRIYRQEFCLSCQP
IGRVTASASFQSIYLTVNTVTSQEPGNLFAISGILDKPQASVQHVYSRESTASFNVDSVTLSFMNSKHVSGSSGV
SAILKVSPMEMAVNARQAQDFLLFREIWYPDDLRRAQTAPVAKAQAETSQGHLVQRYQQVAATAAFPWTATISIA
ALQVSVDLGQTIGKSVFQINDFWVSSKKTSDWEQNMCLGCDKIGIDCSGRLSGFVALQNFKLRTSIQWPRREEAL
NETPLIQASLAFHALRVKASFDYQAFLVADITWLEFLMHNVRESHGDRLVAMLDGESVQVFGTTTSAAQAMALYQ
AVQKLIQERRENFDSSLQEMESLTKGTSASGSAARASQAWPAAAAKLPADGSVAKSPISLDTDVVVTLKTLNLAV
FPSTFLDHQVLKMEALNAYARFAASMEQGRIHSILRMTLGQLRIGLAAVREADAPKTLSDMGIQDVVQRATGSRG
GTILKVPRVEAVMETWQTADSNHIDYVFRSSFEGKVEVGWNYSRISYIRGMWANHSKSLEQTWGRQLPMTAVKIR
GVPKAEGEQKQKITAEVKVPQSRYHYQPLQPPVIQTPQLRDMGEATPPLEWIGLQRERLPNLTHQIVIVSLLELA
GEVEDAYSRILGSS*
Coding >OphauB2|5936
ATGTCCGCCGACGTGATGCTGTTGCAGGCCAGGTCGCGTCCTCATCCTGGCTTCAACTATGAATTCCTCATCTAT
CTCATCGTCTGCGGCCTCGTCGCCGTATTCTTTCTCCTCTATTTCAACCGCCTCTTTGCGTCGCTTGTCTCGTAC
GCCATCCGCACTTATACCTGGCGTCGCCATCAGGTTTGGATCGATGTCAAGGCGCTGCAGATATCCCTTCTGGGC
GGCCGCATCTTCTTCACCGGCCTGCGCTACCATGGCTCCAACGAGACATTTCTCGTGCAGCACGGCGACATTACC
TGGCGCTATTGGCTGCGACGAGTCCGCAAAACCGAACTCCAGGCCTCGTCTGATGCCCTCCACCACCCCCAACGC
AACGCTGCTCTTCCCTGTCGCATCAAGGTCAGGCTTGTAGGCCTCGAGTGCTTTTTTTATAATCGCAGTCCGGCG
TACGATGCTGTCCTGGCCGGCCTGCGGGACGACGGCACCTCCATCTCCACGGCCCATGATGCCCTTGGCCGCGAC
GGCGCTGAGCACGGCCAAGTCAGAATGACGCAGCGTGACTCGACAGCGTTGCCCGCGCCTAACAGCAGCCGCCTT
GCTTCGGCCAAGTCTGAGAAAGCAGCCCACAACCAGCGGCAGAGCGTCTCCTCGACTTCGTCTTTGGACAGCGAC
AAGGCTAATGGTGCCGACGTCTCTTTTCTCCTCCAGCTCCTCCCCATCCATGTTACTTGTCACAAGGTGGCTTGG
GTAGCGGGAAACGAGAATGTGAGGGCTGTTTTGGTGGCCAAAGCCGACTCGGCTTCTGCCCACATAGATGCATCA
GACACCAAGACGTGTGATCCATACCGTCAACTGTACCGAGTTCTTTTGCGCCACCCAACTATAGACTTGAGAGTC
AACGAGCACTTCCAGGAAGATCAAGTGACTCGTGTCGCCAAGGGCCATGATTCAGACGCCCAGCCATCTCCTCAA
AAGCCTTGGTTGCGACATCGACGGCAGCGCGTCATCAGCTCCCTGAGGAATCTGGTTCCATCCTGGCAGCGCTCT
GTTCAGTCGTTTCGAATTGGGTCAAGAGGAAGGGAATTTGGCACAGCTGGCTCTCAGATACCTGGTTCGAGCCAG
TGGCAAGGCTTGTCAAGGTATTTACAGGAGCCCGAACAAGGGAACAAGTCACGATGGTCCGAGATTGAGTATGCA
GCCACGTCGACAATAGTCGACTCACCCGAGGCCACTTTGACAGTTTACTGGGACGTTGTGGGCCGAGTCGAAAAT
CAAACCACCTTGGGCGCCAACATCAATGGCTGCGAGCCTCCAGCATGGGGCATGGGCCTTTCGGTCAAGGGCGGC
ACCATCAACTATGGTCCGTGGGCCGACCGACAGCGTGTCCACCTCCAGCGCTTCTTCTTTCCATCGCTTGCCAAG
GATGCTTGCCCAGCGCAGCCCCTGCCGATTGGAGCGACAAGAGTGGCCACGCAGTTCACCTTTTTACTTGAGCTA
GACGACACGGCAACTCTTCGCATTCCCATACGTGAGCAATCCAAAGATTGGCGCTGGCAAGGAATGGAGCCTTTG
GCTAGGAACGACGAGGGACTCAAGGCGCGCACAACCAAATTGCAGCCCCAAAAGACCAGTAAAGGCGAAGCCGGT
CAATCACGTCAGCCTGGCTGGCTTGAATTCAAAGTGCCGGCCAACTCGTCGGTTTCCTACCATATGGACATGGTT
GCCAGTGCCTCGGGCTTTGATAGCCGCGTCGATGTCGACCTGCCCAACTCGGAGTTGTGGAGCAGTGTCAATCAT
GACTTGCTTTGGCGGTCGGGAGCCCAAAGAGTCTCGTGTAACCTTCCCAGCCCTCTGTCGTGGAACAGCCTTCGC
AACTGGCACTTCACTGTCAGCAGCAACGCTTTGGAGCTGTTCCTCCTTCGTGACCACATTTTTCTTCTCATTGAC
CTAGTCGACGACTGGGCCAGTGGTCCCCCTTCCGACTATCTCGTCTTCACACCCTTCAAATACCACGTCCACTTT
CACTTCTCCCATGTCCGCCTCTACATTAATGTCAATGACGAAAACATCATCGACCAAGCCACATCATTGGAGGAC
AATCACTATCTTATACTGTCAAGTCCCCTTCTCAAGGCCGAGTTGGCCATTCCCCTTGACAGATATCGGCCAAGC
ACAAATGCTGTACCCTTTGATGTCAAGGCAGACACTCTGGACCTGTCTGTCAATGCCCCGCAATCAAGCCCCTTA
GCAGCCTTCCTCTCGTCGAGCGCCATTGGCCACGCTGAAGGCCTCACCGTGACGGGTAGCTATCAATACAATGCC
ACTACGGCACCTGAGAATACAGACACTCTTATCCTCAATGTCCATGGCCAGTCGCCTCAAGTCTATCTCTATGGC
TTCATTGTTCGCTATTTCCTCCTGCTCAAGGACAACTATCTCGGCGATTATGTGCACTTCAAGACCATCAACGAG
TACCAAGAACAAATTCAAGCTCAAGGTCTTGGCCTGGAGCCCCCCGTCGCTCCACCGAGGAAAAAGTCAAACGAC
CTCGACGTGGTCCTGGCCATCAAAGTTGATGACCCGCGCGTTATGTTGCCAGCCAACCTTTACTCTGCCGGCCGT
TATGTACAGTGCGAGCTAGCTGATTTGTCGCTGGATCTTCGCTTCACCAACTACTACATGGACATGGAGCTGGAC
TTGAGTCCATTGAGCCTGTCACTGGGTAGTTCGGACAGCTGTCTCGAGTCTCCAGGGGTTTCTTATTCGGATACC
CAGCTCTTCCTAGATGGCCTTCGTGTCTATGGCCACCGTGTCTTTGGACTCCCACCATCTGAGCCGACATATCTG
TGCAACTGGGATGTCTCGCTCGGTGCTCTTAGTGGCGAATGTACCAAAGAATTTCTATCGTCTTTGATCCGGGGC
GCCACGGCCTTTGGCTTCACTTTTGACGACGTAGAGAACGCCCTGGTTCCGTATTCATCCCTCGTCTTTCACGAC
ATTACCTTTGCTCGGGTTTCTGTCCAATCTGTGCATCTTTGGTTCCATGTTGACGAAGCGGCCTTGTTTCTGTCT
ACCGACACTATTGAGATCAACAGCAACGACTGGGCTCGTTCGCATTACTCGAAGCGTGCAGACATTATCATTCCC
AACGTCCAGCTTTCCTGCGTCAATATCGAGACAGCGACAACTCATAGCTCAGGACGCCCACAACCGGCCGAGACT
GAGGCGTATCTGCATACAGATGTTCGGTTGTCGACTGTTGGGAGGAAGTATCACTTCTCCGAGGAGCGCAAGATT
CAACAAGATTTGGTGCGGCGCGAAGATCAGCGCACTGGCAGGACTCCTTTTTTTCTGCTTGACTGGATACGCAGT
GACATTGTTCCAGAACAAGTGGACCCCCCGGCGCAATGTTCACCATTTCCTCCTCCGCCAATTGTGGAAATGAAG
CATGCTGGTGAAACTGAAGATTTGCTACACCAACACTCAACCCGCCGCCTGAAACATCAGAGTTCGTTTCTGTCG
TTTGCTACTTCTAGCAGTGCCAGTGTACGACGGCGACCTTCACCAACAGTCAAGAAGCATGGCAAAACCAGCATG
TCATGCGGTGAAAACAGTAATAGCTCAGGGCGTGGCGAGCCTCGGCTTGACCATGGGCAAGCCGCCCAGTTCTTT
GAAAGCCCACAACGTAGTCATCCGAAAAAGAAGGCCATAAATCATTGCTCTGTCGCCTTTTCCAGCCAGTATTTC
GCCCCTTCTTTCCCTCTGGACAAGCTTGAGCCAGAAATCAGCAACGACACTGCTCAAGAGCCAGATCGTCTCGGA
GACGCATTTGGACCAACCAGTACACACTTGAGCAGCATCGACCCAGAAACATTGAGCGAGGAGCACGCATACGCA
AGTACATTGGTGGAATTTCCTTCGGGTGTCACGGCATTCATCAAGCCTGAATCTGTCAGACATATTACTTCTCTA
ATAGTGGCGCTGCAACCAAAGGACCCAGAAGACATTCTGGATTCCCTACAAGTCGATGCAATTGACCGTGTCTAT
GCCACAAAGAAGCCAGATCGTGCGCATGGCAAGATACAGGACCTGCTGGTGAGACTACCGCAGGCCAAGGTTCAA
GTCATCAACTCGTCTGCGTCCAGTTCTTCGAGCAGCTCTCATCAAGAACAAGATCAGTACGATCTTGAATTGTCA
AGCGTCTTTCTAACCACTCGCACCACGACGGCGGATGCACATTCTCAATCGTCTCGAACGTCGTTCCACCTACGT
CTCAAGTCTGCTGAGATTTCTGCCTCGGAGCGTCTTTCAGCTCAAGATGACCCCCAGGCGGCCCTTCTCATCGAG
ATTGATAATGTCGTTGCTTCTCTGGGCGCCAAGGATGTGAGCTACTTTGACGTTGATGTAGGTTCCGTGATTGGG
AGCACTGCATCAGGCAAGGTTGAATACCTGGCTTCTCTAATTCATCGGACGGCAAGCCTCGCAACAGATCTAGAG
AAACTTTTTTCCGAGACCATGTCTCGCCAACGTGACCGCGTCAGGCTGTTGGTACATCGTCTTGTCAGGGAAGGA
CAGTCGACTCCTGATGCGTCGTTTCTCATCCGCCCATCAGCTATCCTGAGATCATCTCGCGGCCATGTGCGAAGT
TTTGATTCATGGAAACTCATGATGCGGCTTCGTCAGCTCTGGGTCACAACGACAAAAGGGCAGAACCAGCAGCTC
CTCAGGGCTTGCAAGGAATCGTCACCAGCCACTACGCCAGACGCTGCGGCACAGGTTCTATCCGAGTTTCAGAAA
TGGCGCGGCTGGGACCTGGACAATGTACCAGAAGCCATTCTATATAGGCTCATATTTGGAAATGATGACAAGGCT
TCAGCGCAGGCAAAAGATGGCCATGCTCTGCTCGGCGCCTGCCGCATGGCTGAATTGCAGCTTGTACTAGATCCA
GGGCCCAAGCAAAATCATGTTGGGTTCATCAATGTCAACATGAGGGTCCAAGAGAAGCTTGATGTGGCCAGCATG
CATCTCACTGATGCTAGCGTCAAAGGCCCACTTACAGTTGTCACTTTGCTTTGCGGAGAGGCTGCCGTTAATCTC
AACTGGACTCTTTGCGAGCTGGCAGATGACGTCTTGCGGCTGTACAGCAGAAGCATGACCTCTGTCAATAATTCT
CGTACCAGAAAAAGCCACGGCGAAGCGGAAATTTGGTCATCGTCCATGTTTCATTTTGTCCTTGAGTTGTCGAGA
GGATCAATGGATCTCGAAACCATAAATCTCGTTTCAAACTCCTTGAGTGACGAAATCAGGACGTCCATCATCATG
TATAAGACAGAGACTGGGTGGAGCTGTGAAAACATGGCTATGAGCTGCGATGCCGCAACGTCTAGGCTGCATAGC
CATTCACAGCTTCTGGGTATGTATCAGCTTCGACAGCCAAGCATATTCTTCGCGCACGAGGCCAACAAGGCCGCC
GACATGTCTCATCACAACATGAATGTGATTGCCCGCAGCCAGGAGCTCCAGATCATCATCAAAGAGGCTCCTACA
TCTCTCTTGGAAAGTCTGGATTTTGTCATCAAGGACGAGGTGGCCCAGCTATATCGTTTAAAGAGCTATTTTCCT
AAGTCGTCTAAAAGCCAAAAGCCTATCAAGACGGATGAGGGAATGGCAAATAGTCGGATACATGTTGTTTTATTT
CTCGAGAGATACAAAATCAGCATCCCTTTGCTTCAATCCTTGACCTACACCATCTCTGGACACATGGCCCAAGCT
GTGTGCGCAATCGAGCCAGACAATGAAGCCGTTCTCAACGTCGATGTTGACAAGAACTCTCACAATATTCAAATC
AATGTCAGGGATAATCCACAAAGCATCTCGCTTGTTCAAATGCCACCATTGCATGGCCGAATCGAAAGACGAAAG
AGTGCAACAGGACACGTCCTCGATGTCATGTTTTCAATGGACTTGGTGGAGCTTGATGCATCTGCCATATACAGT
TTGCTCGCTGCTTTGAATCGACCCCAGATCTCTGGCGCCATCAAAGAGATTGAACAGCAAACAGCCATTATTCGG
GGACATGTGGCTGAAGTGCTTGGACCAGCAAAACCCGCGGCATCTGCGGAAACTCAGACAAGCAGTAGTCGCATG
GCATATAAAGCCTACCTGACTTTTGCAGGACTGAGGATATCTGCCAAGACGGCACTTGGCTCTCAAGGCGAGCCT
TGGGCCCAGATACTCTTTTCCCTGGAACAAGTGAGTCTGCGGGCCAGAAATCAAGACAAGCCGGGAGAAGTGGCC
TTGAAATATCCTGATTTACACGTGGATCTGCGGCAGATTGGCCTGGACATTGGCAGAGGCAGAAAGGAGGAAATG
AGGTCTTGCGGAAGCTTTGGAGCGAGTGTCACGGTGAATGCGAGCTCGAGACGAGGCAAAGACGGCAAGGAGGAC
TGGAACTTTACATTTTGCAGCGATGGCTCCGAGGTCAAACTGTCGCCAGAGACGGTGTCGACTGTGATTGATGTC
ATGGGTTACCTGGGGGCCAAGATCAAAAACTTGGACAGTTCGCGGGAGCTTGAGTACCTGCGCAGGTTGCGACAG
TCGAAGCCTCGAATTACCATCAACGACAAGGAAGAAGCAGCTGAGGAGGCAGACATTATTGACTCGGTGCTCGCA
TCAGTAGTTTATCGGTTCGAGTTGCGCAACATTGGACTCTCATGGGACGTTGCCCGGGAATACCACGACAGAGAC
TCTACCAAGGAAGACCTGGTGCTATCCATAAGGCTCATCGAGTTTGGGACAAGAACGAGAAAATCGGCTAGACTC
ACAATTGAGGATTTGCAGCTTCAGACGGTGCCTTGTGGGCAAAACAAGAATGTTCGGTCGCCACACTCTGCTGTG
TTGCCGCATGTCATGTTCAACTTTGCCTACGTGACAACGACTGAAGGGCGAAGAATGGCCTTTCAGGCCACTGGG
GAGTCACTGGACCTTCGACTGACATCGGGCTTCATTATCCCTGCTGCCAACCTGGCCGAGTCAATTTCGCTGTCA
ATCGACAACATTCAGCAAGCATCAGCACAGTGGTCTGCTGAGTTGCCTGGTAGCGACGACAAGGCTGACGAGGGA
CTGCCGGCGGAGCCGAGGCGAAGCATGTTTGGCAACAAGAGGCTAGAGAGTCTTCTCATCGATGCCGACTTTGCC
GGGGCCGTTGTATACATGTCGAGTTTGAGGAGCACTCAACAAGGGGCAGGGCCTTCAACAGTGGGGAAATACGGC
CAGTTTAGTGCTGGTGACTCTGGAAGCGGAGCCATTTTCCAAACGCCAGGTCTTGCGTGGAAAGCCGAGTATAGG
GACAGCGGCGGGGATGATGCTACACTGTACATTGAGATCAAGATTGACGCGTCCAGCAACGTGCTGTACCCCAGC
GTCATGCCTCTGATTCTCGACATCATGTCGAGCGTCAAGGAAGTCGTCAGGGACGACAGCGAGGGGCATCAGTCG
GAGAGTGGAGAGACGGCAGCGCAGGCGCAGGAAAAGGCTAGCGAGGATGAAAGGCTCCTCACGGCCGATCCAAGT
GCTGTACTGGGGCGGCTCAAGCTGAATCTGGGCCTCCGCATCTACCGGCAAGAATTCTGTCTGAGCTGCCAGCCC
ATTGGGCGGGTGACGGCATCGGCAAGCTTCCAAAGCATTTACCTGACAGTCAACACGGTCACGTCTCAGGAGCCA
GGCAACTTGTTTGCCATTTCGGGGATCCTGGACAAGCCGCAGGCCTCGGTGCAACACGTCTACTCGCGCGAGTCG
ACGGCCAGCTTCAACGTAGACTCGGTGACGCTGTCGTTTATGAACAGCAAGCACGTCAGCGGCAGCAGCGGCGTG
TCGGCCATTCTCAAAGTGAGCCCCATGGAGATGGCGGTGAATGCGCGGCAGGCCCAAGACTTCCTCTTGTTTCGC
GAGATATGGTATCCCGACGACTTGCGGCGGGCCCAGACAGCGCCCGTGGCCAAGGCGCAGGCGGAGACGTCGCAG
GGCCATTTGGTGCAGCGCTATCAGCAGGTGGCTGCCACGGCGGCGTTTCCCTGGACCGCGACGATTTCCATTGCG
GCGCTTCAAGTCAGCGTGGACCTGGGCCAGACGATAGGAAAGTCGGTCTTCCAGATCAACGACTTTTGGGTCTCG
TCCAAGAAGACGTCGGACTGGGAGCAGAACATGTGCCTGGGGTGCGACAAGATTGGCATCGACTGCAGCGGGCGG
CTCAGCGGCTTCGTGGCGCTGCAAAACTTCAAGCTGCGCACGTCGATTCAGTGGCCGAGGCGCGAGGAGGCGCTC
AACGAGACGCCGCTGATCCAGGCCTCGCTGGCTTTCCACGCGTTGCGCGTCAAGGCTTCCTTTGACTACCAGGCC
TTTCTCGTGGCCGACATTACATGGCTCGAGTTCCTCATGCACAATGTGCGCGAGAGTCACGGCGACCGGCTCGTG
GCCATGCTGGATGGCGAATCGGTGCAGGTGTTTGGCACCACGACATCGGCGGCCCAGGCCATGGCGCTCTACCAG
GCCGTGCAGAAGCTGATACAGGAGCGGAGGGAAAACTTTGACTCGTCGCTCCAGGAAATGGAAAGCTTGACCAAG
GGCACGTCTGCGTCAGGGTCGGCGGCGAGGGCGTCGCAGGCATGGCCAGCCGCAGCGGCCAAGCTTCCGGCAGAC
GGCAGCGTGGCCAAGTCGCCCATATCGCTGGACACGGATGTCGTGGTGACGCTGAAGACGCTCAACCTGGCCGTG
TTTCCCAGCACCTTTTTGGACCACCAGGTGCTCAAGATGGAGGCTCTCAATGCCTATGCCAGGTTCGCAGCCAGC
ATGGAGCAGGGGCGCATCCACAGCATCCTCCGCATGACGCTGGGCCAGCTGCGCATTGGGTTGGCGGCGGTGCGA
GAGGCCGACGCGCCCAAGACGCTGAGCGACATGGGCATACAAGACGTGGTGCAGCGGGCGACGGGCTCGCGGGGC
GGAACCATTCTCAAGGTGCCGCGCGTCGAGGCCGTCATGGAGACGTGGCAGACGGCCGACAGCAACCACATTGAC
TATGTCTTTCGCAGCTCCTTTGAGGGCAAGGTGGAAGTGGGATGGAACTACTCGCGCATCAGCTACATCCGCGGC
ATGTGGGCCAACCATTCCAAGTCTCTGGAGCAGACGTGGGGGCGCCAGCTGCCCATGACGGCCGTCAAGATTCGT
GGCGTGCCCAAGGCCGAGGGGGAGCAGAAGCAAAAGATTACGGCCGAGGTCAAGGTGCCGCAGTCGCGCTACCAC
TACCAGCCACTGCAGCCGCCCGTCATTCAAACGCCCCAGCTGCGCGACATGGGCGAGGCGACGCCGCCCCTTGAG
TGGATTGGCTTGCAGCGAGAGCGGCTGCCCAATCTGACGCATCAGATTGTCATTGTGTCGCTGCTAGAGCTGGCG
GGCGAGGTTGAGGATGCATACTCGCGCATCCTGGGCTCGTCGTGA
Transcript >OphauB2|5936
ATGTCCGCCGACGTGATGCTGTTGCAGGCCAGGTCGCGTCCTCATCCTGGCTTCAACTATGAATTCCTCATCTAT
CTCATCGTCTGCGGCCTCGTCGCCGTATTCTTTCTCCTCTATTTCAACCGCCTCTTTGCGTCGCTTGTCTCGTAC
GCCATCCGCACTTATACCTGGCGTCGCCATCAGGTTTGGATCGATGTCAAGGCGCTGCAGATATCCCTTCTGGGC
GGCCGCATCTTCTTCACCGGCCTGCGCTACCATGGCTCCAACGAGACATTTCTCGTGCAGCACGGCGACATTACC
TGGCGCTATTGGCTGCGACGAGTCCGCAAAACCGAACTCCAGGCCTCGTCTGATGCCCTCCACCACCCCCAACGC
AACGCTGCTCTTCCCTGTCGCATCAAGGTCAGGCTTGTAGGCCTCGAGTGCTTTTTTTATAATCGCAGTCCGGCG
TACGATGCTGTCCTGGCCGGCCTGCGGGACGACGGCACCTCCATCTCCACGGCCCATGATGCCCTTGGCCGCGAC
GGCGCTGAGCACGGCCAAGTCAGAATGACGCAGCGTGACTCGACAGCGTTGCCCGCGCCTAACAGCAGCCGCCTT
GCTTCGGCCAAGTCTGAGAAAGCAGCCCACAACCAGCGGCAGAGCGTCTCCTCGACTTCGTCTTTGGACAGCGAC
AAGGCTAATGGTGCCGACGTCTCTTTTCTCCTCCAGCTCCTCCCCATCCATGTTACTTGTCACAAGGTGGCTTGG
GTAGCGGGAAACGAGAATGTGAGGGCTGTTTTGGTGGCCAAAGCCGACTCGGCTTCTGCCCACATAGATGCATCA
GACACCAAGACGTGTGATCCATACCGTCAACTGTACCGAGTTCTTTTGCGCCACCCAACTATAGACTTGAGAGTC
AACGAGCACTTCCAGGAAGATCAAGTGACTCGTGTCGCCAAGGGCCATGATTCAGACGCCCAGCCATCTCCTCAA
AAGCCTTGGTTGCGACATCGACGGCAGCGCGTCATCAGCTCCCTGAGGAATCTGGTTCCATCCTGGCAGCGCTCT
GTTCAGTCGTTTCGAATTGGGTCAAGAGGAAGGGAATTTGGCACAGCTGGCTCTCAGATACCTGGTTCGAGCCAG
TGGCAAGGCTTGTCAAGGTATTTACAGGAGCCCGAACAAGGGAACAAGTCACGATGGTCCGAGATTGAGTATGCA
GCCACGTCGACAATAGTCGACTCACCCGAGGCCACTTTGACAGTTTACTGGGACGTTGTGGGCCGAGTCGAAAAT
CAAACCACCTTGGGCGCCAACATCAATGGCTGCGAGCCTCCAGCATGGGGCATGGGCCTTTCGGTCAAGGGCGGC
ACCATCAACTATGGTCCGTGGGCCGACCGACAGCGTGTCCACCTCCAGCGCTTCTTCTTTCCATCGCTTGCCAAG
GATGCTTGCCCAGCGCAGCCCCTGCCGATTGGAGCGACAAGAGTGGCCACGCAGTTCACCTTTTTACTTGAGCTA
GACGACACGGCAACTCTTCGCATTCCCATACGTGAGCAATCCAAAGATTGGCGCTGGCAAGGAATGGAGCCTTTG
GCTAGGAACGACGAGGGACTCAAGGCGCGCACAACCAAATTGCAGCCCCAAAAGACCAGTAAAGGCGAAGCCGGT
CAATCACGTCAGCCTGGCTGGCTTGAATTCAAAGTGCCGGCCAACTCGTCGGTTTCCTACCATATGGACATGGTT
GCCAGTGCCTCGGGCTTTGATAGCCGCGTCGATGTCGACCTGCCCAACTCGGAGTTGTGGAGCAGTGTCAATCAT
GACTTGCTTTGGCGGTCGGGAGCCCAAAGAGTCTCGTGTAACCTTCCCAGCCCTCTGTCGTGGAACAGCCTTCGC
AACTGGCACTTCACTGTCAGCAGCAACGCTTTGGAGCTGTTCCTCCTTCGTGACCACATTTTTCTTCTCATTGAC
CTAGTCGACGACTGGGCCAGTGGTCCCCCTTCCGACTATCTCGTCTTCACACCCTTCAAATACCACGTCCACTTT
CACTTCTCCCATGTCCGCCTCTACATTAATGTCAATGACGAAAACATCATCGACCAAGCCACATCATTGGAGGAC
AATCACTATCTTATACTGTCAAGTCCCCTTCTCAAGGCCGAGTTGGCCATTCCCCTTGACAGATATCGGCCAAGC
ACAAATGCTGTACCCTTTGATGTCAAGGCAGACACTCTGGACCTGTCTGTCAATGCCCCGCAATCAAGCCCCTTA
GCAGCCTTCCTCTCGTCGAGCGCCATTGGCCACGCTGAAGGCCTCACCGTGACGGGTAGCTATCAATACAATGCC
ACTACGGCACCTGAGAATACAGACACTCTTATCCTCAATGTCCATGGCCAGTCGCCTCAAGTCTATCTCTATGGC
TTCATTGTTCGCTATTTCCTCCTGCTCAAGGACAACTATCTCGGCGATTATGTGCACTTCAAGACCATCAACGAG
TACCAAGAACAAATTCAAGCTCAAGGTCTTGGCCTGGAGCCCCCCGTCGCTCCACCGAGGAAAAAGTCAAACGAC
CTCGACGTGGTCCTGGCCATCAAAGTTGATGACCCGCGCGTTATGTTGCCAGCCAACCTTTACTCTGCCGGCCGT
TATGTACAGTGCGAGCTAGCTGATTTGTCGCTGGATCTTCGCTTCACCAACTACTACATGGACATGGAGCTGGAC
TTGAGTCCATTGAGCCTGTCACTGGGTAGTTCGGACAGCTGTCTCGAGTCTCCAGGGGTTTCTTATTCGGATACC
CAGCTCTTCCTAGATGGCCTTCGTGTCTATGGCCACCGTGTCTTTGGACTCCCACCATCTGAGCCGACATATCTG
TGCAACTGGGATGTCTCGCTCGGTGCTCTTAGTGGCGAATGTACCAAAGAATTTCTATCGTCTTTGATCCGGGGC
GCCACGGCCTTTGGCTTCACTTTTGACGACGTAGAGAACGCCCTGGTTCCGTATTCATCCCTCGTCTTTCACGAC
ATTACCTTTGCTCGGGTTTCTGTCCAATCTGTGCATCTTTGGTTCCATGTTGACGAAGCGGCCTTGTTTCTGTCT
ACCGACACTATTGAGATCAACAGCAACGACTGGGCTCGTTCGCATTACTCGAAGCGTGCAGACATTATCATTCCC
AACGTCCAGCTTTCCTGCGTCAATATCGAGACAGCGACAACTCATAGCTCAGGACGCCCACAACCGGCCGAGACT
GAGGCGTATCTGCATACAGATGTTCGGTTGTCGACTGTTGGGAGGAAGTATCACTTCTCCGAGGAGCGCAAGATT
CAACAAGATTTGGTGCGGCGCGAAGATCAGCGCACTGGCAGGACTCCTTTTTTTCTGCTTGACTGGATACGCAGT
GACATTGTTCCAGAACAAGTGGACCCCCCGGCGCAATGTTCACCATTTCCTCCTCCGCCAATTGTGGAAATGAAG
CATGCTGGTGAAACTGAAGATTTGCTACACCAACACTCAACCCGCCGCCTGAAACATCAGAGTTCGTTTCTGTCG
TTTGCTACTTCTAGCAGTGCCAGTGTACGACGGCGACCTTCACCAACAGTCAAGAAGCATGGCAAAACCAGCATG
TCATGCGGTGAAAACAGTAATAGCTCAGGGCGTGGCGAGCCTCGGCTTGACCATGGGCAAGCCGCCCAGTTCTTT
GAAAGCCCACAACGTAGTCATCCGAAAAAGAAGGCCATAAATCATTGCTCTGTCGCCTTTTCCAGCCAGTATTTC
GCCCCTTCTTTCCCTCTGGACAAGCTTGAGCCAGAAATCAGCAACGACACTGCTCAAGAGCCAGATCGTCTCGGA
GACGCATTTGGACCAACCAGTACACACTTGAGCAGCATCGACCCAGAAACATTGAGCGAGGAGCACGCATACGCA
AGTACATTGGTGGAATTTCCTTCGGGTGTCACGGCATTCATCAAGCCTGAATCTGTCAGACATATTACTTCTCTA
ATAGTGGCGCTGCAACCAAAGGACCCAGAAGACATTCTGGATTCCCTACAAGTCGATGCAATTGACCGTGTCTAT
GCCACAAAGAAGCCAGATCGTGCGCATGGCAAGATACAGGACCTGCTGGTGAGACTACCGCAGGCCAAGGTTCAA
GTCATCAACTCGTCTGCGTCCAGTTCTTCGAGCAGCTCTCATCAAGAACAAGATCAGTACGATCTTGAATTGTCA
AGCGTCTTTCTAACCACTCGCACCACGACGGCGGATGCACATTCTCAATCGTCTCGAACGTCGTTCCACCTACGT
CTCAAGTCTGCTGAGATTTCTGCCTCGGAGCGTCTTTCAGCTCAAGATGACCCCCAGGCGGCCCTTCTCATCGAG
ATTGATAATGTCGTTGCTTCTCTGGGCGCCAAGGATGTGAGCTACTTTGACGTTGATGTAGGTTCCGTGATTGGG
AGCACTGCATCAGGCAAGGTTGAATACCTGGCTTCTCTAATTCATCGGACGGCAAGCCTCGCAACAGATCTAGAG
AAACTTTTTTCCGAGACCATGTCTCGCCAACGTGACCGCGTCAGGCTGTTGGTACATCGTCTTGTCAGGGAAGGA
CAGTCGACTCCTGATGCGTCGTTTCTCATCCGCCCATCAGCTATCCTGAGATCATCTCGCGGCCATGTGCGAAGT
TTTGATTCATGGAAACTCATGATGCGGCTTCGTCAGCTCTGGGTCACAACGACAAAAGGGCAGAACCAGCAGCTC
CTCAGGGCTTGCAAGGAATCGTCACCAGCCACTACGCCAGACGCTGCGGCACAGGTTCTATCCGAGTTTCAGAAA
TGGCGCGGCTGGGACCTGGACAATGTACCAGAAGCCATTCTATATAGGCTCATATTTGGAAATGATGACAAGGCT
TCAGCGCAGGCAAAAGATGGCCATGCTCTGCTCGGCGCCTGCCGCATGGCTGAATTGCAGCTTGTACTAGATCCA
GGGCCCAAGCAAAATCATGTTGGGTTCATCAATGTCAACATGAGGGTCCAAGAGAAGCTTGATGTGGCCAGCATG
CATCTCACTGATGCTAGCGTCAAAGGCCCACTTACAGTTGTCACTTTGCTTTGCGGAGAGGCTGCCGTTAATCTC
AACTGGACTCTTTGCGAGCTGGCAGATGACGTCTTGCGGCTGTACAGCAGAAGCATGACCTCTGTCAATAATTCT
CGTACCAGAAAAAGCCACGGCGAAGCGGAAATTTGGTCATCGTCCATGTTTCATTTTGTCCTTGAGTTGTCGAGA
GGATCAATGGATCTCGAAACCATAAATCTCGTTTCAAACTCCTTGAGTGACGAAATCAGGACGTCCATCATCATG
TATAAGACAGAGACTGGGTGGAGCTGTGAAAACATGGCTATGAGCTGCGATGCCGCAACGTCTAGGCTGCATAGC
CATTCACAGCTTCTGGGTATGTATCAGCTTCGACAGCCAAGCATATTCTTCGCGCACGAGGCCAACAAGGCCGCC
GACATGTCTCATCACAACATGAATGTGATTGCCCGCAGCCAGGAGCTCCAGATCATCATCAAAGAGGCTCCTACA
TCTCTCTTGGAAAGTCTGGATTTTGTCATCAAGGACGAGGTGGCCCAGCTATATCGTTTAAAGAGCTATTTTCCT
AAGTCGTCTAAAAGCCAAAAGCCTATCAAGACGGATGAGGGAATGGCAAATAGTCGGATACATGTTGTTTTATTT
CTCGAGAGATACAAAATCAGCATCCCTTTGCTTCAATCCTTGACCTACACCATCTCTGGACACATGGCCCAAGCT
GTGTGCGCAATCGAGCCAGACAATGAAGCCGTTCTCAACGTCGATGTTGACAAGAACTCTCACAATATTCAAATC
AATGTCAGGGATAATCCACAAAGCATCTCGCTTGTTCAAATGCCACCATTGCATGGCCGAATCGAAAGACGAAAG
AGTGCAACAGGACACGTCCTCGATGTCATGTTTTCAATGGACTTGGTGGAGCTTGATGCATCTGCCATATACAGT
TTGCTCGCTGCTTTGAATCGACCCCAGATCTCTGGCGCCATCAAAGAGATTGAACAGCAAACAGCCATTATTCGG
GGACATGTGGCTGAAGTGCTTGGACCAGCAAAACCCGCGGCATCTGCGGAAACTCAGACAAGCAGTAGTCGCATG
GCATATAAAGCCTACCTGACTTTTGCAGGACTGAGGATATCTGCCAAGACGGCACTTGGCTCTCAAGGCGAGCCT
TGGGCCCAGATACTCTTTTCCCTGGAACAAGTGAGTCTGCGGGCCAGAAATCAAGACAAGCCGGGAGAAGTGGCC
TTGAAATATCCTGATTTACACGTGGATCTGCGGCAGATTGGCCTGGACATTGGCAGAGGCAGAAAGGAGGAAATG
AGGTCTTGCGGAAGCTTTGGAGCGAGTGTCACGGTGAATGCGAGCTCGAGACGAGGCAAAGACGGCAAGGAGGAC
TGGAACTTTACATTTTGCAGCGATGGCTCCGAGGTCAAACTGTCGCCAGAGACGGTGTCGACTGTGATTGATGTC
ATGGGTTACCTGGGGGCCAAGATCAAAAACTTGGACAGTTCGCGGGAGCTTGAGTACCTGCGCAGGTTGCGACAG
TCGAAGCCTCGAATTACCATCAACGACAAGGAAGAAGCAGCTGAGGAGGCAGACATTATTGACTCGGTGCTCGCA
TCAGTAGTTTATCGGTTCGAGTTGCGCAACATTGGACTCTCATGGGACGTTGCCCGGGAATACCACGACAGAGAC
TCTACCAAGGAAGACCTGGTGCTATCCATAAGGCTCATCGAGTTTGGGACAAGAACGAGAAAATCGGCTAGACTC
ACAATTGAGGATTTGCAGCTTCAGACGGTGCCTTGTGGGCAAAACAAGAATGTTCGGTCGCCACACTCTGCTGTG
TTGCCGCATGTCATGTTCAACTTTGCCTACGTGACAACGACTGAAGGGCGAAGAATGGCCTTTCAGGCCACTGGG
GAGTCACTGGACCTTCGACTGACATCGGGCTTCATTATCCCTGCTGCCAACCTGGCCGAGTCAATTTCGCTGTCA
ATCGACAACATTCAGCAAGCATCAGCACAGTGGTCTGCTGAGTTGCCTGGTAGCGACGACAAGGCTGACGAGGGA
CTGCCGGCGGAGCCGAGGCGAAGCATGTTTGGCAACAAGAGGCTAGAGAGTCTTCTCATCGATGCCGACTTTGCC
GGGGCCGTTGTATACATGTCGAGTTTGAGGAGCACTCAACAAGGGGCAGGGCCTTCAACAGTGGGGAAATACGGC
CAGTTTAGTGCTGGTGACTCTGGAAGCGGAGCCATTTTCCAAACGCCAGGTCTTGCGTGGAAAGCCGAGTATAGG
GACAGCGGCGGGGATGATGCTACACTGTACATTGAGATCAAGATTGACGCGTCCAGCAACGTGCTGTACCCCAGC
GTCATGCCTCTGATTCTCGACATCATGTCGAGCGTCAAGGAAGTCGTCAGGGACGACAGCGAGGGGCATCAGTCG
GAGAGTGGAGAGACGGCAGCGCAGGCGCAGGAAAAGGCTAGCGAGGATGAAAGGCTCCTCACGGCCGATCCAAGT
GCTGTACTGGGGCGGCTCAAGCTGAATCTGGGCCTCCGCATCTACCGGCAAGAATTCTGTCTGAGCTGCCAGCCC
ATTGGGCGGGTGACGGCATCGGCAAGCTTCCAAAGCATTTACCTGACAGTCAACACGGTCACGTCTCAGGAGCCA
GGCAACTTGTTTGCCATTTCGGGGATCCTGGACAAGCCGCAGGCCTCGGTGCAACACGTCTACTCGCGCGAGTCG
ACGGCCAGCTTCAACGTAGACTCGGTGACGCTGTCGTTTATGAACAGCAAGCACGTCAGCGGCAGCAGCGGCGTG
TCGGCCATTCTCAAAGTGAGCCCCATGGAGATGGCGGTGAATGCGCGGCAGGCCCAAGACTTCCTCTTGTTTCGC
GAGATATGGTATCCCGACGACTTGCGGCGGGCCCAGACAGCGCCCGTGGCCAAGGCGCAGGCGGAGACGTCGCAG
GGCCATTTGGTGCAGCGCTATCAGCAGGTGGCTGCCACGGCGGCGTTTCCCTGGACCGCGACGATTTCCATTGCG
GCGCTTCAAGTCAGCGTGGACCTGGGCCAGACGATAGGAAAGTCGGTCTTCCAGATCAACGACTTTTGGGTCTCG
TCCAAGAAGACGTCGGACTGGGAGCAGAACATGTGCCTGGGGTGCGACAAGATTGGCATCGACTGCAGCGGGCGG
CTCAGCGGCTTCGTGGCGCTGCAAAACTTCAAGCTGCGCACGTCGATTCAGTGGCCGAGGCGCGAGGAGGCGCTC
AACGAGACGCCGCTGATCCAGGCCTCGCTGGCTTTCCACGCGTTGCGCGTCAAGGCTTCCTTTGACTACCAGGCC
TTTCTCGTGGCCGACATTACATGGCTCGAGTTCCTCATGCACAATGTGCGCGAGAGTCACGGCGACCGGCTCGTG
GCCATGCTGGATGGCGAATCGGTGCAGGTGTTTGGCACCACGACATCGGCGGCCCAGGCCATGGCGCTCTACCAG
GCCGTGCAGAAGCTGATACAGGAGCGGAGGGAAAACTTTGACTCGTCGCTCCAGGAAATGGAAAGCTTGACCAAG
GGCACGTCTGCGTCAGGGTCGGCGGCGAGGGCGTCGCAGGCATGGCCAGCCGCAGCGGCCAAGCTTCCGGCAGAC
GGCAGCGTGGCCAAGTCGCCCATATCGCTGGACACGGATGTCGTGGTGACGCTGAAGACGCTCAACCTGGCCGTG
TTTCCCAGCACCTTTTTGGACCACCAGGTGCTCAAGATGGAGGCTCTCAATGCCTATGCCAGGTTCGCAGCCAGC
ATGGAGCAGGGGCGCATCCACAGCATCCTCCGCATGACGCTGGGCCAGCTGCGCATTGGGTTGGCGGCGGTGCGA
GAGGCCGACGCGCCCAAGACGCTGAGCGACATGGGCATACAAGACGTGGTGCAGCGGGCGACGGGCTCGCGGGGC
GGAACCATTCTCAAGGTGCCGCGCGTCGAGGCCGTCATGGAGACGTGGCAGACGGCCGACAGCAACCACATTGAC
TATGTCTTTCGCAGCTCCTTTGAGGGCAAGGTGGAAGTGGGATGGAACTACTCGCGCATCAGCTACATCCGCGGC
ATGTGGGCCAACCATTCCAAGTCTCTGGAGCAGACGTGGGGGCGCCAGCTGCCCATGACGGCCGTCAAGATTCGT
GGCGTGCCCAAGGCCGAGGGGGAGCAGAAGCAAAAGATTACGGCCGAGGTCAAGGTGCCGCAGTCGCGCTACCAC
TACCAGCCACTGCAGCCGCCCGTCATTCAAACGCCCCAGCTGCGCGACATGGGCGAGGCGACGCCGCCCCTTGAG
TGGATTGGCTTGCAGCGAGAGCGGCTGCCCAATCTGACGCATCAGATTGTCATTGTGTCGCTGCTAGAGCTGGCG
GGCGAGGTTGAGGATGCATACTCGCGCATCCTGGGCTCGTCGTGA
Gene >OphauB2|5936
ATGTCCGCCGACGTGATGCTGTTGCAGGCCAGGTCGCGTCCTCATCCTGGCTTCAACTAGTCTGTCCTTTGCCCT
GCGGCCCATGAATGCCGACCATGAATGCCAGTCGGCTAGCTAACATAGGGCTGGCCAGTGAATTCCTCATCTATC
TCATCGTCTGCGGCCTCGTCGCCGTATTCTTTCTCCTCTATTTCAACCGCCTCTTTGCGTCGCTTGTCTCGTACG
CCATCCGCACTTATACCTGGCGTCGCCATCAGGTTTGGATCGATGTCAAGGCGCTGCAGATATCCCTTCTGGGCG
GCCGCATCTTCTTCACCGGCCTGCGCTACCATGGCTCCAACGAGACATTTCTCGTGCAGCACGGCGACATTACCT
GGCGCTATTGGCTGCGACGAGTCCGCAAAACCGAACTCCAGGCCTCGTCTGATGCCCTCCACCACCCCCAACGCA
ACGCTGCTCTTCCCTGTCGCATCAAGGTCAGGCTTGTAGGCCTCGAGTGCTTTTTTTATAATCGCAGTCCGGCGT
ACGATGCTGTCCTGGCCGGCCTGCGGGACGACGGCACCTCCATCTCCACGGCCCATGATGCCCTTGGCCGCGACG
GCGCTGAGCACGGCCAAGTCAGAATGACGCAGCGTGACTCGACAGCGTTGCCCGCGCCTAACAGCAGCCGCCTTG
CTTCGGCCAAGTCTGAGAAAGCAGCCCACAACCAGCGGCAGAGCGTCTCCTCGACTTCGTCTTTGGACAGCGACA
AGGCTAATGGTGCCGACGTCTCTTTTCTCCTCCAGCTCCTCCCCATCCATGTTACTTGTCACAAGGTGGCTTGGG
TAGCGGGAAACGAGAATGTGAGGGCTGTTTTGGTGGCCAAAGCCGACTCGGCTTCTGCCCACATAGATGCATCAG
ACACCAAGACGTGTGATCCATACCGTCAACTGTACCGAGTTCTTTTGCGCCACCCAACTATAGACTTGAGAGTCA
ACGAGCACTTCCAGGAAGATCAAGTGACTCGTGTCGCCAAGGGCCATGATTCAGACGCCCAGCCATCTCCTCAAA
AGCCTTGGTTGCGACATCGACGGCAGCGCGTCATCAGCTCCCTGAGGAATCTGGTTCCATCCTGGCAGCGCTCTG
TTCAGTCGTTTCGAATTGGGTCAAGAGGAAGGGAATTTGGCACAGCTGGCTCTCAGATACCTGGTTCGAGCCAGT
GGCAAGGCTTGTCAAGGTATTTACAGGAGCCCGAACAAGGGAACAAGTCACGATGGTCCGAGATTGAGTATGCAG
CCACGTCGACAATAGTCGACTCACCCGAGGCCACTTTGACAGTTTACTGGGACGTTGTGGGCCGAGTCGAAAATC
AAACCACCTTGGGCGCCAACATCAATGGCTGCGAGCCTCCAGCATGGGGCATGGGCCTTTCGGTCAAGGGCGGCA
CCATCAACTATGGTCCGTGGGCCGACCGACAGCGTGTCCACCTCCAGCGCTTCTTCTTTCCATCGCTTGCCAAGG
ATGCTTGCCCAGCGCAGCCCCTGCCGATTGGAGCGACAAGAGTGGCCACGCAGTTCACCTTTTTACTTGAGCTAG
ACGACACGGCAACTCTTCGCATTCCCATACGTGAGCAATCCAAAGATTGGCGCTGGCAAGGAATGGAGCCTTTGG
CTAGGAACGACGAGGGACTCAAGGCGCGCACAACCAAATTGCAGCCCCAAAAGACCAGTAAAGGCGAAGCCGGTC
AATCACGTCAGCCTGGCTGGCTTGAATTCAAAGTGCCGGCCAACTCGTCGGTTTCCTACCATATGGACATGGTTG
CCAGTGCCTCGGGCTTTGATAGCCGCGTCGATGTCGACCTGCCCAACTCGGAGTTGTGGAGCAGTGTCAATCATG
ACTTGCTTTGGCGGTCGGGAGCCCAAAGAGTCTCGTGTAACCTTCCCAGCCCTCTGTCGTGGAACAGCCTTCGCA
ACTGGCACTTCACTGTCAGCAGCAACGCTTTGGAGCTGTTCCTCCTTCGTGACCACATTTTTCTTCTCATTGACC
TAGTCGACGACTGGGCCAGTGGTCCCCCTTCCGACTATCTCGTCTTCACACCCTTCAAATACCACGTCCACTTTC
ACTTCTCCCATGTCCGCCTCTACATTAATGTCAATGACGAAAACATCATCGACCAAGCCACATCATTGGAGGACA
ATCACTATCTTATACTGTCAAGTCCCCTTCTCAAGGCCGAGTTGGCCATTCCCCTTGACAGATATCGGCCAAGCA
CAAATGCTGTACCCTTTGATGTCAAGGCAGACACTCTGGACCTGTCTGTCAATGCCCCGCAATCAAGCCCCTTAG
CAGCCTTCCTCTCGTCGAGCGCCATTGGCCACGCTGAAGGCCTCACCGTGACGGGTAGCTATCAATACAATGCCA
CTACGGCACCTGAGAATACAGACACTCTTATCCTCAATGTCCATGGCCAGTCGCCTCAAGTCTATCTCTATGGCT
TCATTGTTCGCTATTTCCTCCTGCTCAAGGACAACTATCTCGGCGATTATGTGCACTTCAAGACCATCAACGAGT
ACCAAGAACAAATTCAAGCTCAAGGTCTTGGCCTGGAGCCCCCCGTCGCTCCACCGAGGAAAAAGTCAAACGACC
TCGACGTGGTCCTGGCCATCAAAGTTGATGACCCGCGCGTTATGTTGCCAGCCAACCTTTACTCTGCCGGCCGTT
ATGTACAGTGCGAGCTAGCTGATTTGTCGCTGGATCTTCGCTTCACCAACTACTACATGGACATGGAGCTGGACT
TGAGTCCATTGAGCCTGTCACTGGGTAGTTCGGACAGCTGTCTCGAGTCTCCAGGGGTTTCTTATTCGGATACCC
AGCTCTTCCTAGATGGCCTTCGTGTCTATGGCCACCGTGTCTTTGGACTCCCACCATCTGAGCCGACATATCTGT
GCAACTGGGATGTCTCGCTCGGTGCTCTTAGTGGCGAATGTACCAAAGAATTTCTATCGTCTTTGATCCGGGGCG
CCACGGCCTTTGGCTTCACTTTTGACGACGTAGAGAACGCCCTGGTTCCGTATTCATCCCTCGTCTTTCACGACA
TTACCTTTGCTCGGGTTTCTGTCCAATCTGTGCATCTTTGGTTCCATGTTGACGAAGCGGCCTTGTTTCTGTCTA
CCGACACTATTGAGATCAACAGCAACGACTGGGCTCGTTCGCATTACTCGAAGCGTGCAGACATTATCATTCCCA
ACGTCCAGCTTTCCTGCGTCAATATCGAGACAGCGACAACTCATAGCTCAGGACGCCCACAACCGGCCGAGACTG
AGGCGTATCTGCATACAGATGTTCGGTTGTCGACTGTTGGGAGGAAGTATCACTTCTCCGAGGAGCGCAAGATTC
AACAAGATTTGGTGCGGCGCGAAGATCAGCGCACTGGCAGGACTCCTTTTTTTCTGCTTGACTGGATACGCAGTG
ACATTGTTCCAGAACAAGTGGACCCCCCGGCGCAATGTTCACCATTTCCTCCTCCGCCAATTGTGGAAATGAAGC
ATGCTGGTGAAACTGAAGATTTGCTACACCAACACTCAACCCGCCGCCTGAAACATCAGAGTTCGTTTCTGTCGT
TTGCTACTTCTAGCAGTGCCAGTGTACGACGGCGACCTTCACCAACAGTCAAGAAGCATGGCAAAACCAGCATGT
CATGCGGTGAAAACAGTAATAGCTCAGGGCGTGGCGAGCCTCGGCTTGACCATGGGCAAGCCGCCCAGTTCTTTG
AAAGCCCACAACGTAGTCATCCGAAAAAGAAGGCCATAAATCATTGCTCTGTCGCCTTTTCCAGCCAGTATTTCG
CCCCTTCTTTCCCTCTGGACAAGCTTGAGCCAGAAATCAGCAACGACACTGCTCAAGAGCCAGATCGTCTCGGAG
ACGCATTTGGACCAACCAGTACACACTTGAGCAGCATCGACCCAGAAACATTGAGCGAGGAGCACGCATACGCAA
GTACATTGGTGGAATTTCCTTCGGGTGTCACGGCATTCATCAAGCCTGAATCTGTCAGACATATTACTTCTCTAA
TAGTGGCGCTGCAACCAAAGGACCCAGAAGACATTCTGGATTCCCTACAAGTCGATGCAATTGACCGTGTCTATG
CCACAAAGAAGCCAGATCGTGCGCATGGCAAGATACAGGACCTGCTGGTGAGACTACCGCAGGCCAAGGTTCAAG
TCATCAACTCGTCTGCGTCCAGTTCTTCGAGCAGCTCTCATCAAGAACAAGATCAGTACGATCTTGAATTGTCAA
GCGTCTTTCTAACCACTCGCACCACGACGGCGGATGCACATTCTCAATCGTCTCGAACGTCGTTCCACCTACGTC
TCAAGTCTGCTGAGATTTCTGCCTCGGAGCGTCTTTCAGCTCAAGATGACCCCCAGGCGGCCCTTCTCATCGAGA
TTGATAATGTCGTTGCTTCTCTGGGCGCCAAGGATGTGAGCTACTTTGACGTTGATGTAGGTTCCGTGATTGGGA
GCACTGCATCAGGCAAGGTTGAATACCTGGCTTCTCTAATTCATCGGACGGCAAGCCTCGCAACAGATCTAGAGA
AACTTTTTTCCGAGACCATGTCTCGCCAACGTGACCGCGTCAGGCTGTTGGTACATCGTCTTGTCAGGGAAGGAC
AGTCGACTCCTGATGCGTCGTTTCTCATCCGCCCATCAGCTATCCTGAGATCATCTCGCGGCCATGTGCGAAGTT
TTGATTCATGGAAACTCATGATGCGGCTTCGTCAGCTCTGGGTCACAACGACAAAAGGGCAGAACCAGCAGCTCC
TCAGGGCTTGCAAGGAATCGTCACCAGCCACTACGCCAGACGCTGCGGCACAGGTTCTATCCGAGTTTCAGAAAT
GGCGCGGCTGGGACCTGGACAATGTACCAGAAGCCATTCTATATAGGCTCATATTTGGAAATGATGACAAGGCTT
CAGCGCAGGCAAAAGATGGCCATGCTCTGCTCGGCGCCTGCCGCATGGCTGAATTGCAGCTTGTACTAGATCCAG
GGCCCAAGCAAAATCATGTTGGGTTCATCAATGTCAACATGAGGGTCCAAGAGAAGCTTGATGTGGCCAGCATGC
ATCTCACTGATGCTAGCGTCAAAGGCCCACTTACAGTTGTCACTTTGCTTTGCGGAGAGGCTGCCGTTAATCTCA
ACTGGACTCTTTGCGAGCTGGCAGATGACGTCTTGCGGCTGTACAGCAGAAGCATGACCTCTGTCAATAATTCTC
GTACCAGAAAAAGCCACGGCGAAGCGGAAATTTGGTCATCGTCCATGTTTCATTTTGTCCTTGAGTTGTCGAGAG
GATCAATGGATCTCGAAACCATAAATCTCGTTTCAAACTCCTTGAGTGACGAAATCAGGACGTCCATCATCATGT
ATAAGACAGAGACTGGGTGGAGCTGTGAAAACATGGCTATGAGCTGCGATGCCGCAACGTCTAGGCTGCATAGCC
ATTCACAGCTTCTGGGTATGTATCAGCTTCGACAGCCAAGCATATTCTTCGCGCACGAGGCCAACAAGGCCGCCG
ACATGTCTCATCACAACATGAATGTGATTGCCCGCAGCCAGGAGCTCCAGATCATCATCAAAGAGGCTCCTACAT
CTCTCTTGGAAAGTCTGGATTTTGTCATCAAGGACGAGGTGGCCCAGCTATATCGTTTAAAGAGCTATTTTCCTA
AGTCGTCTAAAAGCCAAAAGCCTATCAAGACGGATGAGGGAATGGCAAATAGTCGGATACATGTTGTTTTATTTC
TCGAGAGATACAAAATCAGCATCCCTTTGCTTCAATCCTTGACCTACACCATCTCTGGACACATGGCCCAAGCTG
TGTGCGCAATCGAGCCAGACAATGAAGCCGTTCTCAACGTCGATGTTGACAAGAACTCTCACAATATTCAAATCA
ATGTCAGGGATAATCCACAAAGCATCTCGCTTGTTCAAATGCCACCATTGCATGGCCGAATCGAAAGACGAAAGA
GTGCAACAGGACACGTCCTCGATGTCATGTTTTCAATGGACTTGGTGGAGCTTGATGCATCTGCCATATACAGTT
TGCTCGCTGCTTTGAATCGACCCCAGATCTCTGGCGCCATCAAAGAGATTGAACAGCAAACAGCCATTATTCGGG
GACATGTGGCTGAAGTGCTTGGACCAGCAAAACCCGCGGCATCTGCGGAAACTCAGACAAGCAGTAGTCGCATGG
CATATAAAGCCTACCTGACTTTTGCAGGACTGAGGATATCTGCCAAGACGGCACTTGGCTCTCAAGGCGAGCCTT
GGGCCCAGATACTCTTTTCCCTGGAACAAGTGAGTCTGCGGGCCAGAAATCAAGACAAGCCGGGAGAAGTGGCCT
TGAAATATCCTGATTTACACGTGGATCTGCGGCAGATTGGCCTGGACATTGGCAGAGGCAGAAAGGAGGAAATGA
GGTCTTGCGGAAGCTTTGGAGCGAGTGTCACGGTGAATGCGAGCTCGAGACGAGGCAAAGACGGCAAGGAGGACT
GGAACTTTACATTTTGCAGCGATGGCTCCGAGGTCAAACTGTCGCCAGAGACGGTGTCGACTGTGATTGATGTCA
TGGGTTACCTGGGGGCCAAGATCAAAAACTTGGACAGTTCGCGGGAGCTTGAGTACCTGCGCAGGTTGCGACAGT
CGAAGCCTCGAATTACCATCAACGACAAGGAAGAAGCAGCTGAGGAGGCAGACATTATTGACTCGGTGCTCGCAT
CAGTAGTTTATCGGTTCGAGTTGCGCAACATTGGACTCTCATGGGACGTTGCCCGGGAATACCACGACAGAGACT
CTACCAAGGAAGACCTGGTGCTATCCATAAGGCTCATCGAGTTTGGGACAAGAACGAGAAAATCGGCTAGACTCA
CAATTGAGGATTTGCAGCTTCAGACGGTGCCTTGTGGGCAAAACAAGAATGTTCGGTCGCCACACTCTGCTGTGT
TGCCGCATGTCATGTTCAACTTTGCCTACGTGACAACGACTGAAGGGCGAAGAATGGCCTTTCAGGCCACTGGGG
AGTCACTGGACCTTCGACTGACATCGGGCTTCATTATCCCTGCTGCCAACCTGGCCGAGTCAATTTCGCTGTCAA
TCGACAACATTCAGCAAGCATCAGCACAGTGGTCTGCTGAGTTGCCTGGTAGCGACGACAAGGCTGACGAGGGAC
TGCCGGCGGAGCCGAGGCGAAGCATGTTTGGCAACAAGAGGCTAGAGAGTCTTCTCATCGATGCCGACTTTGCCG
GGGCCGTTGTATACATGTCGAGTTTGAGGAGCACTCAACAAGGGGCAGGGCCTTCAACAGTGGGGAAATACGGCC
AGTTTAGTGCTGGTGACTCTGGAAGCGGAGCCATTTTCCAAACGCCAGGTCTTGCGTGGAAAGCCGAGTATAGGG
ACAGCGGCGGGGATGATGCTACACTGTACATTGAGATCAAGATTGACGCGTCCAGCAACGTGCTGTACCCCAGCG
TCATGCCTCTGATTCTCGACATCATGTCGAGCGTCAAGGAAGTCGTCAGGGACGACAGCGAGGGGCATCAGTCGG
AGAGTGGAGAGACGGCAGCGCAGGCGCAGGAAAAGGCTAGCGAGGATGAAAGGCTCCTCACGGCCGATCCAAGTG
CTGTACTGGGGCGGCTCAAGCTGAATCTGGGCCTCCGCATCTACCGGCAAGAATTCTGTCTGAGCTGCCAGCCCA
TTGGGCGGGTGACGGCATCGGCAAGCTTCCAAAGCATTTACCTGACAGTCAACACGGTCACGTCTCAGGAGCCAG
GCAACTTGTTTGCCATTTCGGGGATCCTGGACAAGCCGCAGGCCTCGGTGCAACACGTCTACTCGCGCGAGTCGA
CGGCCAGCTTCAACGTAGACTCGGTGACGCTGTCGTTTATGAACAGCAAGCACGTCAGCGGCAGCAGCGGCGTGT
CGGCCATTCTCAAAGTGAGCCCCATGGAGATGGCGGTGAATGCGCGGCAGGCCCAAGACTTCCTCTTGTTTCGCG
AGATATGGTATCCCGACGACTTGCGGCGGGCCCAGACAGCGCCCGTGGCCAAGGCGCAGGCGGAGACGTCGCAGG
GCCATTTGGTGCAGCGCTATCAGCAGGTGGCTGCCACGGCGGCGTTTCCCTGGACCGCGACGATTTCCATTGCGG
CGCTTCAAGTCAGCGTGGACCTGGGCCAGACGATAGGAAAGTCGGTCTTCCAGATCAACGACTTTTGGGTCTCGT
CCAAGAAGACGTCGGACTGGGAGCAGAACATGTGCCTGGGGTGCGACAAGATTGGCATCGACTGCAGCGGGCGGC
TCAGCGGCTTCGTGGCGCTGCAAAACTTCAAGCTGCGCACGTCGATTCAGTGGCCGAGGCGCGAGGAGGCGCTCA
ACGAGACGCCGCTGATCCAGGCCTCGCTGGCTTTCCACGCGTTGCGCGTCAAGGCTTCCTTTGACTACCAGGCCT
TTCTCGTGGCCGACATTACATGGCTCGAGTTCCTCATGCACAATGTGCGCGAGAGTCACGGCGACCGGCTCGTGG
CCATGCTGGATGGCGAATCGGTGCAGGTGTTTGGCACCACGACATCGGCGGCCCAGGCCATGGCGCTCTACCAGG
CCGTGCAGAAGCTGATACAGGAGCGGAGGGAAAACTTTGACTCGTCGCTCCAGGAAATGGAAAGCTTGACCAAGG
GCACGTCTGCGTCAGGGTCGGCGGCGAGGGCGTCGCAGGCATGGCCAGCCGCAGCGGCCAAGCTTCCGGCAGACG
GCAGCGTGGCCAAGTCGCCCATATCGCTGGACACGGATGTCGTGGTGACGCTGAAGACGCTCAACCTGGCCGTGT
TTCCCAGCACCTTTTTGGACCACCAGGTGCTCAAGATGGAGGCTCTCAATGCCTATGCCAGGTTCGCAGCCAGCA
TGGAGCAGGGGCGCATCCACAGCATCCTCCGCATGACGCTGGGCCAGCTGCGCATTGGGTTGGCGGCGGTGCGAG
AGGCCGACGCGCCCAAGACGCTGAGCGACATGGGCATACAAGACGTGGTGCAGCGGGCGACGGGCTCGCGGGGCG
GAACCATTCTCAAGGTGCCGCGCGTCGAGGCCGTCATGGAGACGTGGCAGACGGCCGACAGCAACCACATTGACT
ATGTCTTTCGCAGCTCCTTTGAGGGCAAGGTGGAAGTGGGATGGAACTACTCGCGCATCAGCTACATCCGCGGCA
TGTGGGCCAACCATTCCAAGTCTCTGGAGCAGACGTGGGGGCGCCAGCTGCCCATGACGGCCGTCAAGATTCGTG
GCGTGCCCAAGGCCGAGGGGGAGCAGAAGCAAAAGATTACGGCCGAGGTCAAGGTGCCGCAGTCGCGCTACCACT
ACCAGCCACTGCAGCCGCCCGTCATTCAAACGCCCCAGCTGCGCGACATGGGCGAGGCGACGCCGCCCCTTGAGT
GGATTGGCTTGCAGCGAGAGCGGCTGCCCAATCTGACGCATCAGATTGTCATTGTGTCGCTGCTAGAGCTGGCGG
GCGAGGTTGAGGATGCATACTCGCGCATCCTGGGCTCGTCGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail