Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|5935
Gene name
LocationContig_5:205672..208490
Strand-
Gene length (bp)2818
Transcript length (bp)2535
Coding sequence length (bp)2535
Protein length (aa) 845

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00009 GTP_EFTU Elongation factor Tu GTP binding domain 5.6E-68 18 345
PF03764 EFG_IV Elongation factor G, domain IV 2.4E-31 605 721
PF00679 EFG_C Elongation factor G C-terminus 3.0E-21 725 807
PF03144 GTP_EFTU_D2 Elongation factor Tu domain 2 7.1E-12 396 471
PF14492 EFG_III Elongation Factor G, domain III 1.3E-11 488 549

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q96X45|EF2_NEUCR Elongation factor 2 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=cot-3 PE=3 SV=3 1 844 0.0E+00
sp|Q874B9|EF2_PICPA Elongation factor 2 OS=Komagataella pastoris GN=EFT1 PE=3 SV=1 1 844 0.0E+00
sp|Q875S0|EF2_LACK1 Elongation factor 2 OS=Lachancea kluyveri (strain ATCC 58438 / CBS 3082 / CCRC 21498 / NBRC 1685 / JCM 7257 / NCYC 543 / NRRL Y-12651) GN=EFT2 PE=3 SV=1 1 844 0.0E+00
sp|P32324|EF2_YEAST Elongation factor 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=EFT1 PE=1 SV=1 1 844 0.0E+00
sp|Q6FYA7|EF2_CANGA Elongation factor 2 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=EFT1 PE=3 SV=1 1 844 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q96X45|EF2_NEUCR Elongation factor 2 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=cot-3 PE=3 SV=3 1 844 0.0E+00
sp|Q874B9|EF2_PICPA Elongation factor 2 OS=Komagataella pastoris GN=EFT1 PE=3 SV=1 1 844 0.0E+00
sp|Q875S0|EF2_LACK1 Elongation factor 2 OS=Lachancea kluyveri (strain ATCC 58438 / CBS 3082 / CCRC 21498 / NBRC 1685 / JCM 7257 / NCYC 543 / NRRL Y-12651) GN=EFT2 PE=3 SV=1 1 844 0.0E+00
sp|P32324|EF2_YEAST Elongation factor 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=EFT1 PE=1 SV=1 1 844 0.0E+00
sp|Q6FYA7|EF2_CANGA Elongation factor 2 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=EFT1 PE=3 SV=1 1 844 0.0E+00
sp|Q6CPQ9|EF2_KLULA Elongation factor 2 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=EFT1 PE=3 SV=1 1 844 0.0E+00
sp|Q754C8|EF2_ASHGO Elongation factor 2 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=EFT1 PE=3 SV=1 1 844 0.0E+00
sp|O14460|EF2_SCHPO Elongation factor 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=eft201 PE=1 SV=2 1 844 0.0E+00
sp|Q875Z2|EF2_NAUCC Elongation factor 2 OS=Naumovozyma castellii (strain ATCC 76901 / CBS 4309 / NBRC 1992 / NRRL Y-12630) GN=EFT1 PE=3 SV=1 1 844 0.0E+00
sp|A5DI11|EF2_PICGU Elongation factor 2 OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=EFT2 PE=3 SV=1 1 844 0.0E+00
sp|Q6BJ25|EF2_DEBHA Elongation factor 2 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=EFT1 PE=3 SV=1 1 844 0.0E+00
sp|C4YJQ8|EF2_CANAW Elongation factor 2 OS=Candida albicans (strain WO-1) GN=EFT2 PE=3 SV=1 1 844 0.0E+00
sp|Q5A0M4|EF2_CANAL Elongation factor 2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=EFT2 PE=1 SV=2 1 844 0.0E+00
sp|Q90705|EF2_CHICK Elongation factor 2 OS=Gallus gallus GN=EEF2 PE=1 SV=3 1 844 0.0E+00
sp|P58252|EF2_MOUSE Elongation factor 2 OS=Mus musculus GN=Eef2 PE=1 SV=2 1 844 0.0E+00
sp|P05197|EF2_RAT Elongation factor 2 OS=Rattus norvegicus GN=Eef2 PE=1 SV=4 1 844 0.0E+00
sp|P29691|EF2_CAEEL Elongation factor 2 OS=Caenorhabditis elegans GN=eef-2 PE=2 SV=4 1 844 0.0E+00
sp|Q3SYU2|EF2_BOVIN Elongation factor 2 OS=Bos taurus GN=EEF2 PE=2 SV=3 1 844 0.0E+00
sp|A0SXL6|EF2_CALJA Elongation factor 2 OS=Callithrix jacchus GN=EEF2 PE=2 SV=1 1 844 0.0E+00
sp|P09445|EF2_CRIGR Elongation factor 2 OS=Cricetulus griseus GN=EEF2 PE=1 SV=4 1 844 0.0E+00
sp|Q5R8Z3|EF2_PONAB Elongation factor 2 OS=Pongo abelii GN=EEF2 PE=2 SV=3 1 844 0.0E+00
sp|P13639|EF2_HUMAN Elongation factor 2 OS=Homo sapiens GN=EEF2 PE=1 SV=4 1 844 0.0E+00
sp|P13060|EF2_DROME Elongation factor 2 OS=Drosophila melanogaster GN=EF2 PE=1 SV=4 1 844 0.0E+00
sp|Q1HPK6|EF2_BOMMO Translation elongation factor 2 OS=Bombyx mori GN=tef2 PE=1 SV=1 1 844 0.0E+00
sp|P15112|EF2_DICDI Elongation factor 2 OS=Dictyostelium discoideum GN=efbA PE=1 SV=2 1 844 0.0E+00
sp|Q23716|EF2_CRYPV Elongation factor 2 OS=Cryptosporidium parvum PE=3 SV=1 1 844 0.0E+00
sp|O23755|EF2_BETVU Elongation factor 2 OS=Beta vulgaris PE=2 SV=1 1 844 0.0E+00
sp|Q06193|EF2_ENTHI Elongation factor 2 OS=Entamoeba histolytica GN=EF-2 PE=2 SV=1 1 844 0.0E+00
sp|P28996|EF2_PARKE Elongation factor 2 OS=Parachlorella kessleri PE=2 SV=1 1 844 0.0E+00
sp|Q17152|EF2_BLAHO Elongation factor 2 OS=Blastocystis hominis PE=2 SV=1 1 844 0.0E+00
sp|Q8SQT7|EF2_ENCCU Elongation factor 2 OS=Encephalitozoon cuniculi (strain GB-M1) GN=EFT1 PE=1 SV=1 1 844 0.0E+00
sp|A4FUD3|U5S1_BOVIN 116 kDa U5 small nuclear ribonucleoprotein component OS=Bos taurus GN=EFTUD2 PE=2 SV=1 4 842 0.0E+00
sp|Q5F3X4|U5S1_CHICK 116 kDa U5 small nuclear ribonucleoprotein component OS=Gallus gallus GN=EFTUD2 PE=2 SV=1 4 842 0.0E+00
sp|O08810|U5S1_MOUSE 116 kDa U5 small nuclear ribonucleoprotein component OS=Mus musculus GN=Eftud2 PE=1 SV=1 4 842 0.0E+00
sp|Q15029|U5S1_HUMAN 116 kDa U5 small nuclear ribonucleoprotein component OS=Homo sapiens GN=EFTUD2 PE=1 SV=1 4 842 0.0E+00
sp|Q5R6E0|U5S1_PONAB 116 kDa U5 small nuclear ribonucleoprotein component OS=Pongo abelii GN=EFTUD2 PE=2 SV=1 4 842 0.0E+00
sp|O94316|SN114_SCHPO Pre-mRNA-splicing factor cwf10 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cwf10 PE=1 SV=2 11 843 8.0E-174
sp|A4YCV9|EF2_METS5 Elongation factor 2 OS=Metallosphaera sedula (strain ATCC 51363 / DSM 5348) GN=fusA PE=3 SV=1 5 840 2.0E-148
sp|O74945|RIA1_SCHPO Ribosome assembly protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ria1 PE=3 SV=1 7 838 4.0E-145
sp|O93632|EF2_METBU Elongation factor 2 OS=Methanococcoides burtonii (strain DSM 6242 / NBRC 107633 / OCM 468 / ACE-M) GN=fusA PE=3 SV=1 6 840 4.0E-145
sp|B1L7Q0|EF2_KORCO Elongation factor 2 OS=Korarchaeum cryptofilum (strain OPF8) GN=fusA PE=3 SV=1 6 844 4.0E-141
sp|Q5UZS7|EF2_HALMA Elongation factor 2 OS=Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) GN=fusA PE=3 SV=1 6 841 1.0E-135
sp|O59521|EF2_PYRHO Elongation factor 2 OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=fusA PE=1 SV=2 6 794 2.0E-135
sp|P61878|EF2_PYRWO Elongation factor 2 OS=Pyrococcus woesei GN=fusA PE=3 SV=1 6 794 2.0E-134
sp|P61877|EF2_PYRFU Elongation factor 2 OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=fusA PE=3 SV=1 6 794 2.0E-134
sp|Q9V1Z8|EF2_PYRAB Elongation factor 2 OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=fusA PE=3 SV=1 6 794 2.0E-133
sp|D3E3N9|EF2_METRM Elongation factor 2 OS=Methanobrevibacter ruminantium (strain ATCC 35063 / DSM 1093 / JCM 13430 / OCM 146 / M1) GN=fusA PE=3 SV=1 6 840 5.0E-122
sp|B8GJK8|EF2_METPE Elongation factor 2 OS=Methanosphaerula palustris (strain ATCC BAA-1556 / DSM 19958 / E1-9c) GN=fusA PE=3 SV=1 6 840 1.0E-119
sp|Q9YC19|EF2_AERPE Elongation factor 2 OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) GN=fusA PE=3 SV=1 5 839 4.0E-117
sp|A6VGV5|EF2_METM7 Elongation factor 2 OS=Methanococcus maripaludis (strain C7 / ATCC BAA-1331) GN=fusA PE=3 SV=1 6 833 2.0E-114
sp|Q74M52|EF2_NANEQ Elongation factor 2 OS=Nanoarchaeum equitans (strain Kin4-M) GN=fusA PE=3 SV=1 7 833 4.0E-114
sp|O93637|EF2_METMT Elongation factor 2 OS=Methanococcoides methylutens GN=fusA PE=3 SV=1 6 840 1.0E-112
sp|Q6LXI2|EF2_METMP Elongation factor 2 OS=Methanococcus maripaludis (strain S2 / LL) GN=fusA PE=3 SV=1 6 833 6.0E-112
sp|P09604|EF2_METVS Elongation factor 2 OS=Methanococcus vannielii (strain SB / ATCC 35089 / DSM 1224) GN=fusA PE=3 SV=2 6 833 2.0E-109
sp|A9A9U4|EF2_METM6 Elongation factor 2 OS=Methanococcus maripaludis (strain C6 / ATCC BAA-1332) GN=fusA PE=3 SV=1 6 833 2.0E-108
sp|O28385|EF2_ARCFU Elongation factor 2 OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=fusA PE=3 SV=1 330 840 5.0E-100
sp|B1YE08|EF2_PYRNV Elongation factor 2 OS=Pyrobaculum neutrophilum (strain DSM 2338 / JCM 9278 / V24Sta) GN=fusA PE=3 SV=1 329 842 2.0E-96
sp|A8ACA7|EF2_IGNH4 Elongation factor 2 OS=Ignicoccus hospitalis (strain KIN4/I / DSM 18386 / JCM 14125) GN=fusA PE=3 SV=1 330 840 4.0E-96
sp|Q975H5|EF2_SULTO Elongation factor 2 OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=fusA PE=3 SV=3 329 840 1.0E-93
sp|A1RVX2|EF2_PYRIL Elongation factor 2 OS=Pyrobaculum islandicum (strain DSM 4184 / JCM 9189 / GEO3) GN=fusA PE=3 SV=1 329 835 2.0E-93
sp|Q8ZZC1|EF2_PYRAE Elongation factor 2 OS=Pyrobaculum aerophilum (strain ATCC 51768 / IM2 / DSM 7523 / JCM 9630 / NBRC 100827) GN=fusA PE=3 SV=1 329 835 4.0E-93
sp|A3MSN3|EF2_PYRCJ Elongation factor 2 OS=Pyrobaculum calidifontis (strain JCM 11548 / VA1) GN=fusA PE=3 SV=1 329 842 6.0E-93
sp|A3DMV6|EF2_STAMF Elongation factor 2 OS=Staphylothermus marinus (strain ATCC 43588 / DSM 3639 / JCM 9404 / F1) GN=fusA PE=3 SV=1 312 840 1.0E-92
sp|A4WMR8|EF2_PYRAR Elongation factor 2 OS=Pyrobaculum arsenaticum (strain DSM 13514 / JCM 11321) GN=fusA PE=3 SV=1 329 835 1.0E-92
sp|C3NED6|EF2_SULIY Elongation factor 2 OS=Sulfolobus islandicus (strain Y.G.57.14 / Yellowstone #1) GN=fusA PE=3 SV=1 330 840 3.0E-92
sp|C3NHB6|EF2_SULIN Elongation factor 2 OS=Sulfolobus islandicus (strain Y.N.15.51 / Yellowstone #2) GN=fusA PE=3 SV=1 330 840 3.0E-92
sp|C3MVH1|EF2_SULIM Elongation factor 2 OS=Sulfolobus islandicus (strain M.14.25 / Kamchatka #1) GN=fusA PE=3 SV=1 330 840 3.0E-92
sp|C3MQ53|EF2_SULIL Elongation factor 2 OS=Sulfolobus islandicus (strain L.S.2.15 / Lassen #1) GN=fusA PE=3 SV=1 330 840 3.0E-92
sp|C4KHE9|EF2_SULIK Elongation factor 2 OS=Sulfolobus islandicus (strain M.16.4 / Kamchatka #3) GN=fusA PE=3 SV=1 330 840 3.0E-92
sp|C3N5S0|EF2_SULIA Elongation factor 2 OS=Sulfolobus islandicus (strain M.16.27) GN=fusA PE=3 SV=1 330 840 3.0E-92
sp|P30925|EF2_SULSO Elongation factor 2 OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=fusA PE=1 SV=3 330 840 4.0E-92
sp|A0B7D5|EF2_METTP Elongation factor 2 OS=Methanosaeta thermophila (strain DSM 6194 / JCM 14653 / NBRC 101360 / PT) GN=fusA PE=3 SV=1 337 840 2.0E-90
sp|Q8TRC3|EF2_METAC Elongation factor 2 OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=fusA PE=3 SV=1 330 840 2.0E-89
sp|Q8PUR7|EF2_METMA Elongation factor 2 OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=fusA PE=3 SV=1 330 840 2.0E-88
sp|P36048|SN114_YEAST Pre-mRNA-splicing factor SNU114 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SNU114 PE=1 SV=1 4 830 4.0E-88
sp|Q58448|EF2_METJA Elongation factor 2 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=fusA PE=3 SV=1 306 833 7.0E-88
sp|A7I4X4|EF2_METB6 Elongation factor 2 OS=Methanoregula boonei (strain 6A8) GN=fusA PE=3 SV=1 330 840 8.0E-88
sp|C6A4M0|EF2_THESM Elongation factor 2 OS=Thermococcus sibiricus (strain MM 739 / DSM 12597) GN=fusA PE=3 SV=1 325 835 1.0E-87
sp|Q464Z3|EF2_METBF Elongation factor 2 OS=Methanosarcina barkeri (strain Fusaro / DSM 804) GN=fusA PE=3 SV=1 330 840 2.0E-87
sp|A5ULM6|EF2_METS3 Elongation factor 2 OS=Methanobrevibacter smithii (strain PS / ATCC 35061 / DSM 861) GN=fusA PE=3 SV=1 311 840 4.0E-87
sp|Q8TXJ4|EF2_METKA Elongation factor 2 OS=Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938) GN=fusA PE=3 SV=1 306 842 2.0E-86
sp|P33159|EF2_DESMO Elongation factor 2 OS=Desulfurococcus mobilis GN=fusA PE=3 SV=1 312 840 4.0E-85
sp|B8D6B2|EF2_DESK1 Elongation factor 2 OS=Desulfurococcus kamchatkensis (strain 1221n / DSM 18924) GN=fusA PE=3 SV=1 312 840 6.0E-85
sp|O27131|EF2_METTH Elongation factor 2 OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=fusA PE=3 SV=2 307 840 8.0E-85
sp|A0RW30|EF2_CENSY Elongation factor 2 OS=Cenarchaeum symbiosum (strain A) GN=fusA PE=3 SV=1 330 843 3.0E-84
sp|P23112|EF2_SULAC Elongation factor 2 OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=fusA PE=1 SV=3 329 840 3.0E-84
sp|A3CXM8|EF2_METMJ Elongation factor 2 OS=Methanoculleus marisnigri (strain ATCC 35101 / DSM 1498 / JR1) GN=fusA PE=3 SV=1 330 840 4.0E-84
sp|O93640|EF2_METTE Elongation factor 2 OS=Methanosarcina thermophila GN=fusA PE=3 SV=1 330 840 1.0E-83
sp|Q5JFZ3|EF2_THEKO Elongation factor 2 OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=fusA PE=3 SV=1 325 794 5.0E-83
sp|Q6L200|EF2_PICTO Elongation factor 2 OS=Picrophilus torridus (strain ATCC 700027 / DSM 9790 / JCM 10055 / NBRC 100828) GN=fusA PE=3 SV=1 330 844 3.0E-82
sp|B6YVG5|EF2_THEON Elongation factor 2 OS=Thermococcus onnurineus (strain NA1) GN=fusA PE=3 SV=1 325 830 4.0E-82
sp|Q2NEL0|EF2_METST Elongation factor 2 OS=Methanosphaera stadtmanae (strain ATCC 43021 / DSM 3091 / JCM 11832 / MCB-3) GN=fusA PE=3 SV=1 306 840 3.0E-81
sp|C5A6N7|EF2_THEGJ Elongation factor 2 OS=Thermococcus gammatolerans (strain DSM 15229 / JCM 11827 / EJ3) GN=fusA PE=3 SV=1 325 794 9.0E-80
sp|P26752|EF2_THEAC Elongation factor 2 OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=fusA PE=3 SV=2 335 841 1.0E-79
sp|Q9HM85|EF2_HALSA Elongation factor 2 OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=fusA PE=3 SV=2 330 835 1.0E-78
sp|B0R8C8|EF2_HALS3 Elongation factor 2 OS=Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1) GN=fusA PE=3 SV=1 330 835 1.0E-78
sp|Q979T3|EF2_THEVO Elongation factor 2 OS=Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1) GN=fusA PE=3 SV=1 335 841 3.0E-77
sp|P53893|RIA1_YEAST Ribosome assembly protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RIA1 PE=1 SV=1 10 387 3.0E-77
sp|A4FWF0|EF2_METM5 Elongation factor 2 OS=Methanococcus maripaludis (strain C5 / ATCC BAA-1333) GN=fusA PE=3 SV=1 312 833 5.0E-77
sp|Q3IUM4|EF2_NATPD Elongation factor 2 OS=Natronomonas pharaonis (strain ATCC 35678 / DSM 2160) GN=fusA PE=3 SV=1 330 841 1.0E-76
sp|A6UV44|EF2_META3 Elongation factor 2 OS=Methanococcus aeolicus (strain Nankai-3 / ATCC BAA-1280) GN=fusA PE=3 SV=1 330 833 8.0E-76
sp|Q7Z2Z2|ETUD1_HUMAN Elongation factor Tu GTP-binding domain-containing protein 1 OS=Homo sapiens GN=EFTUD1 PE=1 SV=2 1 393 8.0E-74
sp|Q8C0D5|ETUD1_MOUSE Elongation factor Tu GTP-binding domain-containing protein 1 OS=Mus musculus GN=Eftud1 PE=1 SV=1 1 386 2.0E-73
sp|C7NYH7|EF2_HALMD Elongation factor 2 OS=Halomicrobium mukohataei (strain ATCC 700874 / DSM 12286 / JCM 9738 / NCIMB 13541) GN=fusA PE=3 SV=1 330 841 5.0E-72
sp|Q8C0D5|ETUD1_MOUSE Elongation factor Tu GTP-binding domain-containing protein 1 OS=Mus musculus GN=Eftud1 PE=1 SV=1 390 839 2.0E-62
sp|A1SNN6|EFG_NOCSJ Elongation factor G OS=Nocardioides sp. (strain BAA-499 / JS614) GN=fusA PE=3 SV=1 17 808 3.0E-56
sp|P53893|RIA1_YEAST Ribosome assembly protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RIA1 PE=1 SV=1 397 839 1.0E-55
sp|Q82DQ1|EFG_STRAW Elongation factor G OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=fusA PE=3 SV=1 17 806 1.0E-55
sp|A3DMV6|EF2_STAMF Elongation factor 2 OS=Staphylothermus marinus (strain ATCC 43588 / DSM 3639 / JCM 9404 / F1) GN=fusA PE=3 SV=1 8 224 4.0E-54
sp|Q1BDD4|EFG_MYCSS Elongation factor G OS=Mycobacterium sp. (strain MCS) GN=fusA PE=3 SV=1 17 806 1.0E-53
sp|A1UBL0|EFG_MYCSK Elongation factor G OS=Mycobacterium sp. (strain KMS) GN=fusA PE=3 SV=1 17 806 1.0E-53
sp|A3PV95|EFG_MYCSJ Elongation factor G OS=Mycobacterium sp. (strain JLS) GN=fusA PE=3 SV=1 17 806 1.0E-53
sp|P23112|EF2_SULAC Elongation factor 2 OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=fusA PE=1 SV=3 5 224 1.0E-52
sp|Q3IUM4|EF2_NATPD Elongation factor 2 OS=Natronomonas pharaonis (strain ATCC 35678 / DSM 2160) GN=fusA PE=3 SV=1 6 257 3.0E-52
sp|O28385|EF2_ARCFU Elongation factor 2 OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=fusA PE=3 SV=1 6 300 5.0E-52
sp|Q975H5|EF2_SULTO Elongation factor 2 OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=fusA PE=3 SV=3 5 224 5.0E-52
sp|Q7NAV3|EFG_MYCGA Elongation factor G OS=Mycoplasma gallisepticum (strain R(low / passage 15 / clone 2)) GN=fusA PE=3 SV=2 20 806 7.0E-52
sp|A7I4X4|EF2_METB6 Elongation factor 2 OS=Methanoregula boonei (strain 6A8) GN=fusA PE=3 SV=1 5 245 1.0E-51
sp|C5A6N7|EF2_THEGJ Elongation factor 2 OS=Thermococcus gammatolerans (strain DSM 15229 / JCM 11827 / EJ3) GN=fusA PE=3 SV=1 6 244 1.0E-51
sp|Q9HM85|EF2_HALSA Elongation factor 2 OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=fusA PE=3 SV=2 6 236 3.0E-51
sp|B0R8C8|EF2_HALS3 Elongation factor 2 OS=Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1) GN=fusA PE=3 SV=1 6 236 3.0E-51
sp|Q5JFZ3|EF2_THEKO Elongation factor 2 OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=fusA PE=3 SV=1 6 237 4.0E-51
sp|C3NED6|EF2_SULIY Elongation factor 2 OS=Sulfolobus islandicus (strain Y.G.57.14 / Yellowstone #1) GN=fusA PE=3 SV=1 5 224 5.0E-51
sp|C3NHB6|EF2_SULIN Elongation factor 2 OS=Sulfolobus islandicus (strain Y.N.15.51 / Yellowstone #2) GN=fusA PE=3 SV=1 5 224 5.0E-51
sp|C3MVH1|EF2_SULIM Elongation factor 2 OS=Sulfolobus islandicus (strain M.14.25 / Kamchatka #1) GN=fusA PE=3 SV=1 5 224 5.0E-51
sp|C3MQ53|EF2_SULIL Elongation factor 2 OS=Sulfolobus islandicus (strain L.S.2.15 / Lassen #1) GN=fusA PE=3 SV=1 5 224 5.0E-51
sp|C4KHE9|EF2_SULIK Elongation factor 2 OS=Sulfolobus islandicus (strain M.16.4 / Kamchatka #3) GN=fusA PE=3 SV=1 5 224 5.0E-51
sp|C3N5S0|EF2_SULIA Elongation factor 2 OS=Sulfolobus islandicus (strain M.16.27) GN=fusA PE=3 SV=1 5 224 5.0E-51
sp|P30925|EF2_SULSO Elongation factor 2 OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=fusA PE=1 SV=3 5 224 1.0E-50
sp|C7NYH7|EF2_HALMD Elongation factor 2 OS=Halomicrobium mukohataei (strain ATCC 700874 / DSM 12286 / JCM 9738 / NCIMB 13541) GN=fusA PE=3 SV=1 6 236 1.0E-50
sp|A8GMA0|EFG_RICAH Elongation factor G OS=Rickettsia akari (strain Hartford) GN=fusA PE=3 SV=1 13 806 1.0E-50
sp|C6A4M0|EF2_THESM Elongation factor 2 OS=Thermococcus sibiricus (strain MM 739 / DSM 12597) GN=fusA PE=3 SV=1 6 237 2.0E-50
sp|A4XBP9|EFG_SALTO Elongation factor G OS=Salinispora tropica (strain ATCC BAA-916 / DSM 44818 / CNB-440) GN=fusA PE=3 SV=1 11 807 3.0E-50
sp|A8M532|EFG_SALAI Elongation factor G OS=Salinispora arenicola (strain CNS-205) GN=fusA PE=3 SV=1 11 806 3.0E-50
sp|O27131|EF2_METTH Elongation factor 2 OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=fusA PE=3 SV=2 6 224 5.0E-50
sp|B6YVG5|EF2_THEON Elongation factor 2 OS=Thermococcus onnurineus (strain NA1) GN=fusA PE=3 SV=1 6 244 6.0E-50
sp|A4WMR8|EF2_PYRAR Elongation factor 2 OS=Pyrobaculum arsenaticum (strain DSM 13514 / JCM 11321) GN=fusA PE=3 SV=1 1 224 1.0E-49
sp|A8ACA7|EF2_IGNH4 Elongation factor 2 OS=Ignicoccus hospitalis (strain KIN4/I / DSM 18386 / JCM 14125) GN=fusA PE=3 SV=1 6 224 3.0E-49
sp|C1A6Q2|EFG_GEMAT Elongation factor G OS=Gemmatimonas aurantiaca (strain T-27 / DSM 14586 / JCM 11422 / NBRC 100505) GN=fusA PE=3 SV=1 18 817 5.0E-49
sp|A5I7K9|EFG_CLOBH Elongation factor G OS=Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A) GN=fusA PE=3 SV=1 17 806 6.0E-49
sp|A7FZ72|EFG_CLOB1 Elongation factor G OS=Clostridium botulinum (strain ATCC 19397 / Type A) GN=fusA PE=3 SV=1 17 806 6.0E-49
sp|A7GJ77|EFG_CLOBL Elongation factor G OS=Clostridium botulinum (strain Langeland / NCTC 10281 / Type F) GN=fusA PE=3 SV=1 17 806 6.0E-49
sp|B1IGF7|EFG_CLOBK Elongation factor G OS=Clostridium botulinum (strain Okra / Type B1) GN=fusA PE=3 SV=1 17 806 6.0E-49
sp|B8D6B2|EF2_DESK1 Elongation factor 2 OS=Desulfurococcus kamchatkensis (strain 1221n / DSM 18924) GN=fusA PE=3 SV=1 1 224 8.0E-49
sp|Q046C7|EFG_LACGA Elongation factor G OS=Lactobacillus gasseri (strain ATCC 33323 / DSM 20243 / JCM 1131 / NCIMB 11718 / AM63) GN=fusA PE=3 SV=1 19 806 1.0E-48
sp|Q58448|EF2_METJA Elongation factor 2 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=fusA PE=3 SV=1 6 237 2.0E-48
sp|Q8KTB4|EFG_RICHE Elongation factor G OS=Rickettsia helvetica GN=fusA PE=3 SV=1 13 806 2.0E-48
sp|A1RVX2|EF2_PYRIL Elongation factor 2 OS=Pyrobaculum islandicum (strain DSM 4184 / JCM 9189 / GEO3) GN=fusA PE=3 SV=1 1 224 3.0E-48
sp|A3MSN3|EF2_PYRCJ Elongation factor 2 OS=Pyrobaculum calidifontis (strain JCM 11548 / VA1) GN=fusA PE=3 SV=1 1 224 3.0E-48
sp|A6UV44|EF2_META3 Elongation factor 2 OS=Methanococcus aeolicus (strain Nankai-3 / ATCC BAA-1280) GN=fusA PE=3 SV=1 6 224 3.0E-48
sp|C3PMH0|EFG_RICAE Elongation factor G OS=Rickettsia africae (strain ESF-5) GN=fusA PE=3 SV=1 13 806 3.0E-48
sp|Q9CDG1|EFG_LACLA Elongation factor G OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=fusA PE=3 SV=1 17 806 3.0E-48
sp|C4K1P6|EFG_RICPU Elongation factor G OS=Rickettsia peacockii (strain Rustic) GN=fusA PE=3 SV=1 13 806 3.0E-48
sp|A2RP72|EFG_LACLM Elongation factor G OS=Lactococcus lactis subsp. cremoris (strain MG1363) GN=fusA PE=3 SV=1 17 806 3.0E-48
sp|Q8ZZC1|EF2_PYRAE Elongation factor 2 OS=Pyrobaculum aerophilum (strain ATCC 51768 / IM2 / DSM 7523 / JCM 9630 / NBRC 100827) GN=fusA PE=3 SV=1 1 224 5.0E-48
sp|Q92J93|EFG_RICCN Elongation factor G OS=Rickettsia conorii (strain ATCC VR-613 / Malish 7) GN=fusA PE=3 SV=1 13 806 5.0E-48
sp|Q74L90|EFG_LACJO Elongation factor G OS=Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533) GN=fusA PE=3 SV=1 19 818 5.0E-48
sp|B1YE08|EF2_PYRNV Elongation factor 2 OS=Pyrobaculum neutrophilum (strain DSM 2338 / JCM 9278 / V24Sta) GN=fusA PE=3 SV=1 1 224 7.0E-48
sp|Q73R08|EFG1_TREDE Elongation factor G 1 OS=Treponema denticola (strain ATCC 35405 / CIP 103919 / DSM 14222) GN=fusA1 PE=3 SV=1 12 804 8.0E-48
sp|A5ULM6|EF2_METS3 Elongation factor 2 OS=Methanobrevibacter smithii (strain PS / ATCC 35061 / DSM 861) GN=fusA PE=3 SV=1 6 224 1.0E-47
sp|Q6L200|EF2_PICTO Elongation factor 2 OS=Picrophilus torridus (strain ATCC 700027 / DSM 9790 / JCM 10055 / NBRC 100828) GN=fusA PE=3 SV=1 12 224 1.0E-47
sp|Q8KTA8|EFG_RICFE Elongation factor G OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=fusA PE=3 SV=2 13 806 1.0E-47
sp|Q8G5B6|EFG_BIFLO Elongation factor G OS=Bifidobacterium longum (strain NCC 2705) GN=fusA PE=3 SV=1 18 806 1.0E-47
sp|B3DT30|EFG_BIFLD Elongation factor G OS=Bifidobacterium longum (strain DJO10A) GN=fusA PE=3 SV=1 18 806 1.0E-47
sp|Q4AAQ6|EFG_MYCHJ Elongation factor G OS=Mycoplasma hyopneumoniae (strain J / ATCC 25934 / NCTC 10110) GN=fusA PE=3 SV=2 18 806 1.0E-47
sp|Q4A8T7|EFG_MYCH7 Elongation factor G OS=Mycoplasma hyopneumoniae (strain 7448) GN=fusA PE=3 SV=2 18 806 1.0E-47
sp|Q601W8|EFG_MYCH2 Elongation factor G OS=Mycoplasma hyopneumoniae (strain 232) GN=fusA PE=3 SV=1 18 806 1.0E-47
sp|Q0BSG5|EFG_GRABC Elongation factor G OS=Granulibacter bethesdensis (strain ATCC BAA-1260 / CGDNIH1) GN=fusA PE=3 SV=1 13 806 2.0E-47
sp|A7HWQ8|EFG_PARL1 Elongation factor G OS=Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966) GN=fusA PE=3 SV=1 15 806 4.0E-47
sp|A4FWF0|EF2_METM5 Elongation factor 2 OS=Methanococcus maripaludis (strain C5 / ATCC BAA-1333) GN=fusA PE=3 SV=1 6 224 5.0E-47
sp|Q8KTB9|EFG_RICPA Elongation factor G OS=Rickettsia parkeri GN=fusA PE=3 SV=1 13 806 6.0E-47
sp|Q979T3|EF2_THEVO Elongation factor 2 OS=Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1) GN=fusA PE=3 SV=1 19 228 3.0E-46
sp|Q5FUP6|EFG_GLUOX Elongation factor G OS=Gluconobacter oxydans (strain 621H) GN=fusA PE=3 SV=1 17 806 3.0E-46
sp|A8YXK3|EFG_LACH4 Elongation factor G OS=Lactobacillus helveticus (strain DPC 4571) GN=fusA PE=3 SV=1 17 818 5.0E-46
sp|B3EUF3|EFG_AMOA5 Elongation factor G OS=Amoebophilus asiaticus (strain 5a2) GN=fusA PE=3 SV=1 19 806 7.0E-46
sp|Q8KTB6|EFG_RICMO Elongation factor G OS=Rickettsia montanensis GN=fusA PE=3 SV=1 13 806 7.0E-46
sp|B2J5B0|EFG_NOSP7 Elongation factor G OS=Nostoc punctiforme (strain ATCC 29133 / PCC 73102) GN=fusA PE=3 SV=1 19 806 8.0E-46
sp|P26752|EF2_THEAC Elongation factor 2 OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=fusA PE=3 SV=2 19 228 1.0E-45
sp|P33159|EF2_DESMO Elongation factor 2 OS=Desulfurococcus mobilis GN=fusA PE=3 SV=1 1 224 2.0E-45
sp|Q0I0A8|EFG1_SHESR Elongation factor G 1 OS=Shewanella sp. (strain MR-7) GN=fusA1 PE=3 SV=1 20 793 2.0E-45
sp|Q0HNU0|EFG1_SHESM Elongation factor G 1 OS=Shewanella sp. (strain MR-4) GN=fusA1 PE=3 SV=1 20 793 2.0E-45
sp|B8G6S9|EFG_CHLAD Elongation factor G OS=Chloroflexus aggregans (strain MD-66 / DSM 9485) GN=fusA PE=3 SV=1 18 806 3.0E-45
sp|B1GZ80|EFG_UNCTG Elongation factor G OS=Uncultured termite group 1 bacterium phylotype Rs-D17 GN=fusA PE=3 SV=1 17 806 5.0E-45
sp|P18667|EFG_SYNP6 Elongation factor G OS=Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1) GN=fusA PE=3 SV=1 19 806 9.0E-45
sp|Q31PV4|EFG_SYNE7 Elongation factor G OS=Synechococcus elongatus (strain PCC 7942) GN=fusA PE=3 SV=1 19 806 9.0E-45
sp|A3CXM8|EF2_METMJ Elongation factor 2 OS=Methanoculleus marisnigri (strain ATCC 35101 / DSM 1498 / JR1) GN=fusA PE=3 SV=1 6 264 1.0E-44
sp|Q7UZY6|EFG_PROMP Elongation factor G OS=Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / MED4) GN=fusA PE=3 SV=1 19 806 3.0E-44
sp|Q464Z3|EF2_METBF Elongation factor 2 OS=Methanosarcina barkeri (strain Fusaro / DSM 804) GN=fusA PE=3 SV=1 6 224 4.0E-44
sp|A0RW30|EF2_CENSY Elongation factor 2 OS=Cenarchaeum symbiosum (strain A) GN=fusA PE=3 SV=1 1 224 4.0E-44
sp|Q839G9|EFG_ENTFA Elongation factor G OS=Enterococcus faecalis (strain ATCC 700802 / V583) GN=fusA PE=3 SV=1 20 806 5.0E-44
sp|Q8TRC3|EF2_METAC Elongation factor 2 OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=fusA PE=3 SV=1 6 224 1.0E-43
sp|Q8PUR7|EF2_METMA Elongation factor 2 OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=fusA PE=3 SV=1 6 244 1.0E-43
sp|Q9ZEU4|EFG_APPPP Elongation factor G OS=Apple proliferation phytoplasma GN=fusA PE=3 SV=1 20 793 1.0E-43
sp|O93640|EF2_METTE Elongation factor 2 OS=Methanosarcina thermophila GN=fusA PE=3 SV=1 6 224 2.0E-43
sp|Q2NEL0|EF2_METST Elongation factor 2 OS=Methanosphaera stadtmanae (strain ATCC 43021 / DSM 3091 / JCM 11832 / MCB-3) GN=fusA PE=3 SV=1 6 224 5.0E-43
sp|Q1IX68|EFG_DEIGD Elongation factor G OS=Deinococcus geothermalis (strain DSM 11300) GN=fusA PE=3 SV=1 17 806 9.0E-43
sp|B0CH35|EFG_BRUSI Elongation factor G OS=Brucella suis (strain ATCC 23445 / NCTC 10510) GN=fusA PE=3 SV=1 15 806 2.0E-42
sp|Q089Q7|EFG1_SHEFN Elongation factor G 1 OS=Shewanella frigidimarina (strain NCIMB 400) GN=fusA1 PE=3 SV=1 20 793 2.0E-42
sp|A2BT84|EFG_PROMS Elongation factor G OS=Prochlorococcus marinus (strain AS9601) GN=fusA PE=3 SV=1 19 806 3.0E-42
sp|A2BYN5|EFG_PROM5 Elongation factor G OS=Prochlorococcus marinus (strain MIT 9515) GN=fusA PE=3 SV=1 19 806 4.0E-41
sp|A0B7D5|EF2_METTP Elongation factor 2 OS=Methanosaeta thermophila (strain DSM 6194 / JCM 14653 / NBRC 101360 / PT) GN=fusA PE=3 SV=1 7 227 9.0E-41
sp|B8HVR8|EFG_CYAP4 Elongation factor G OS=Cyanothece sp. (strain PCC 7425 / ATCC 29141) GN=fusA PE=3 SV=1 19 806 4.0E-40
sp|Q5L6S5|EFG_CHLAB Elongation factor G OS=Chlamydophila abortus (strain DSM 27085 / S26/3) GN=fusA PE=3 SV=1 17 793 5.0E-40
sp|Q7Z2Z2|ETUD1_HUMAN Elongation factor Tu GTP-binding domain-containing protein 1 OS=Homo sapiens GN=EFTUD1 PE=1 SV=2 390 687 1.0E-39
sp|A9NEN3|EFG_ACHLI Elongation factor G OS=Acholeplasma laidlawii (strain PG-8A) GN=fusA PE=3 SV=1 20 576 1.0E-39
sp|Q8TXJ4|EF2_METKA Elongation factor 2 OS=Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938) GN=fusA PE=3 SV=1 21 224 4.0E-39
sp|Q9Z802|EFG_CHLPN Elongation factor G OS=Chlamydia pneumoniae GN=fusA PE=3 SV=1 17 793 8.0E-39
sp|A6ZQM4|RRF2M_YEAS7 Ribosome-releasing factor 2, mitochondrial OS=Saccharomyces cerevisiae (strain YJM789) GN=MEF2 PE=3 SV=1 17 752 7.0E-35
sp|P39677|RRF2M_YEAST Ribosome-releasing factor 2, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MEF2 PE=1 SV=1 17 752 9.0E-35
sp|B3LQ11|RRF2M_YEAS1 Ribosome-releasing factor 2, mitochondrial OS=Saccharomyces cerevisiae (strain RM11-1a) GN=MEF2 PE=3 SV=1 17 752 9.0E-35
sp|Q8YP62|EFG_NOSS1 Elongation factor G OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=fusA PE=3 SV=1 19 569 4.0E-33
sp|Q9PJV6|EFG_CHLMU Elongation factor G OS=Chlamydia muridarum (strain MoPn / Nigg) GN=fusA PE=3 SV=1 19 572 1.0E-32
sp|Q253F1|EFG_CHLFF Elongation factor G OS=Chlamydophila felis (strain Fe/C-56) GN=fusA PE=3 SV=1 17 568 1.0E-32
sp|Q824G0|EFG_CHLCV Elongation factor G OS=Chlamydophila caviae (strain GPIC) GN=fusA PE=3 SV=1 17 573 4.0E-32
sp|Q8R2Q4|RRF2M_MOUSE Ribosome-releasing factor 2, mitochondrial OS=Mus musculus GN=Gfm2 PE=1 SV=2 6 819 1.0E-31
sp|Q969S9|RRF2M_HUMAN Ribosome-releasing factor 2, mitochondrial OS=Homo sapiens GN=GFM2 PE=1 SV=1 1 793 4.0E-31
sp|A6QNM2|RRF2M_BOVIN Ribosome-releasing factor 2, mitochondrial OS=Bos taurus GN=GFM2 PE=2 SV=1 1 819 1.0E-29
sp|P28371|EFG1_SYNY3 Elongation factor G 1 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=fusA PE=1 SV=2 374 828 7.0E-29
sp|Q04ED6|EFG_OENOB Elongation factor G OS=Oenococcus oeni (strain ATCC BAA-331 / PSU-1) GN=fusA PE=3 SV=1 335 806 1.0E-28
sp|Q5R600|RRF2M_PONAB Ribosome-releasing factor 2, mitochondrial OS=Pongo abelii GN=GFM2 PE=2 SV=1 1 793 2.0E-28
sp|P40173|EFG1_STRCO Elongation factor G 1 OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=fusA PE=3 SV=2 335 806 3.0E-28
sp|Q03ZQ2|EFG_LEUMM Elongation factor G OS=Leuconostoc mesenteroides subsp. mesenteroides (strain ATCC 8293 / NCDO 523) GN=fusA PE=3 SV=1 335 806 7.0E-28
sp|Q1D777|EFG2_MYXXD Elongation factor G 2 OS=Myxococcus xanthus (strain DK 1622) GN=fusA2 PE=3 SV=1 335 806 1.0E-27
sp|B2GIL1|EFG_KOCRD Elongation factor G OS=Kocuria rhizophila (strain ATCC 9341 / DSM 348 / NBRC 103217 / DC2201) GN=fusA PE=3 SV=1 335 806 1.0E-27
sp|B1W417|EFG_STRGG Elongation factor G OS=Streptomyces griseus subsp. griseus (strain JCM 4626 / NBRC 13350) GN=fusA PE=3 SV=1 335 806 2.0E-27
sp|Q9ZLZ3|TYPA_HELPJ GTP-binding protein TypA/BipA homolog OS=Helicobacter pylori (strain J99 / ATCC 700824) GN=typA PE=3 SV=1 18 168 3.0E-27
sp|O25225|TYPA_HELPY GTP-binding protein TypA/BipA homolog OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=typA PE=3 SV=1 18 168 3.0E-27
sp|Q3BWY7|EFG_XANC5 Elongation factor G OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) GN=fusA PE=3 SV=1 334 806 4.0E-27
sp|B1MW21|EFG_LEUCK Elongation factor G OS=Leuconostoc citreum (strain KM20) GN=fusA PE=3 SV=1 335 806 4.0E-27
sp|Q8KTB2|EFG_RICTY Elongation factor G OS=Rickettsia typhi (strain ATCC VR-144 / Wilmington) GN=fusA PE=3 SV=2 398 806 4.0E-27
sp|Q8PNS6|EFG_XANAC Elongation factor G OS=Xanthomonas axonopodis pv. citri (strain 306) GN=fusA PE=3 SV=1 334 806 4.0E-27
sp|Q0TNS2|LEPA_CLOP1 Elongation factor 4 OS=Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A) GN=lepA PE=3 SV=1 13 165 4.0E-27
sp|Q0SRD8|LEPA_CLOPS Elongation factor 4 OS=Clostridium perfringens (strain SM101 / Type A) GN=lepA PE=3 SV=1 13 165 5.0E-27
sp|Q8XIS6|LEPA_CLOPE Elongation factor 4 OS=Clostridium perfringens (strain 13 / Type A) GN=lepA PE=3 SV=1 13 165 5.0E-27
sp|B4SKW0|EFG_STRM5 Elongation factor G OS=Stenotrophomonas maltophilia (strain R551-3) GN=fusA PE=3 SV=1 334 806 6.0E-27
sp|Q5GWS9|EFG_XANOR Elongation factor G OS=Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85) GN=fusA PE=3 SV=2 334 806 8.0E-27
sp|Q2NZY2|EFG_XANOM Elongation factor G OS=Xanthomonas oryzae pv. oryzae (strain MAFF 311018) GN=fusA PE=3 SV=1 334 806 8.0E-27
sp|Q1R0H8|EFG_CHRSD Elongation factor G OS=Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIMB 13768) GN=fusA PE=3 SV=1 334 806 8.0E-27
sp|A6TSM4|LEPA_ALKMQ Elongation factor 4 OS=Alkaliphilus metalliredigens (strain QYMF) GN=lepA PE=3 SV=1 14 163 2.0E-26
sp|P41084|EFG_RICPR Elongation factor G OS=Rickettsia prowazekii (strain Madrid E) GN=fusA PE=3 SV=3 398 806 3.0E-26
sp|Q83NA0|EFG_TROW8 Elongation factor G OS=Tropheryma whipplei (strain TW08/27) GN=fusA PE=3 SV=1 400 806 4.0E-26
sp|A0LRL7|EFG_ACIC1 Elongation factor G OS=Acidothermus cellulolyticus (strain ATCC 43068 / 11B) GN=fusA PE=3 SV=1 335 806 4.0E-26
sp|Q83FP1|EFG_TROWT Elongation factor G OS=Tropheryma whipplei (strain Twist) GN=fusA PE=3 SV=1 400 806 5.0E-26
sp|Q10W80|EFG2_TRIEI Elongation factor G 2 OS=Trichodesmium erythraeum (strain IMS101) GN=fusA2 PE=3 SV=1 335 806 5.0E-26
sp|A6Q241|LEPA_NITSB Elongation factor 4 OS=Nitratiruptor sp. (strain SB155-2) GN=lepA PE=3 SV=1 18 163 5.0E-26
sp|A7GZW3|LEPA_CAMC5 Elongation factor 4 OS=Campylobacter curvus (strain 525.92) GN=lepA PE=3 SV=1 18 176 5.0E-26
sp|O07631|TYPA_BACSU GTP-binding protein TypA/BipA homolog OS=Bacillus subtilis (strain 168) GN=typA PE=3 SV=1 17 221 6.0E-26
sp|Q8DCQ8|EFG_VIBVU Elongation factor G OS=Vibrio vulnificus (strain CMCP6) GN=fusA PE=3 SV=1 334 804 9.0E-26
sp|Q7MH42|EFG1_VIBVY Elongation factor G 1 OS=Vibrio vulnificus (strain YJ016) GN=fusA1 PE=3 SV=1 334 804 9.0E-26
sp|Q17X87|LEPA_HELAH Elongation factor 4 OS=Helicobacter acinonychis (strain Sheeba) GN=lepA PE=3 SV=1 18 188 1.0E-25
sp|Q98QD8|EFG_MYCPU Elongation factor G OS=Mycoplasma pulmonis (strain UAB CTIP) GN=fusA PE=3 SV=2 398 806 1.0E-25
sp|B4UDQ7|LEPA_ANASK Elongation factor 4 OS=Anaeromyxobacter sp. (strain K) GN=lepA PE=3 SV=1 12 163 1.0E-25
sp|A7TPD4|GUF1_VANPO Translation factor GUF1, mitochondrial OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=GUF1 PE=3 SV=1 18 180 1.0E-25
sp|B9DVS2|EFG_STRU0 Elongation factor G OS=Streptococcus uberis (strain ATCC BAA-854 / 0140J) GN=fusA PE=3 SV=1 335 806 1.0E-25
sp|Q2IIA6|LEPA_ANADE Elongation factor 4 OS=Anaeromyxobacter dehalogenans (strain 2CP-C) GN=lepA PE=3 SV=1 12 163 1.0E-25
sp|B8JAF3|LEPA_ANAD2 Elongation factor 4 OS=Anaeromyxobacter dehalogenans (strain 2CP-1 / ATCC BAA-258) GN=lepA PE=3 SV=1 12 163 1.0E-25
sp|Q6AL53|LEPA_DESPS Elongation factor 4 OS=Desulfotalea psychrophila (strain LSv54 / DSM 12343) GN=lepA PE=3 SV=1 18 163 1.0E-25
sp|Q5ZYP6|EFG_LEGPH Elongation factor G OS=Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) GN=fusA PE=3 SV=1 398 793 1.0E-25
sp|Q5X862|EFG_LEGPA Elongation factor G OS=Legionella pneumophila (strain Paris) GN=fusA PE=3 SV=1 398 793 1.0E-25
sp|A5IHR7|EFG_LEGPC Elongation factor G OS=Legionella pneumophila (strain Corby) GN=fusA PE=3 SV=1 398 793 2.0E-25
sp|Q5WZL5|EFG_LEGPL Elongation factor G OS=Legionella pneumophila (strain Lens) GN=fusA PE=3 SV=1 398 793 2.0E-25
sp|Q1QR19|LEPA_NITHX Elongation factor 4 OS=Nitrobacter hamburgensis (strain X14 / DSM 10229) GN=lepA PE=3 SV=1 7 163 2.0E-25
sp|B2FQ42|EFG_STRMK Elongation factor G OS=Stenotrophomonas maltophilia (strain K279a) GN=fusA PE=3 SV=1 371 806 2.0E-25
sp|Q7M8H5|LEPA_WOLSU Elongation factor 4 OS=Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / LMG 7466 / NCTC 11488 / FDC 602W) GN=lepA PE=3 SV=1 18 163 2.0E-25
sp|A0RQX4|LEPA_CAMFF Elongation factor 4 OS=Campylobacter fetus subsp. fetus (strain 82-40) GN=lepA PE=3 SV=1 17 176 2.0E-25
sp|B2USI5|LEPA_HELPS Elongation factor 4 OS=Helicobacter pylori (strain Shi470) GN=lepA PE=3 SV=1 18 163 3.0E-25
sp|C5Z3W1|GUF1_SORBI Translation factor GUF1 homolog, mitochondrial OS=Sorghum bicolor GN=Sb10g003070 PE=3 SV=1 16 180 3.0E-25
sp|C6BST2|LEPA_DESAD Elongation factor 4 OS=Desulfovibrio salexigens (strain ATCC 14822 / DSM 2638 / NCIB 8403 / VKM B-1763) GN=lepA PE=3 SV=1 13 163 4.0E-25
sp|A7ZCJ3|LEPA_CAMC1 Elongation factor 4 OS=Campylobacter concisus (strain 13826) GN=lepA PE=3 SV=1 18 163 4.0E-25
sp|B8B2R1|GUF1_ORYSI Translation factor GUF1 homolog, mitochondrial OS=Oryza sativa subsp. indica GN=OsI_21607 PE=3 SV=1 16 164 4.0E-25
sp|Q4DKF7|GUF11_TRYCC Translation factor GUF1 homolog 1, mitochondrial OS=Trypanosoma cruzi (strain CL Brener) GN=Tc00.1047053503697.90 PE=3 SV=1 16 179 5.0E-25
sp|Q4DZ91|GUF12_TRYCC Translation factor GUF1 homolog 2, mitochondrial OS=Trypanosoma cruzi (strain CL Brener) GN=Tc00.1047053504105.210 PE=3 SV=1 16 179 5.0E-25
sp|Q892Q6|LEPA_CLOTE Elongation factor 4 OS=Clostridium tetani (strain Massachusetts / E88) GN=lepA PE=3 SV=2 14 163 5.0E-25
sp|Q5VQ69|GUF1_ORYSJ Translation factor GUF1 homolog, mitochondrial OS=Oryza sativa subsp. japonica GN=Os06g0144800 PE=3 SV=1 16 164 5.0E-25
sp|Q5FM92|EFG_LACAC Elongation factor G OS=Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM) GN=fusA PE=3 SV=1 335 818 6.0E-25
sp|Q30Q17|LEPA_SULDN Elongation factor 4 OS=Sulfurimonas denitrificans (strain ATCC 33889 / DSM 1251) GN=lepA PE=3 SV=1 18 163 6.0E-25
sp|B1I1I5|EFG_DESAP Elongation factor G OS=Desulforudis audaxviator (strain MP104C) GN=fusA PE=3 SV=1 335 806 6.0E-25
sp|Q8PB55|LEPA_XANCP Elongation factor 4 OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=lepA PE=3 SV=1 14 176 7.0E-25
sp|Q1D6M1|LEPA_MYXXD Elongation factor 4 OS=Myxococcus xanthus (strain DK 1622) GN=lepA PE=3 SV=1 17 163 7.0E-25
sp|A0Q1R8|LEPA_CLONN Elongation factor 4 OS=Clostridium novyi (strain NT) GN=lepA PE=3 SV=1 14 163 7.0E-25
sp|B0RX30|LEPA_XANCB Elongation factor 4 OS=Xanthomonas campestris pv. campestris (strain B100) GN=lepA PE=3 SV=1 14 176 7.0E-25
sp|Q4USF4|LEPA_XANC8 Elongation factor 4 OS=Xanthomonas campestris pv. campestris (strain 8004) GN=lepA PE=3 SV=1 14 176 7.0E-25
sp|C4Z9E3|LEPA_EUBR3 Elongation factor 4 OS=Eubacterium rectale (strain ATCC 33656 / VPI 0990) GN=lepA PE=3 SV=1 17 163 9.0E-25
sp|Q87C09|LEPA_XYLFT Elongation factor 4 OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=lepA PE=3 SV=1 14 163 9.0E-25
sp|B2I601|LEPA_XYLF2 Elongation factor 4 OS=Xylella fastidiosa (strain M23) GN=lepA PE=3 SV=1 14 163 9.0E-25
sp|B6JKS8|LEPA_HELP2 Elongation factor 4 OS=Helicobacter pylori (strain P12) GN=lepA PE=3 SV=1 18 175 9.0E-25
sp|Q9PBA1|LEPA_XYLFA Elongation factor 4 OS=Xylella fastidiosa (strain 9a5c) GN=lepA PE=3 SV=1 14 176 9.0E-25
sp|B9LJC8|EFG_CHLSY Elongation factor G OS=Chloroflexus aurantiacus (strain ATCC 29364 / DSM 637 / Y-400-fl) GN=fusA PE=3 SV=1 335 806 9.0E-25
sp|A9WH62|EFG_CHLAA Elongation factor G OS=Chloroflexus aurantiacus (strain ATCC 29366 / DSM 635 / J-10-fl) GN=fusA PE=3 SV=1 335 806 9.0E-25
sp|B0U3D5|LEPA_XYLFM Elongation factor 4 OS=Xylella fastidiosa (strain M12) GN=lepA PE=3 SV=1 14 163 9.0E-25
sp|A7H311|LEPA_CAMJD Elongation factor 4 OS=Campylobacter jejuni subsp. doylei (strain ATCC BAA-1458 / RM4099 / 269.97) GN=lepA PE=3 SV=1 18 163 9.0E-25
sp|Q6FZB9|EFG_BARQU Elongation factor G OS=Bartonella quintana (strain Toulouse) GN=fusA PE=3 SV=1 335 816 1.0E-24
sp|Q9ZM93|LEPA_HELPJ Elongation factor 4 OS=Helicobacter pylori (strain J99 / ATCC 700824) GN=lepA PE=3 SV=1 18 163 1.0E-24
sp|Q5HU70|LEPA_CAMJR Elongation factor 4 OS=Campylobacter jejuni (strain RM1221) GN=lepA PE=3 SV=1 18 163 1.0E-24
sp|A1W018|LEPA_CAMJJ Elongation factor 4 OS=Campylobacter jejuni subsp. jejuni serotype O:23/36 (strain 81-176) GN=lepA PE=3 SV=1 18 163 1.0E-24
sp|Q9PNR1|LEPA_CAMJE Elongation factor 4 OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) GN=lepA PE=3 SV=1 18 163 1.0E-24
sp|A8FM79|LEPA_CAMJ8 Elongation factor 4 OS=Campylobacter jejuni subsp. jejuni serotype O:6 (strain 81116 / NCTC 11828) GN=lepA PE=3 SV=1 18 163 1.0E-24
sp|B8I3E6|LEPA_CLOCE Elongation factor 4 OS=Clostridium cellulolyticum (strain ATCC 35319 / DSM 5812 / JCM 6584 / H10) GN=lepA PE=3 SV=1 19 176 1.0E-24
sp|A5N6L8|LEPA_CLOK5 Elongation factor 4 OS=Clostridium kluyveri (strain ATCC 8527 / DSM 555 / NCIMB 10680) GN=lepA PE=3 SV=1 14 163 1.0E-24
sp|B5ZAB8|LEPA_HELPG Elongation factor 4 OS=Helicobacter pylori (strain G27) GN=lepA PE=3 SV=1 18 163 1.0E-24
sp|B9DKV7|EFG_STACT Elongation factor G OS=Staphylococcus carnosus (strain TM300) GN=fusA PE=3 SV=1 398 806 1.0E-24
sp|A5DG70|GUF1_PICGU Translation factor GUF1, mitochondrial OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=GUF1 PE=3 SV=2 16 196 1.0E-24
sp|Q9KUZ7|EFG1_VIBCH Elongation factor G 1 OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=fusA1 PE=3 SV=1 334 806 1.0E-24
sp|A3DF29|LEPA_CLOTH Elongation factor 4 OS=Clostridium thermocellum (strain ATCC 27405 / DSM 1237 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) GN=lepA PE=3 SV=1 14 163 2.0E-24
sp|Q2JQ51|LEPA_SYNJB Elongation factor 4 OS=Synechococcus sp. (strain JA-2-3B'a(2-13)) GN=lepA PE=3 SV=1 17 163 2.0E-24
sp|A6LC18|LEPA_PARD8 Elongation factor 4 OS=Parabacteroides distasonis (strain ATCC 8503 / DSM 20701 / NCTC 11152) GN=lepA PE=3 SV=1 18 219 2.0E-24
sp|P60794|LEPA_TREDE Elongation factor 4 OS=Treponema denticola (strain ATCC 35405 / CIP 103919 / DSM 14222) GN=lepA PE=3 SV=1 13 225 2.0E-24
sp|Q30XI4|LEPA_DESAG Elongation factor 4 OS=Desulfovibrio alaskensis (strain G20) GN=lepA PE=3 SV=1 13 163 2.0E-24
sp|B2FQC4|LEPA_STRMK Elongation factor 4 OS=Stenotrophomonas maltophilia (strain K279a) GN=lepA PE=3 SV=1 14 176 2.0E-24
sp|Q8K9Q9|LEPA_BUCAP Elongation factor 4 OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=lepA PE=3 SV=1 12 163 2.0E-24
sp|B8DTV6|EFG_BIFA0 Elongation factor G OS=Bifidobacterium animalis subsp. lactis (strain AD011) GN=fusA PE=3 SV=1 395 806 2.0E-24
sp|C4Z541|LEPA_EUBE2 Elongation factor 4 OS=Eubacterium eligens (strain ATCC 27750 / VPI C15-48) GN=lepA PE=3 SV=1 18 163 2.0E-24
sp|B5ELX6|EFG_ACIF5 Elongation factor G OS=Acidithiobacillus ferrooxidans (strain ATCC 53993) GN=fusA PE=3 SV=1 334 807 2.0E-24
sp|B7J464|EFG_ACIF2 Elongation factor G OS=Acidithiobacillus ferrooxidans (strain ATCC 23270 / DSM 14882 / CIP 104768 / NCIMB 8455) GN=fusA PE=3 SV=1 334 807 2.0E-24
sp|Q2RKX8|LEPA_MOOTA Elongation factor 4 OS=Moorella thermoacetica (strain ATCC 39073) GN=lepA PE=3 SV=1 19 163 2.0E-24
sp|Q1CUF5|LEPA_HELPH Elongation factor 4 OS=Helicobacter pylori (strain HPAG1) GN=lepA PE=3 SV=1 18 163 2.0E-24
sp|B4SRL3|LEPA_STRM5 Elongation factor 4 OS=Stenotrophomonas maltophilia (strain R551-3) GN=lepA PE=3 SV=1 14 176 3.0E-24
sp|A1BHJ8|LEPA_CHLPD Elongation factor 4 OS=Chlorobium phaeobacteroides (strain DSM 266) GN=lepA PE=3 SV=1 18 163 3.0E-24
sp|O25122|LEPA_HELPY Elongation factor 4 OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=lepA PE=3 SV=1 18 163 3.0E-24
sp|A7HCF3|LEPA_ANADF Elongation factor 4 OS=Anaeromyxobacter sp. (strain Fw109-5) GN=lepA PE=3 SV=1 17 163 3.0E-24
sp|B3ESU2|LEPA_AMOA5 Elongation factor 4 OS=Amoebophilus asiaticus (strain 5a2) GN=lepA PE=3 SV=1 18 163 3.0E-24
sp|Q2JWR1|LEPA_SYNJA Elongation factor 4 OS=Synechococcus sp. (strain JA-3-3Ab) GN=lepA PE=3 SV=1 12 163 3.0E-24
sp|Q38W39|LEPA_LACSS Elongation factor 4 OS=Lactobacillus sakei subsp. sakei (strain 23K) GN=lepA PE=3 SV=1 12 163 3.0E-24
sp|B3QPU3|LEPA_CHLP8 Elongation factor 4 OS=Chlorobaculum parvum (strain NCIB 8327) GN=lepA PE=3 SV=1 19 163 3.0E-24
sp|B7GKC4|LEPA_ANOFW Elongation factor 4 OS=Anoxybacillus flavithermus (strain DSM 21510 / WK1) GN=lepA PE=3 SV=1 13 163 3.0E-24
sp|Q89BJ8|LEPA_BRADU Elongation factor 4 OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=lepA PE=3 SV=2 17 163 3.0E-24
sp|C5DWG7|GUF1_ZYGRC Translation factor GUF1, mitochondrial OS=Zygosaccharomyces rouxii (strain ATCC 2623 / CBS 732 / NBRC 1130 / NCYC 568 / NRRL Y-229) GN=GUF1 PE=3 SV=1 18 180 3.0E-24
sp|Q97JJ6|LEPA_CLOAB Elongation factor 4 OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=lepA PE=3 SV=1 14 163 4.0E-24
sp|Q8KCH0|LEPA_CHLTE Elongation factor 4 OS=Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) GN=lepA PE=3 SV=1 19 163 4.0E-24
sp|C6DZ67|LEPA_GEOSM Elongation factor 4 OS=Geobacter sp. (strain M21) GN=lepA PE=3 SV=1 18 163 5.0E-24
sp|Q0AF67|LEPA_NITEC Elongation factor 4 OS=Nitrosomonas eutropha (strain C91) GN=lepA PE=3 SV=1 18 163 5.0E-24
sp|P72749|TYPA_SYNY3 GTP-binding protein TypA/BipA homolog OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=typA PE=3 SV=1 19 180 5.0E-24
sp|Q112D2|LEPA_TRIEI Elongation factor 4 OS=Trichodesmium erythraeum (strain IMS101) GN=lepA PE=3 SV=1 17 176 5.0E-24
sp|Q6FR62|GUF1_CANGA Translation factor GUF1, mitochondrial OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=GUF1 PE=3 SV=1 8 180 5.0E-24
sp|B5EB36|LEPA_GEOBB Elongation factor 4 OS=Geobacter bemidjiensis (strain Bem / ATCC BAA-1014 / DSM 16622) GN=lepA PE=3 SV=1 18 163 5.0E-24
sp|Q0IFX5|GUF1_AEDAE Translation factor GUF1 homolog, mitochondrial OS=Aedes aegypti GN=AAEL003926 PE=3 SV=1 19 163 5.0E-24
sp|Q8KQB3|EFG_BARHE Elongation factor G OS=Bartonella henselae (strain ATCC 49882 / DSM 28221 / Houston 1) GN=fusA PE=3 SV=1 335 816 5.0E-24
sp|Q4FNH3|LEPA_PELUB Elongation factor 4 OS=Pelagibacter ubique (strain HTCC1062) GN=lepA PE=3 SV=1 13 176 5.0E-24
sp|Q2SSW9|EFG_MYCCT Elongation factor G OS=Mycoplasma capricolum subsp. capricolum (strain California kid / ATCC 27343 / NCTC 10154) GN=fusA PE=3 SV=1 335 806 5.0E-24
sp|B0WXB8|GUF1_CULQU Translation factor GUF1 homolog, mitochondrial OS=Culex quinquefasciatus GN=CPIJ012086 PE=3 SV=1 2 163 5.0E-24
sp|C1N1Y2|GUFP_MICPC Translation factor GUF1 homolog, chloroplastic OS=Micromonas pusilla (strain CCMP1545) GN=MICPUCDRAFT_51778 PE=3 SV=1 6 163 5.0E-24
sp|B9KD01|LEPA_CAMLR Elongation factor 4 OS=Campylobacter lari (strain RM2100 / D67 / ATCC BAA-1060) GN=lepA PE=3 SV=1 18 163 5.0E-24
sp|Q8PMV3|LEPA_XANAC Elongation factor 4 OS=Xanthomonas axonopodis pv. citri (strain 306) GN=lepA PE=3 SV=1 14 163 6.0E-24
sp|A8MFA6|LEPA_ALKOO Elongation factor 4 OS=Alkaliphilus oremlandii (strain OhILAs) GN=lepA PE=3 SV=1 14 163 6.0E-24
sp|P13550|EFG_ARTPT Elongation factor G OS=Arthrospira platensis GN=fusA PE=3 SV=1 335 806 6.0E-24
sp|P44910|TYPA_HAEIN GTP-binding protein TypA/BipA homolog OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=typA PE=1 SV=1 19 164 7.0E-24
sp|Q07TF1|LEPA_RHOP5 Elongation factor 4 OS=Rhodopseudomonas palustris (strain BisA53) GN=lepA PE=3 SV=1 18 176 8.0E-24
sp|A7GHI0|LEPA_CLOBL Elongation factor 4 OS=Clostridium botulinum (strain Langeland / NCTC 10281 / Type F) GN=lepA PE=3 SV=1 19 163 8.0E-24
sp|B1ILM7|LEPA_CLOBK Elongation factor 4 OS=Clostridium botulinum (strain Okra / Type B1) GN=lepA PE=3 SV=1 19 163 8.0E-24
sp|B6JJT7|LEPA_OLICO Elongation factor 4 OS=Oligotropha carboxidovorans (strain ATCC 49405 / DSM 1227 / OM5) GN=lepA PE=3 SV=1 17 163 8.0E-24
sp|C1FVU4|LEPA_CLOBJ Elongation factor 4 OS=Clostridium botulinum (strain Kyoto / Type A2) GN=lepA PE=3 SV=1 19 163 9.0E-24
sp|Q3SVT1|LEPA_NITWN Elongation factor 4 OS=Nitrobacter winogradskyi (strain Nb-255 / ATCC 25391) GN=lepA PE=3 SV=1 17 163 9.0E-24
sp|B4U6M2|LEPA_HYDS0 Elongation factor 4 OS=Hydrogenobaculum sp. (strain Y04AAS1) GN=lepA PE=3 SV=1 18 163 9.0E-24
sp|B3WEQ5|LEPA_LACCB Elongation factor 4 OS=Lactobacillus casei (strain BL23) GN=lepA PE=3 SV=1 12 176 9.0E-24
sp|Q038N6|LEPA_LACC3 Elongation factor 4 OS=Lactobacillus casei (strain ATCC 334) GN=lepA PE=3 SV=1 12 176 9.0E-24
sp|Q3BVV9|LEPA_XANC5 Elongation factor 4 OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) GN=lepA PE=3 SV=1 18 163 9.0E-24
sp|B4U3G9|LEPA_STREM Elongation factor 4 OS=Streptococcus equi subsp. zooepidemicus (strain MGCS10565) GN=lepA PE=3 SV=1 12 163 9.0E-24
sp|Q3A445|LEPA_PELCD Elongation factor 4 OS=Pelobacter carbinolicus (strain DSM 2380 / Gra Bd 1) GN=lepA PE=3 SV=1 17 163 9.0E-24
sp|Q89AC9|TYPA_BUCBP GTP-binding protein TypA/BipA homolog OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=typA PE=3 SV=2 18 164 1.0E-23
sp|Q3ATB2|LEPA_CHLCH Elongation factor 4 OS=Chlorobium chlorochromatii (strain CaD3) GN=lepA PE=3 SV=1 17 163 1.0E-23
sp|C0M8H9|LEPA_STRE4 Elongation factor 4 OS=Streptococcus equi subsp. equi (strain 4047) GN=lepA PE=3 SV=1 12 163 1.0E-23
sp|Q5H1R5|LEPA_XANOR Elongation factor 4 OS=Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85) GN=lepA PE=3 SV=1 14 176 1.0E-23
sp|Q2P4M4|LEPA_XANOM Elongation factor 4 OS=Xanthomonas oryzae pv. oryzae (strain MAFF 311018) GN=lepA PE=3 SV=1 14 176 1.0E-23
sp|Q6MTR6|LEPA_MYCMS Elongation factor 4 OS=Mycoplasma mycoides subsp. mycoides SC (strain PG1) GN=lepA PE=3 SV=1 13 163 1.0E-23
sp|A5CR97|LEPA_CLAM3 Elongation factor 4 OS=Clavibacter michiganensis subsp. michiganensis (strain NCPPB 382) GN=lepA PE=3 SV=1 9 163 1.0E-23
sp|D2VRR7|GUF1_NAEGR Translation factor GUF1 homolog, mitochondrial OS=Naegleria gruberi GN=NAEGRDRAFT_71680 PE=3 SV=1 16 176 1.0E-23
sp|Q8N442|GUF1_HUMAN Translation factor GUF1, mitochondrial OS=Homo sapiens GN=GUF1 PE=1 SV=1 18 163 1.0E-23
sp|B0RCT0|LEPA_CLAMS Elongation factor 4 OS=Clavibacter michiganensis subsp. sepedonicus (strain ATCC 33113 / DSM 20744 / JCM 9667 / LMG 2889 / C-1) GN=lepA PE=3 SV=1 1 163 1.0E-23
sp|B1ZC10|LEPA_METPB Elongation factor 4 OS=Methylobacterium populi (strain ATCC BAA-705 / NCIMB 13946 / BJ001) GN=lepA PE=3 SV=1 18 163 1.0E-23
sp|A4J7F8|LEPA_DESRM Elongation factor 4 OS=Desulfotomaculum reducens (strain MI-1) GN=lepA PE=3 SV=1 13 163 1.0E-23
sp|B1KZP1|LEPA_CLOBM Elongation factor 4 OS=Clostridium botulinum (strain Loch Maree / Type A3) GN=lepA PE=3 SV=1 19 163 1.0E-23
sp|A8LR11|LEPA_DINSH Elongation factor 4 OS=Dinoroseobacter shibae (strain DSM 16493 / NCIMB 14021 / DFL 12) GN=lepA PE=3 SV=1 13 163 1.0E-23
sp|A0M6M2|LEPA_GRAFK Elongation factor 4 OS=Gramella forsetii (strain KT0803) GN=lepA PE=3 SV=1 18 163 1.0E-23
sp|A5I644|LEPA_CLOBH Elongation factor 4 OS=Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A) GN=lepA PE=3 SV=1 19 163 1.0E-23
sp|A7FXL9|LEPA_CLOB1 Elongation factor 4 OS=Clostridium botulinum (strain ATCC 19397 / Type A) GN=lepA PE=3 SV=1 19 163 1.0E-23
sp|A5VB59|LEPA_SPHWW Elongation factor 4 OS=Sphingomonas wittichii (strain RW1 / DSM 6014 / JCM 10273) GN=lepA PE=3 SV=1 19 163 1.0E-23
sp|C3L3H1|LEPA_CLOB6 Elongation factor 4 OS=Clostridium botulinum (strain 657 / Type Ba4) GN=lepA PE=3 SV=1 19 163 1.0E-23
sp|B3EE17|LEPA_CHLL2 Elongation factor 4 OS=Chlorobium limicola (strain DSM 245 / NBRC 103803) GN=lepA PE=3 SV=1 17 163 1.0E-23
sp|B2RKK1|LEPA_PORG3 Elongation factor 4 OS=Porphyromonas gingivalis (strain ATCC 33277 / DSM 20709 / JCM 12257) GN=lepA PE=3 SV=1 18 163 1.0E-23
sp|Q7MV56|LEPA_PORGI Elongation factor 4 OS=Porphyromonas gingivalis (strain ATCC BAA-308 / W83) GN=lepA PE=3 SV=1 18 163 1.0E-23
sp|Q9PA90|EFG_XYLFA Elongation factor G OS=Xylella fastidiosa (strain 9a5c) GN=fusA PE=3 SV=1 334 806 1.0E-23
sp|Q87A35|EFG_XYLFT Elongation factor G OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=fusA PE=3 SV=1 334 806 2.0E-23
sp|B2IA64|EFG_XYLF2 Elongation factor G OS=Xylella fastidiosa (strain M23) GN=fusA PE=3 SV=1 334 806 2.0E-23
sp|Q00ZZ1|GUF1_OSTTA Translation factor GUF1 homolog, mitochondrial OS=Ostreococcus tauri GN=Ot10g01840 PE=3 SV=1 20 163 2.0E-23
sp|Q820H8|LEPA_NITEU Elongation factor 4 OS=Nitrosomonas europaea (strain ATCC 19718 / NBRC 14298) GN=lepA PE=3 SV=1 18 163 2.0E-23
sp|B2SRY0|LEPA_XANOP Elongation factor 4 OS=Xanthomonas oryzae pv. oryzae (strain PXO99A) GN=lepA PE=3 SV=1 18 176 2.0E-23
sp|Q39US7|LEPA_GEOMG Elongation factor 4 OS=Geobacter metallireducens (strain GS-15 / ATCC 53774 / DSM 7210) GN=lepA PE=3 SV=2 15 163 2.0E-23
sp|Q7VJZ1|LEPA_HELHP Elongation factor 4 OS=Helicobacter hepaticus (strain ATCC 51449 / 3B1) GN=lepA PE=3 SV=1 9 163 2.0E-23
sp|B6K6L6|GUF1_SCHJY Translation factor guf1, mitochondrial OS=Schizosaccharomyces japonicus (strain yFS275 / FY16936) GN=guf1 PE=3 SV=1 18 163 2.0E-23
sp|Q5R104|LEPA_IDILO Elongation factor 4 OS=Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR) GN=lepA PE=3 SV=1 15 163 2.0E-23
sp|B8DIZ5|LEPA_DESVM Elongation factor 4 OS=Desulfovibrio vulgaris (strain Miyazaki F / DSM 19637) GN=lepA PE=3 SV=1 13 163 2.0E-23
sp|Q38BU9|GUF1_TRYB2 Translation factor GUF1 homolog, mitochondrial OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) GN=Tb10.70.4600 PE=3 SV=1 16 166 2.0E-23
sp|Q2LTN3|LEPA_SYNAS Elongation factor 4 OS=Syntrophus aciditrophicus (strain SB) GN=lepA PE=3 SV=1 18 163 2.0E-23
sp|P60930|LEPA_BDEBA Elongation factor 4 OS=Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIB 9529 / HD100) GN=lepA PE=3 SV=2 16 163 2.0E-23
sp|Q2NJE6|LEPA_AYWBP Elongation factor 4 OS=Aster yellows witches'-broom phytoplasma (strain AYWB) GN=lepA PE=3 SV=1 9 267 2.0E-23
sp|B9M4U5|LEPA_GEODF Elongation factor 4 OS=Geobacter daltonii (strain DSM 22248 / JCM 15807 / FRC-32) GN=lepA PE=3 SV=1 18 163 2.0E-23
sp|B5EQB5|LEPA_ACIF5 Elongation factor 4 OS=Acidithiobacillus ferrooxidans (strain ATCC 53993) GN=lepA PE=3 SV=1 13 163 3.0E-23
sp|B7J9J8|LEPA_ACIF2 Elongation factor 4 OS=Acidithiobacillus ferrooxidans (strain ATCC 23270 / DSM 14882 / CIP 104768 / NCIMB 8455) GN=lepA PE=3 SV=1 13 163 3.0E-23
sp|Q182F4|LEPA_PEPD6 Elongation factor 4 OS=Peptoclostridium difficile (strain 630) GN=lepA PE=3 SV=1 14 163 3.0E-23
sp|A6QLJ3|GUF1_BOVIN Translation factor GUF1, mitochondrial OS=Bos taurus GN=GUF1 PE=2 SV=1 18 163 3.0E-23
sp|B4SBG4|LEPA_PELPB Elongation factor 4 OS=Pelodictyon phaeoclathratiforme (strain DSM 5477 / BU-1) GN=lepA PE=3 SV=1 17 163 3.0E-23
sp|Q21BS0|LEPA_RHOPB Elongation factor 4 OS=Rhodopseudomonas palustris (strain BisB18) GN=lepA PE=3 SV=2 17 163 3.0E-23
sp|B2GBR9|LEPA_LACF3 Elongation factor 4 OS=Lactobacillus fermentum (strain NBRC 3956 / LMG 18251) GN=lepA PE=3 SV=1 8 163 3.0E-23
sp|Q9KD76|LEPA_BACHD Elongation factor 4 OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=lepA PE=3 SV=1 15 163 3.0E-23
sp|Q11UD0|LEPA_CYTH3 Elongation factor 4 OS=Cytophaga hutchinsonii (strain ATCC 33406 / NCIMB 9469) GN=lepA PE=3 SV=1 18 163 3.0E-23
sp|Q88VN0|LEPA1_LACPL Elongation factor 4 1 OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=lepA1 PE=3 SV=1 12 163 3.0E-23
sp|A5DWY7|GUF1_LODEL Translation factor GUF1, mitochondrial OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=GUF1 PE=3 SV=1 18 180 3.0E-23
sp|Q67S76|LEPA_SYMTH Elongation factor 4 OS=Symbiobacterium thermophilum (strain T / IAM 14863) GN=lepA PE=3 SV=1 18 163 3.0E-23
sp|Q5WVI1|LEPA_LEGPL Elongation factor 4 OS=Legionella pneumophila (strain Lens) GN=lepA PE=3 SV=1 17 163 3.0E-23
sp|C4K153|LEPA_RICPU Elongation factor 4 OS=Rickettsia peacockii (strain Rustic) GN=lepA PE=3 SV=1 13 163 3.0E-23
sp|A5IZ33|EFG_MYCAP Elongation factor G OS=Mycoplasma agalactiae (strain PG2) GN=fusA PE=3 SV=1 398 806 3.0E-23
sp|B2GIL1|EFG_KOCRD Elongation factor G OS=Kocuria rhizophila (strain ATCC 9341 / DSM 348 / NBRC 103217 / DC2201) GN=fusA PE=3 SV=1 19 164 4.0E-23
sp|A1A0T0|EFG_BIFAA Elongation factor G OS=Bifidobacterium adolescentis (strain ATCC 15703 / DSM 20083 / NCTC 11814 / E194a) GN=fusA PE=3 SV=1 395 806 4.0E-23
sp|Q5WHG5|LEPA_BACSK Elongation factor 4 OS=Bacillus clausii (strain KSM-K16) GN=lepA PE=3 SV=1 13 163 4.0E-23
sp|P75498|LEPA_MYCPN Elongation factor 4 OS=Mycoplasma pneumoniae (strain ATCC 29342 / M129) GN=lepA PE=3 SV=2 19 213 4.0E-23
sp|B3PME9|EFG_MYCA5 Elongation factor G OS=Mycoplasma arthritidis (strain 158L3-1) GN=fusA PE=3 SV=1 398 834 4.0E-23
sp|B0U5X3|EFG_XYLFM Elongation factor G OS=Xylella fastidiosa (strain M12) GN=fusA PE=3 SV=1 334 806 4.0E-23
sp|C4L433|LEPA_EXISA Elongation factor 4 OS=Exiguobacterium sp. (strain ATCC BAA-1283 / AT1b) GN=lepA PE=3 SV=1 12 163 4.0E-23
sp|A4S3R2|GUF1_OSTLU Translation factor GUF1 homolog, mitochondrial OS=Ostreococcus lucimarinus (strain CCE9901) GN=OSTLU_88434 PE=3 SV=1 5 187 4.0E-23
sp|Q81LR7|LEPA_BACAN Elongation factor 4 OS=Bacillus anthracis GN=lepA PE=3 SV=1 15 163 4.0E-23
sp|C3P8M5|LEPA_BACAA Elongation factor 4 OS=Bacillus anthracis (strain A0248) GN=lepA PE=3 SV=1 15 163 4.0E-23
sp|A6WYK4|LEPA_OCHA4 Elongation factor 4 OS=Ochrobactrum anthropi (strain ATCC 49188 / DSM 6882 / NCTC 12168) GN=lepA PE=3 SV=1 18 163 4.0E-23
sp|Q8FV17|LEPA_BRUSU Elongation factor 4 OS=Brucella suis biovar 1 (strain 1330) GN=lepA PE=3 SV=1 18 163 5.0E-23
sp|A9WW49|LEPA_BRUSI Elongation factor 4 OS=Brucella suis (strain ATCC 23445 / NCTC 10510) GN=lepA PE=3 SV=1 18 163 5.0E-23
sp|A5VVU4|LEPA_BRUO2 Elongation factor 4 OS=Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512) GN=lepA PE=3 SV=1 18 163 5.0E-23
sp|A9MCW5|LEPA_BRUC2 Elongation factor 4 OS=Brucella canis (strain ATCC 23365 / NCTC 10854) GN=lepA PE=3 SV=1 18 163 5.0E-23
sp|Q8YDB8|LEPA_BRUME Elongation factor 4 OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=lepA PE=3 SV=1 18 163 5.0E-23
sp|C0RMH8|LEPA_BRUMB Elongation factor 4 OS=Brucella melitensis biotype 2 (strain ATCC 23457) GN=lepA PE=3 SV=1 18 163 5.0E-23
sp|Q576S5|LEPA_BRUAB Elongation factor 4 OS=Brucella abortus biovar 1 (strain 9-941) GN=lepA PE=3 SV=1 18 163 5.0E-23
sp|Q2YJP8|LEPA_BRUA2 Elongation factor 4 OS=Brucella abortus (strain 2308) GN=lepA PE=3 SV=1 18 163 5.0E-23
sp|B2SC25|LEPA_BRUA1 Elongation factor 4 OS=Brucella abortus (strain S19) GN=lepA PE=3 SV=1 18 163 5.0E-23
sp|C3PMX3|LEPA_RICAE Elongation factor 4 OS=Rickettsia africae (strain ESF-5) GN=lepA PE=3 SV=1 13 163 5.0E-23
sp|B1X3K4|GUFP_PAUCH Translation factor GUF1 homolog, organellar chromatophore OS=Paulinella chromatophora GN=lepA PE=3 SV=1 12 163 5.0E-23
sp|Q4FUV9|LEPA_PSYA2 Elongation factor 4 OS=Psychrobacter arcticus (strain DSM 17307 / 273-4) GN=lepA PE=3 SV=1 13 163 5.0E-23
sp|A6SXR0|LEPA_JANMA Elongation factor 4 OS=Janthinobacterium sp. (strain Marseille) GN=lepA PE=3 SV=1 17 163 5.0E-23
sp|Q92SU3|LEPA_RHIME Elongation factor 4 OS=Rhizobium meliloti (strain 1021) GN=lepA PE=3 SV=1 17 176 5.0E-23
sp|A6VLV6|LEPA_ACTSZ Elongation factor 4 OS=Actinobacillus succinogenes (strain ATCC 55618 / 130Z) GN=lepA PE=3 SV=1 18 163 5.0E-23
sp|Q6MEF3|LEPA_PARUW Elongation factor 4 OS=Protochlamydia amoebophila (strain UWE25) GN=lepA PE=3 SV=1 17 163 5.0E-23
sp|Q6F0Z2|LEPA_MESFL Elongation factor 4 OS=Mesoplasma florum (strain ATCC 33453 / NBRC 100688 / NCTC 11704 / L1) GN=lepA PE=3 SV=1 13 176 5.0E-23
sp|Q1QDV6|LEPA_PSYCK Elongation factor 4 OS=Psychrobacter cryohalolentis (strain K5) GN=lepA PE=3 SV=1 13 163 5.0E-23
sp|Q6F0J4|EFG_MESFL Elongation factor G OS=Mesoplasma florum (strain ATCC 33453 / NBRC 100688 / NCTC 11704 / L1) GN=fusA PE=3 SV=1 335 806 5.0E-23
sp|Q8EWZ9|LEPA_MYCPE Elongation factor 4 OS=Mycoplasma penetrans (strain HF-2) GN=lepA PE=3 SV=1 13 163 5.0E-23
sp|Q2SSF7|LEPA_MYCCT Elongation factor 4 OS=Mycoplasma capricolum subsp. capricolum (strain California kid / ATCC 27343 / NCTC 10154) GN=lepA PE=3 SV=1 13 163 5.0E-23
sp|Q8AA33|LEPA_BACTN Elongation factor 4 OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482) GN=lepA PE=3 SV=1 18 165 5.0E-23
sp|Q01SV7|LEPA_SOLUE Elongation factor 4 OS=Solibacter usitatus (strain Ellin6076) GN=lepA PE=3 SV=1 19 163 5.0E-23
sp|C4LBZ6|LEPA_TOLAT Elongation factor 4 OS=Tolumonas auensis (strain DSM 9187 / TA4) GN=lepA PE=3 SV=1 18 163 6.0E-23
sp|Q7VL73|LEPA_HAEDU Elongation factor 4 OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=lepA PE=3 SV=2 18 163 6.0E-23
sp|A6H1S4|LEPA_FLAPJ Elongation factor 4 OS=Flavobacterium psychrophilum (strain JIP02/86 / ATCC 49511) GN=lepA PE=3 SV=1 18 163 6.0E-23
sp|B0G189|GUF1_DICDI Translation factor GUF1 homolog, mitochondrial OS=Dictyostelium discoideum GN=guf1 PE=3 SV=1 19 180 6.0E-23
sp|B1YKS5|LEPA_EXIS2 Elongation factor 4 OS=Exiguobacterium sibiricum (strain DSM 17290 / JCM 13490 / 255-15) GN=lepA PE=3 SV=1 13 163 6.0E-23
sp|A9IW31|EFG_BART1 Elongation factor G OS=Bartonella tribocorum (strain CIP 105476 / IBS 506) GN=fusA PE=3 SV=1 335 816 6.0E-23
sp|B0K3Y4|LEPA_THEPX Elongation factor 4 OS=Thermoanaerobacter sp. (strain X514) GN=lepA PE=3 SV=1 19 163 6.0E-23
sp|P57806|LEPA_PASMU Elongation factor 4 OS=Pasteurella multocida (strain Pm70) GN=lepA PE=3 SV=1 18 163 6.0E-23
sp|A5FLU8|LEPA_FLAJ1 Elongation factor 4 OS=Flavobacterium johnsoniae (strain ATCC 17061 / DSM 2064 / UW101) GN=lepA PE=3 SV=1 19 163 6.0E-23
sp|Q5P089|LEPA_AROAE Elongation factor 4 OS=Aromatoleum aromaticum (strain EbN1) GN=lepA PE=3 SV=1 18 163 6.0E-23
sp|Q74ZG2|GUF1_ASHGO Translation factor GUF1, mitochondrial OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=GUF1 PE=3 SV=1 20 178 6.0E-23
sp|Q92IQ1|LEPA_RICCN Elongation factor 4 OS=Rickettsia conorii (strain ATCC VR-613 / Malish 7) GN=lepA PE=3 SV=1 13 163 6.0E-23
sp|B7HCU5|LEPA_BACC4 Elongation factor 4 OS=Bacillus cereus (strain B4264) GN=lepA PE=3 SV=1 15 163 6.0E-23
sp|B7IYH2|LEPA_BACC2 Elongation factor 4 OS=Bacillus cereus (strain G9842) GN=lepA PE=3 SV=1 15 163 6.0E-23
sp|C4Y8M4|GUF1_CLAL4 Translation factor GUF1, mitochondrial OS=Clavispora lusitaniae (strain ATCC 42720) GN=GUF1 PE=3 SV=1 17 163 6.0E-23
sp|Q1IXW5|LEPA_DEIGD Elongation factor 4 OS=Deinococcus geothermalis (strain DSM 11300) GN=lepA PE=3 SV=1 18 163 7.0E-23
sp|B9IY86|LEPA_BACCQ Elongation factor 4 OS=Bacillus cereus (strain Q1) GN=lepA PE=3 SV=1 15 163 7.0E-23
sp|B0KA85|LEPA_THEP3 Elongation factor 4 OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) GN=lepA PE=3 SV=1 19 163 7.0E-23
sp|B7KR78|LEPA_METC4 Elongation factor 4 OS=Methylobacterium extorquens (strain CM4 / NCIMB 13688) GN=lepA PE=3 SV=1 18 163 7.0E-23
sp|A8FFD6|LEPA_BACP2 Elongation factor 4 OS=Bacillus pumilus (strain SAFR-032) GN=lepA PE=3 SV=1 13 163 7.0E-23
sp|A7GT14|LEPA_BACCN Elongation factor 4 OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=lepA PE=3 SV=1 15 163 7.0E-23
sp|A1SSM6|LEPA_PSYIN Elongation factor 4 OS=Psychromonas ingrahamii (strain 37) GN=lepA PE=3 SV=1 18 163 7.0E-23
sp|A9S3D3|GUF1_PHYPA Translation factor GUF1 homolog, mitochondrial OS=Physcomitrella patens subsp. patens GN=PHYPADRAFT_180825 PE=3 SV=1 16 187 7.0E-23
sp|Q730L6|LEPA_BACC1 Elongation factor 4 OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=lepA PE=3 SV=1 15 163 7.0E-23
sp|A5G4G3|LEPA_GEOUR Elongation factor 4 OS=Geobacter uraniireducens (strain Rf4) GN=lepA PE=3 SV=1 18 163 7.0E-23
sp|Q68X95|LEPA_RICTY Elongation factor 4 OS=Rickettsia typhi (strain ATCC VR-144 / Wilmington) GN=lepA PE=3 SV=1 13 168 7.0E-23
sp|A9A0N0|LEPA_DESOH Elongation factor 4 OS=Desulfococcus oleovorans (strain DSM 6200 / Hxd3) GN=lepA PE=3 SV=1 17 163 7.0E-23
sp|Q818E4|LEPA_BACCR Elongation factor 4 OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=lepA PE=3 SV=1 15 163 7.0E-23
sp|Q6HDK2|LEPA_BACHK Elongation factor 4 OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=lepA PE=3 SV=1 15 163 7.0E-23
sp|Q634M2|LEPA_BACCZ Elongation factor 4 OS=Bacillus cereus (strain ZK / E33L) GN=lepA PE=3 SV=1 15 163 7.0E-23
sp|C1ESL3|LEPA_BACC3 Elongation factor 4 OS=Bacillus cereus (strain 03BB102) GN=lepA PE=3 SV=1 15 163 7.0E-23
sp|A0RIT7|LEPA_BACAH Elongation factor 4 OS=Bacillus thuringiensis (strain Al Hakam) GN=lepA PE=3 SV=1 15 163 7.0E-23
sp|P60789|LEPA_GEOSL Elongation factor 4 OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) GN=lepA PE=3 SV=1 15 163 7.0E-23
sp|Q5YZZ7|LEPA_NOCFA Elongation factor 4 OS=Nocardia farcinica (strain IFM 10152) GN=lepA PE=3 SV=1 16 163 7.0E-23
sp|Q07YZ4|LEPA_SHEFN Elongation factor 4 OS=Shewanella frigidimarina (strain NCIMB 400) GN=lepA PE=3 SV=1 18 163 7.0E-23
sp|B7HPL8|LEPA_BACC7 Elongation factor 4 OS=Bacillus cereus (strain AH187) GN=lepA PE=3 SV=1 15 163 7.0E-23
sp|B7JNV1|LEPA_BACC0 Elongation factor 4 OS=Bacillus cereus (strain AH820) GN=lepA PE=3 SV=1 15 163 7.0E-23
sp|C3L5S2|LEPA_BACAC Elongation factor 4 OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=lepA PE=3 SV=1 15 163 7.0E-23
sp|Q0AWL9|LEPA_SYNWW Elongation factor 4 OS=Syntrophomonas wolfei subsp. wolfei (strain DSM 2245B / Goettingen) GN=lepA PE=3 SV=1 18 176 7.0E-23
sp|C0MDV7|LEPA_STRS7 Elongation factor 4 OS=Streptococcus equi subsp. zooepidemicus (strain H70) GN=lepA PE=3 SV=1 12 163 8.0E-23
sp|Q6MU82|EFG_MYCMS Elongation factor G OS=Mycoplasma mycoides subsp. mycoides SC (strain PG1) GN=fusA PE=3 SV=1 335 806 8.0E-23
sp|Q1WUE6|LEPA_LACS1 Elongation factor 4 OS=Lactobacillus salivarius (strain UCC118) GN=lepA PE=3 SV=1 15 163 8.0E-23
sp|A9VHU6|LEPA_BACWK Elongation factor 4 OS=Bacillus weihenstephanensis (strain KBAB4) GN=lepA PE=3 SV=1 15 163 8.0E-23
sp|C1F2I3|LEPA_ACIC5 Elongation factor 4 OS=Acidobacterium capsulatum (strain ATCC 51196 / DSM 11244 / JCM 7670 / NBRC 15755 / NCIMB 13165 / 161) GN=lepA PE=3 SV=1 19 179 8.0E-23
sp|A1RMC9|LEPA_SHESW Elongation factor 4 OS=Shewanella sp. (strain W3-18-1) GN=lepA PE=3 SV=1 18 163 8.0E-23
sp|A1K601|LEPA_AZOSB Elongation factor 4 OS=Azoarcus sp. (strain BH72) GN=lepA PE=3 SV=1 18 163 8.0E-23
sp|Q9VRH6|GUF1_DROME Translation factor waclaw, mitochondrial OS=Drosophila melanogaster GN=waw PE=3 SV=2 7 163 8.0E-23
sp|A4G6S1|LEPA_HERAR Elongation factor 4 OS=Herminiimonas arsenicoxydans GN=lepA PE=3 SV=1 17 163 8.0E-23
sp|A4Y4K2|LEPA_SHEPC Elongation factor 4 OS=Shewanella putrefaciens (strain CN-32 / ATCC BAA-453) GN=lepA PE=3 SV=1 18 163 9.0E-23
sp|B9RUN8|GUF1_RICCO Translation factor GUF1 homolog, mitochondrial OS=Ricinus communis GN=RCOM_0855130 PE=3 SV=1 19 164 9.0E-23
sp|C5CSF2|LEPA_VARPS Elongation factor 4 OS=Variovorax paradoxus (strain S110) GN=lepA PE=3 SV=1 17 163 9.0E-23
sp|Q6F9B9|LEPA_ACIAD Elongation factor 4 OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=lepA PE=3 SV=1 18 163 9.0E-23
sp|B0USR9|LEPA_HISS2 Elongation factor 4 OS=Histophilus somni (strain 2336) GN=lepA PE=3 SV=1 18 163 9.0E-23
sp|Q0I4Z1|LEPA_HAES1 Elongation factor 4 OS=Haemophilus somnus (strain 129Pt) GN=lepA PE=3 SV=1 18 163 9.0E-23
sp|Q2NS11|LEPA_SODGM Elongation factor 4 OS=Sodalis glossinidius (strain morsitans) GN=lepA PE=3 SV=1 18 163 9.0E-23
sp|B8HLK8|LEPA_CYAP4 Elongation factor 4 OS=Cyanothece sp. (strain PCC 7425 / ATCC 29141) GN=lepA PE=3 SV=1 17 163 9.0E-23
sp|P47384|LEPA_MYCGE Elongation factor 4 OS=Mycoplasma genitalium (strain ATCC 33530 / G-37 / NCTC 10195) GN=lepA PE=3 SV=1 18 213 9.0E-23
sp|P43729|LEPA_HAEIN Elongation factor 4 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=lepA PE=3 SV=1 18 163 9.0E-23
sp|P40173|EFG1_STRCO Elongation factor G 1 OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=fusA PE=3 SV=2 17 170 1.0E-22
sp|Q1D777|EFG2_MYXXD Elongation factor G 2 OS=Myxococcus xanthus (strain DK 1622) GN=fusA2 PE=3 SV=1 20 172 1.0E-22
sp|D1ZET3|GUF1_SORMK Translation factor GUF1, mitochondrial OS=Sordaria macrospora (strain ATCC MYA-333 / DSM 997 / K(L3346) / K-hell) GN=GUF1 PE=3 SV=1 20 202 1.0E-22
sp|Q3B2V1|LEPA_CHLL7 Elongation factor 4 OS=Chlorobium luteolum (strain DSM 273 / 2530) GN=lepA PE=3 SV=1 17 163 1.0E-22
sp|Q03KW7|LEPA_STRTD Elongation factor 4 OS=Streptococcus thermophilus (strain ATCC BAA-491 / LMD-9) GN=lepA PE=3 SV=1 9 163 1.0E-22
sp|Q5M008|LEPA_STRT1 Elongation factor 4 OS=Streptococcus thermophilus (strain CNRZ 1066) GN=lepA PE=3 SV=1 9 163 1.0E-22
sp|A5UFI9|LEPA_HAEIG Elongation factor 4 OS=Haemophilus influenzae (strain PittGG) GN=lepA PE=3 SV=1 18 163 1.0E-22
sp|A5UBC2|LEPA_HAEIE Elongation factor 4 OS=Haemophilus influenzae (strain PittEE) GN=lepA PE=3 SV=1 18 163 1.0E-22
sp|Q4QPM8|LEPA_HAEI8 Elongation factor 4 OS=Haemophilus influenzae (strain 86-028NP) GN=lepA PE=3 SV=1 18 163 1.0E-22
sp|B4S9B7|LEPA_PROA2 Elongation factor 4 OS=Prosthecochloris aestuarii (strain DSM 271 / SK 413) GN=lepA PE=3 SV=1 19 163 1.0E-22
sp|Q8C3X4|GUF1_MOUSE Translation factor Guf1, mitochondrial OS=Mus musculus GN=Guf1 PE=1 SV=1 18 163 1.0E-22
sp|Q5M4M2|LEPA_STRT2 Elongation factor 4 OS=Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311) GN=lepA PE=3 SV=1 9 163 1.0E-22
sp|D0NKK0|GUF1_PHYIT Translation factor GUF1 homolog, mitochondrial OS=Phytophthora infestans (strain T30-4) GN=PITG_12454 PE=3 SV=1 15 163 1.0E-22
sp|A5D3X6|LEPA_PELTS Elongation factor 4 OS=Pelotomaculum thermopropionicum (strain DSM 13744 / JCM 10971 / SI) GN=lepA PE=3 SV=1 19 163 1.0E-22
sp|B0VCT7|LEPA_ACIBY Elongation factor 4 OS=Acinetobacter baumannii (strain AYE) GN=lepA PE=3 SV=1 18 163 1.0E-22
sp|A3M7P5|LEPA_ACIBT Elongation factor 4 OS=Acinetobacter baumannii (strain ATCC 17978 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377) GN=lepA PE=3 SV=2 18 163 1.0E-22
sp|B2HWQ2|LEPA_ACIBC Elongation factor 4 OS=Acinetobacter baumannii (strain ACICU) GN=lepA PE=3 SV=1 18 163 1.0E-22
sp|B7I580|LEPA_ACIB5 Elongation factor 4 OS=Acinetobacter baumannii (strain AB0057) GN=lepA PE=3 SV=1 18 163 1.0E-22
sp|B7GYS7|LEPA_ACIB3 Elongation factor 4 OS=Acinetobacter baumannii (strain AB307-0294) GN=lepA PE=3 SV=1 18 163 1.0E-22
sp|B0VTM2|LEPA_ACIBS Elongation factor 4 OS=Acinetobacter baumannii (strain SDF) GN=lepA PE=3 SV=1 18 163 1.0E-22
sp|Q2KDL5|LEPA_RHIEC Elongation factor 4 OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=lepA PE=3 SV=1 17 163 1.0E-22
sp|B0CS18|GUF1_LACBS Translation factor GUF1, mitochondrial OS=Laccaria bicolor (strain S238N-H82 / ATCC MYA-4686) GN=GUF1 PE=3 SV=1 4 163 1.0E-22
sp|C4K3Z1|LEPA_HAMD5 Elongation factor 4 OS=Hamiltonella defensa subsp. Acyrthosiphon pisum (strain 5AT) GN=lepA PE=3 SV=1 20 163 1.0E-22
sp|Q4L6T4|LEPA_STAHJ Elongation factor 4 OS=Staphylococcus haemolyticus (strain JCSC1435) GN=lepA PE=3 SV=1 14 176 1.0E-22
sp|Q7S0P6|GUF1_NEUCR Translation factor guf1, mitochondrial OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=guf1 PE=3 SV=2 20 202 1.0E-22
sp|Q7U5L9|LEPA_SYNPX Elongation factor 4 OS=Synechococcus sp. (strain WH8102) GN=lepA PE=3 SV=1 12 163 1.0E-22
sp|A5CWJ4|LEPA_VESOH Elongation factor 4 OS=Vesicomyosocius okutanii subsp. Calyptogena okutanii (strain HA) GN=lepA PE=3 SV=1 18 163 1.0E-22
sp|Q2J2Y0|LEPA_RHOP2 Elongation factor 4 OS=Rhodopseudomonas palustris (strain HaA2) GN=lepA PE=3 SV=2 18 163 1.0E-22
sp|Q65H50|LEPA_BACLD Elongation factor 4 OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=lepA PE=3 SV=1 13 163 1.0E-22
sp|A4SFN5|LEPA_CHLPM Elongation factor 4 OS=Chlorobium phaeovibrioides (strain DSM 265 / 1930) GN=lepA PE=3 SV=1 17 163 1.0E-22
sp|Q05FI2|EFG_CARRP Elongation factor G OS=Carsonella ruddii (strain PV) GN=fusA PE=3 SV=1 13 164 1.0E-22
sp|B3PYC6|LEPA_RHIE6 Elongation factor 4 OS=Rhizobium etli (strain CIAT 652) GN=lepA PE=3 SV=1 17 163 1.0E-22
sp|B0S1G2|LEPA_FINM2 Elongation factor 4 OS=Finegoldia magna (strain ATCC 29328) GN=lepA PE=3 SV=1 19 176 1.0E-22
sp|Q46GZ6|LEPA_PROMT Elongation factor 4 OS=Prochlorococcus marinus (strain NATL2A) GN=lepA PE=3 SV=1 17 163 1.0E-22
sp|Q0RP81|LEPA_FRAAA Elongation factor 4 OS=Frankia alni (strain ACN14a) GN=lepA PE=3 SV=1 16 163 1.0E-22
sp|A4TKY0|LEPA_YERPP Elongation factor 4 OS=Yersinia pestis (strain Pestoides F) GN=lepA PE=3 SV=1 17 163 1.0E-22
sp|Q1MMQ8|LEPA_RHIL3 Elongation factor 4 OS=Rhizobium leguminosarum bv. viciae (strain 3841) GN=lepA PE=3 SV=1 17 163 1.0E-22
sp|Q13E78|LEPA_RHOPS Elongation factor 4 OS=Rhodopseudomonas palustris (strain BisB5) GN=lepA PE=3 SV=2 18 163 1.0E-22
sp|P60791|LEPA_MYCPA Elongation factor 4 OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=lepA PE=3 SV=1 16 163 1.0E-22
sp|A9KKU4|LEPA_CLOPH Elongation factor 4 OS=Clostridium phytofermentans (strain ATCC 700394 / DSM 18823 / ISDg) GN=lepA PE=3 SV=1 19 163 1.0E-22
sp|P0A3B4|TYPA_SHIFL GTP-binding protein TypA/BipA OS=Shigella flexneri GN=typA PE=3 SV=1 19 164 1.0E-22
sp|P32132|TYPA_ECOLI GTP-binding protein TypA/BipA OS=Escherichia coli (strain K12) GN=typA PE=1 SV=2 19 164 1.0E-22
sp|P0A3B1|TYPA_ECOL6 GTP-binding protein TypA/BipA OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=typA PE=3 SV=1 19 164 1.0E-22
sp|P0A3B3|TYPA_ECO57 GTP-binding protein TypA/BipA OS=Escherichia coli O157:H7 GN=typA PE=3 SV=1 19 164 1.0E-22
sp|P0A3B2|TYPA_ECO27 GTP-binding protein TypA/BipA OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=typA PE=3 SV=1 19 164 1.0E-22
sp|B5ZXQ5|LEPA_RHILW Elongation factor 4 OS=Rhizobium leguminosarum bv. trifolii (strain WSM2304) GN=lepA PE=3 SV=1 17 163 1.0E-22
sp|A5WCD6|LEPA_PSYWF Elongation factor 4 OS=Psychrobacter sp. (strain PRwf-1) GN=lepA PE=3 SV=1 13 198 1.0E-22
sp|A2C0M8|LEPA_PROM1 Elongation factor 4 OS=Prochlorococcus marinus (strain NATL1A) GN=lepA PE=3 SV=1 17 163 1.0E-22
sp|B1I1I5|EFG_DESAP Elongation factor G OS=Desulforudis audaxviator (strain MP104C) GN=fusA PE=3 SV=1 20 164 4.0E-22
sp|A0LRL7|EFG_ACIC1 Elongation factor G OS=Acidothermus cellulolyticus (strain ATCC 43068 / 11B) GN=fusA PE=3 SV=1 17 170 6.0E-22
sp|B3PME9|EFG_MYCA5 Elongation factor G OS=Mycoplasma arthritidis (strain 158L3-1) GN=fusA PE=3 SV=1 15 176 7.0E-22
sp|A1A0T0|EFG_BIFAA Elongation factor G OS=Bifidobacterium adolescentis (strain ATCC 15703 / DSM 20083 / NCTC 11814 / E194a) GN=fusA PE=3 SV=1 12 164 9.0E-22
sp|B1W417|EFG_STRGG Elongation factor G OS=Streptomyces griseus subsp. griseus (strain JCM 4626 / NBRC 13350) GN=fusA PE=3 SV=1 17 164 1.0E-21
sp|B8DTV6|EFG_BIFA0 Elongation factor G OS=Bifidobacterium animalis subsp. lactis (strain AD011) GN=fusA PE=3 SV=1 17 164 2.0E-21
sp|Q2SSW9|EFG_MYCCT Elongation factor G OS=Mycoplasma capricolum subsp. capricolum (strain California kid / ATCC 27343 / NCTC 10154) GN=fusA PE=3 SV=1 18 164 2.0E-21
sp|Q83NA0|EFG_TROW8 Elongation factor G OS=Tropheryma whipplei (strain TW08/27) GN=fusA PE=3 SV=1 12 164 3.0E-21
sp|Q83FP1|EFG_TROWT Elongation factor G OS=Tropheryma whipplei (strain Twist) GN=fusA PE=3 SV=1 12 164 3.0E-21
sp|A5IZ33|EFG_MYCAP Elongation factor G OS=Mycoplasma agalactiae (strain PG2) GN=fusA PE=3 SV=1 11 165 3.0E-21
sp|Q6F0J4|EFG_MESFL Elongation factor G OS=Mesoplasma florum (strain ATCC 33453 / NBRC 100688 / NCTC 11704 / L1) GN=fusA PE=3 SV=1 18 164 3.0E-21
sp|Q03ZQ2|EFG_LEUMM Elongation factor G OS=Leuconostoc mesenteroides subsp. mesenteroides (strain ATCC 8293 / NCDO 523) GN=fusA PE=3 SV=1 20 188 4.0E-21
sp|Q5ZYP6|EFG_LEGPH Elongation factor G OS=Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) GN=fusA PE=3 SV=1 20 164 4.0E-21
sp|Q5X862|EFG_LEGPA Elongation factor G OS=Legionella pneumophila (strain Paris) GN=fusA PE=3 SV=1 20 164 4.0E-21
sp|A5IHR7|EFG_LEGPC Elongation factor G OS=Legionella pneumophila (strain Corby) GN=fusA PE=3 SV=1 20 164 4.0E-21
sp|Q5WZL5|EFG_LEGPL Elongation factor G OS=Legionella pneumophila (strain Lens) GN=fusA PE=3 SV=1 20 164 4.0E-21
sp|Q5FM92|EFG_LACAC Elongation factor G OS=Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM) GN=fusA PE=3 SV=1 17 193 4.0E-21
sp|B1MW21|EFG_LEUCK Elongation factor G OS=Leuconostoc citreum (strain KM20) GN=fusA PE=3 SV=1 20 188 6.0E-21
sp|Q6MU82|EFG_MYCMS Elongation factor G OS=Mycoplasma mycoides subsp. mycoides SC (strain PG1) GN=fusA PE=3 SV=1 18 164 6.0E-21
sp|B5ELX6|EFG_ACIF5 Elongation factor G OS=Acidithiobacillus ferrooxidans (strain ATCC 53993) GN=fusA PE=3 SV=1 20 164 7.0E-21
sp|B7J464|EFG_ACIF2 Elongation factor G OS=Acidithiobacillus ferrooxidans (strain ATCC 23270 / DSM 14882 / CIP 104768 / NCIMB 8455) GN=fusA PE=3 SV=1 20 164 7.0E-21
sp|Q1R0H8|EFG_CHRSD Elongation factor G OS=Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIMB 13768) GN=fusA PE=3 SV=1 20 165 1.0E-20
sp|Q98QD8|EFG_MYCPU Elongation factor G OS=Mycoplasma pulmonis (strain UAB CTIP) GN=fusA PE=3 SV=2 18 172 1.0E-20
sp|Q04ED6|EFG_OENOB Elongation factor G OS=Oenococcus oeni (strain ATCC BAA-331 / PSU-1) GN=fusA PE=3 SV=1 19 176 2.0E-20
sp|B9DKV7|EFG_STACT Elongation factor G OS=Staphylococcus carnosus (strain TM300) GN=fusA PE=3 SV=1 20 191 2.0E-20
sp|B9DVS2|EFG_STRU0 Elongation factor G OS=Streptococcus uberis (strain ATCC BAA-854 / 0140J) GN=fusA PE=3 SV=1 17 164 3.0E-20
sp|P13550|EFG_ARTPT Elongation factor G OS=Arthrospira platensis GN=fusA PE=3 SV=1 19 164 5.0E-20
sp|Q8KTB2|EFG_RICTY Elongation factor G OS=Rickettsia typhi (strain ATCC VR-144 / Wilmington) GN=fusA PE=3 SV=2 13 164 6.0E-20
sp|P41084|EFG_RICPR Elongation factor G OS=Rickettsia prowazekii (strain Madrid E) GN=fusA PE=3 SV=3 13 164 9.0E-20
sp|Q7Z2Z2|ETUD1_HUMAN Elongation factor Tu GTP-binding domain-containing protein 1 OS=Homo sapiens GN=EFTUD1 PE=1 SV=2 704 839 4.0E-19
sp|B9LJC8|EFG_CHLSY Elongation factor G OS=Chloroflexus aurantiacus (strain ATCC 29364 / DSM 637 / Y-400-fl) GN=fusA PE=3 SV=1 18 203 9.0E-19
sp|A9WH62|EFG_CHLAA Elongation factor G OS=Chloroflexus aurantiacus (strain ATCC 29366 / DSM 635 / J-10-fl) GN=fusA PE=3 SV=1 18 203 9.0E-19
sp|Q9PA90|EFG_XYLFA Elongation factor G OS=Xylella fastidiosa (strain 9a5c) GN=fusA PE=3 SV=1 20 164 6.0E-18
sp|B0U5X3|EFG_XYLFM Elongation factor G OS=Xylella fastidiosa (strain M12) GN=fusA PE=3 SV=1 20 164 6.0E-18
sp|Q87A35|EFG_XYLFT Elongation factor G OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=fusA PE=3 SV=1 20 164 7.0E-18
sp|B2IA64|EFG_XYLF2 Elongation factor G OS=Xylella fastidiosa (strain M23) GN=fusA PE=3 SV=1 20 164 7.0E-18
sp|B2FQ42|EFG_STRMK Elongation factor G OS=Stenotrophomonas maltophilia (strain K279a) GN=fusA PE=3 SV=1 20 170 8.0E-18
sp|B4SKW0|EFG_STRM5 Elongation factor G OS=Stenotrophomonas maltophilia (strain R551-3) GN=fusA PE=3 SV=1 20 164 9.0E-18
sp|Q10W80|EFG2_TRIEI Elongation factor G 2 OS=Trichodesmium erythraeum (strain IMS101) GN=fusA2 PE=3 SV=1 17 164 1.0E-17
sp|Q8DCQ8|EFG_VIBVU Elongation factor G OS=Vibrio vulnificus (strain CMCP6) GN=fusA PE=3 SV=1 20 165 2.0E-17
sp|Q7MH42|EFG1_VIBVY Elongation factor G 1 OS=Vibrio vulnificus (strain YJ016) GN=fusA1 PE=3 SV=1 20 165 2.0E-17
sp|Q3BWY7|EFG_XANC5 Elongation factor G OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) GN=fusA PE=3 SV=1 20 164 3.0E-17
sp|Q8PNS6|EFG_XANAC Elongation factor G OS=Xanthomonas axonopodis pv. citri (strain 306) GN=fusA PE=3 SV=1 20 164 3.0E-17
sp|Q5GWS9|EFG_XANOR Elongation factor G OS=Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85) GN=fusA PE=3 SV=2 20 164 3.0E-17
sp|Q2NZY2|EFG_XANOM Elongation factor G OS=Xanthomonas oryzae pv. oryzae (strain MAFF 311018) GN=fusA PE=3 SV=1 20 164 3.0E-17
sp|A9IW31|EFG_BART1 Elongation factor G OS=Bartonella tribocorum (strain CIP 105476 / IBS 506) GN=fusA PE=3 SV=1 15 164 3.0E-17
sp|Q6FZB9|EFG_BARQU Elongation factor G OS=Bartonella quintana (strain Toulouse) GN=fusA PE=3 SV=1 15 164 4.0E-17
sp|Q8KQB3|EFG_BARHE Elongation factor G OS=Bartonella henselae (strain ATCC 49882 / DSM 28221 / Houston 1) GN=fusA PE=3 SV=1 15 164 4.0E-17
sp|Q9KUZ7|EFG1_VIBCH Elongation factor G 1 OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=fusA1 PE=3 SV=1 20 165 5.0E-17
sp|P28371|EFG1_SYNY3 Elongation factor G 1 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=fusA PE=1 SV=2 17 164 2.0E-15
sp|Q05FI2|EFG_CARRP Elongation factor G OS=Carsonella ruddii (strain PV) GN=fusA PE=3 SV=1 397 807 5.0E-14
sp|A9NEN3|EFG_ACHLI Elongation factor G OS=Acholeplasma laidlawii (strain PG-8A) GN=fusA PE=3 SV=1 721 806 2.0E-07
sp|Q253F1|EFG_CHLFF Elongation factor G OS=Chlamydophila felis (strain Fe/C-56) GN=fusA PE=3 SV=1 721 793 7.0E-07
sp|Q824G0|EFG_CHLCV Elongation factor G OS=Chlamydophila caviae (strain GPIC) GN=fusA PE=3 SV=1 721 793 1.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0005525 GTP binding Yes
GO:0003924 GTPase activity Yes
GO:0017111 nucleoside-triphosphatase activity No
GO:0005488 binding No
GO:0016787 hydrolase activity No
GO:0003674 molecular_function No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0000166 nucleotide binding No
GO:0043167 ion binding No
GO:0019001 guanyl nucleotide binding No
GO:0032553 ribonucleotide binding No
GO:0097367 carbohydrate derivative binding No
GO:0016817 hydrolase activity, acting on acid anhydrides No
GO:0043168 anion binding No
GO:0003824 catalytic activity No
GO:0017076 purine nucleotide binding No
GO:0097159 organic cyclic compound binding No
GO:1901265 nucleoside phosphate binding No
GO:0032555 purine ribonucleotide binding No
GO:0016818 hydrolase activity, acting on acid anhydrides, in phosphorus-containing anhydrides No
GO:1901363 heterocyclic compound binding No
GO:0036094 small molecule binding No
GO:0016462 pyrophosphatase activity No
GO:0032561 guanyl ribonucleotide binding No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup2397
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|67
Ophiocordyceps australis map64 (Brazil) OphauB2|5935 (this protein)
Ophiocordyceps camponoti-floridani Ophcf2|03958
Ophiocordyceps camponoti-rufipedis Ophun1|3840
Ophiocordyceps kimflemingae Ophio5|1734
Ophiocordyceps subramaniannii Hirsu2|3385

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|5935
MVNFTIDEIRALMDKPSNVRNMSVIAHVDHGKSTLTDSLLAKAGIISTAKAGDARATDTRADEQERGITIKSTAI
SLYGHLDDPEDVKDIVGQKTDGQDFLINLIDSPGHVDFSSEVTAALRVTDGALVVVDTVEGVCVQTETVLRQALG
ERIKPVVIINKVDRALLELQVSKEDLYQSFSRTIESVNVIISTYLDKALGDVQVYPYKGTVAFGSGLHGWAFTIR
QFAVRYAKKFGVDKNKMMERLWGDNYFNPHTKKWTKSDSYEGKPLERAFNQFILDPIFKIFAAVMNFRKEEIATL
LEKLNLKLSPEDKQKEGKQLLKAVMRTFLPAADSLLEMMILHLPSPVTAQRYRVETLYEGPMDDEAALGIRDCDP
KAPLMLYVSKMVPTSDKGRFYAFGRVFSGTVRSGLKVRIQGPNYVPGKKEDLFIKAIQRTVLMMGGKVEPIDDMP
AGNIVGLVGIDQFLLKSGTLTTSDTAHNLKVMKFSVSPVVQRSVQVKNAQDLPKLVEGLKRLSKSDPCVLTMTSE
SGEHIVAGAGELHLEICLKDLEEDHASVPLIISDPVVQYRETVQSKSSMTALSKSPNKHNRLYMVAEPMDEELSL
AIEAGKVSPRDDFKARARVLADDFGWDVTDARKIWTFGPDGTGANLLVDQTKAVQYLNEIKDSVVSGFQWASREG
PVAEEPMRSIRFNILDVTLHADAIHRGGGQIIPTTRRVLYASALLAEPALLEPVYLVEIQVPEQAMGGVYGVLTR
RRGHVFNEEQRPGTPLFNIKAYLPVLESFGFNGDLRQATSGQAFPQSVFDHWQVLPGGSPLDPTSKVGQIVTEMR
KRKGIKVEVPGVENYYDKL*
Coding >OphauB2|5935
ATGGTCAACTTCACAATCGACGAAATTCGGGCCTTGATGGACAAGCCCTCCAATGTCCGCAACATGTCCGTCATT
GCCCACGTCGACCACGGAAAGTCGACTCTGACCGACTCCCTGCTGGCCAAGGCCGGCATCATCTCCACTGCCAAG
GCTGGAGACGCTCGAGCAACCGACACTCGTGCAGACGAGCAAGAGCGTGGCATCACCATCAAGTCGACTGCTATC
TCCCTGTATGGTCATCTTGACGACCCCGAGGACGTAAAAGATATTGTTGGTCAAAAGACGGATGGCCAGGACTTC
CTCATCAACCTCATCGACTCCCCAGGCCACGTTGACTTTTCCTCCGAGGTGACGGCTGCTCTGCGCGTCACTGAC
GGTGCTCTTGTCGTCGTCGACACCGTCGAGGGTGTTTGCGTTCAGACCGAGACAGTCCTTCGTCAGGCCCTGGGT
GAACGCATCAAGCCCGTCGTCATCATCAACAAGGTTGACCGTGCTCTTCTCGAGCTCCAAGTTTCCAAGGAGGAC
CTCTACCAGTCCTTTTCTCGTACCATTGAGTCGGTCAATGTCATCATCTCTACCTACCTCGACAAGGCTTTGGGT
GACGTCCAAGTTTACCCCTACAAGGGTACAGTTGCCTTTGGCTCTGGTCTGCACGGCTGGGCTTTTACCATTCGC
CAATTCGCTGTTCGCTATGCCAAGAAGTTTGGTGTTGATAAGAACAAGATGATGGAGCGTCTGTGGGGCGACAAC
TACTTCAACCCTCACACCAAGAAGTGGACCAAGAGCGACAGCTATGAGGGCAAGCCCCTGGAGCGTGCTTTTAAC
CAATTCATTTTGGACCCCATATTCAAGATTTTTGCCGCCGTCATGAACTTCCGCAAGGAGGAAATTGCCACTCTG
CTCGAGAAGCTCAACCTCAAGCTATCGCCCGAAGATAAGCAGAAGGAGGGCAAGCAGCTGCTCAAGGCCGTCATG
CGCACCTTCCTTCCCGCTGCCGACTCGCTTCTTGAGATGATGATTTTGCATCTGCCTTCGCCCGTCACGGCCCAG
AGATATCGCGTGGAAACTCTATATGAGGGTCCCATGGATGACGAAGCTGCGCTTGGCATTCGTGACTGCGACCCC
AAAGCTCCTTTGATGCTTTACGTTTCCAAGATGGTGCCGACTTCGGACAAGGGCCGCTTCTATGCTTTTGGCCGT
GTCTTTTCTGGTACTGTGCGCTCCGGTCTCAAGGTGCGCATCCAGGGCCCCAACTATGTTCCCGGCAAGAAGGAG
GATCTCTTCATCAAGGCCATTCAGCGCACCGTTCTCATGATGGGCGGCAAGGTGGAGCCCATTGACGACATGCCT
GCTGGTAACATTGTTGGTCTGGTTGGCATTGACCAGTTCCTGCTCAAGTCTGGTACTCTGACTACAAGCGACACT
GCTCATAACCTCAAGGTGATGAAGTTCTCAGTCTCGCCCGTTGTCCAGCGCTCTGTGCAGGTCAAGAATGCTCAG
GATCTGCCCAAGCTGGTTGAAGGTCTCAAGCGTTTGTCCAAGTCTGATCCATGTGTCCTGACCATGACATCTGAG
TCTGGTGAGCACATTGTCGCTGGTGCTGGTGAGCTGCATCTCGAGATTTGCTTGAAGGATCTCGAAGAGGACCAC
GCTTCGGTGCCGCTCATCATCTCGGATCCTGTTGTGCAGTACCGCGAAACGGTTCAGAGCAAGTCGAGCATGACG
GCCCTGTCCAAGTCGCCCAACAAGCACAATCGTCTGTACATGGTGGCCGAGCCTATGGATGAAGAGCTGTCTCTT
GCCATTGAAGCCGGCAAGGTCAGTCCTCGTGACGACTTCAAGGCACGTGCCCGTGTCTTGGCAGATGACTTTGGC
TGGGACGTGACGGATGCTCGCAAGATCTGGACCTTTGGTCCTGATGGCACTGGCGCCAACCTGTTGGTGGACCAG
ACCAAGGCTGTGCAGTATCTCAACGAAATCAAGGACTCTGTCGTCTCAGGCTTCCAGTGGGCCAGCCGTGAGGGT
CCGGTTGCCGAAGAGCCGATGCGCTCGATCCGCTTCAATATCCTCGATGTGACGTTGCACGCTGATGCCATTCAT
CGTGGCGGTGGCCAGATCATCCCGACGACGCGTCGTGTACTGTATGCATCGGCTCTCCTGGCCGAGCCCGCCCTG
CTGGAACCAGTCTATCTGGTTGAGATTCAAGTGCCCGAGCAAGCCATGGGTGGCGTGTATGGTGTGCTGACTCGC
AGACGCGGTCACGTCTTCAACGAGGAGCAGCGTCCTGGCACTCCTCTATTCAACATCAAGGCCTATCTGCCCGTT
CTCGAGTCGTTTGGCTTCAATGGTGATTTGCGCCAGGCTACTTCTGGCCAGGCCTTCCCCCAATCCGTCTTTGAC
CATTGGCAGGTGCTGCCTGGTGGATCGCCGCTGGATCCTACCAGCAAGGTGGGCCAGATTGTCACCGAGATGCGC
AAGCGCAAGGGCATCAAGGTTGAGGTTCCCGGTGTTGAGAACTACTACGACAAGCTGTGA
Transcript >OphauB2|5935
ATGGTCAACTTCACAATCGACGAAATTCGGGCCTTGATGGACAAGCCCTCCAATGTCCGCAACATGTCCGTCATT
GCCCACGTCGACCACGGAAAGTCGACTCTGACCGACTCCCTGCTGGCCAAGGCCGGCATCATCTCCACTGCCAAG
GCTGGAGACGCTCGAGCAACCGACACTCGTGCAGACGAGCAAGAGCGTGGCATCACCATCAAGTCGACTGCTATC
TCCCTGTATGGTCATCTTGACGACCCCGAGGACGTAAAAGATATTGTTGGTCAAAAGACGGATGGCCAGGACTTC
CTCATCAACCTCATCGACTCCCCAGGCCACGTTGACTTTTCCTCCGAGGTGACGGCTGCTCTGCGCGTCACTGAC
GGTGCTCTTGTCGTCGTCGACACCGTCGAGGGTGTTTGCGTTCAGACCGAGACAGTCCTTCGTCAGGCCCTGGGT
GAACGCATCAAGCCCGTCGTCATCATCAACAAGGTTGACCGTGCTCTTCTCGAGCTCCAAGTTTCCAAGGAGGAC
CTCTACCAGTCCTTTTCTCGTACCATTGAGTCGGTCAATGTCATCATCTCTACCTACCTCGACAAGGCTTTGGGT
GACGTCCAAGTTTACCCCTACAAGGGTACAGTTGCCTTTGGCTCTGGTCTGCACGGCTGGGCTTTTACCATTCGC
CAATTCGCTGTTCGCTATGCCAAGAAGTTTGGTGTTGATAAGAACAAGATGATGGAGCGTCTGTGGGGCGACAAC
TACTTCAACCCTCACACCAAGAAGTGGACCAAGAGCGACAGCTATGAGGGCAAGCCCCTGGAGCGTGCTTTTAAC
CAATTCATTTTGGACCCCATATTCAAGATTTTTGCCGCCGTCATGAACTTCCGCAAGGAGGAAATTGCCACTCTG
CTCGAGAAGCTCAACCTCAAGCTATCGCCCGAAGATAAGCAGAAGGAGGGCAAGCAGCTGCTCAAGGCCGTCATG
CGCACCTTCCTTCCCGCTGCCGACTCGCTTCTTGAGATGATGATTTTGCATCTGCCTTCGCCCGTCACGGCCCAG
AGATATCGCGTGGAAACTCTATATGAGGGTCCCATGGATGACGAAGCTGCGCTTGGCATTCGTGACTGCGACCCC
AAAGCTCCTTTGATGCTTTACGTTTCCAAGATGGTGCCGACTTCGGACAAGGGCCGCTTCTATGCTTTTGGCCGT
GTCTTTTCTGGTACTGTGCGCTCCGGTCTCAAGGTGCGCATCCAGGGCCCCAACTATGTTCCCGGCAAGAAGGAG
GATCTCTTCATCAAGGCCATTCAGCGCACCGTTCTCATGATGGGCGGCAAGGTGGAGCCCATTGACGACATGCCT
GCTGGTAACATTGTTGGTCTGGTTGGCATTGACCAGTTCCTGCTCAAGTCTGGTACTCTGACTACAAGCGACACT
GCTCATAACCTCAAGGTGATGAAGTTCTCAGTCTCGCCCGTTGTCCAGCGCTCTGTGCAGGTCAAGAATGCTCAG
GATCTGCCCAAGCTGGTTGAAGGTCTCAAGCGTTTGTCCAAGTCTGATCCATGTGTCCTGACCATGACATCTGAG
TCTGGTGAGCACATTGTCGCTGGTGCTGGTGAGCTGCATCTCGAGATTTGCTTGAAGGATCTCGAAGAGGACCAC
GCTTCGGTGCCGCTCATCATCTCGGATCCTGTTGTGCAGTACCGCGAAACGGTTCAGAGCAAGTCGAGCATGACG
GCCCTGTCCAAGTCGCCCAACAAGCACAATCGTCTGTACATGGTGGCCGAGCCTATGGATGAAGAGCTGTCTCTT
GCCATTGAAGCCGGCAAGGTCAGTCCTCGTGACGACTTCAAGGCACGTGCCCGTGTCTTGGCAGATGACTTTGGC
TGGGACGTGACGGATGCTCGCAAGATCTGGACCTTTGGTCCTGATGGCACTGGCGCCAACCTGTTGGTGGACCAG
ACCAAGGCTGTGCAGTATCTCAACGAAATCAAGGACTCTGTCGTCTCAGGCTTCCAGTGGGCCAGCCGTGAGGGT
CCGGTTGCCGAAGAGCCGATGCGCTCGATCCGCTTCAATATCCTCGATGTGACGTTGCACGCTGATGCCATTCAT
CGTGGCGGTGGCCAGATCATCCCGACGACGCGTCGTGTACTGTATGCATCGGCTCTCCTGGCCGAGCCCGCCCTG
CTGGAACCAGTCTATCTGGTTGAGATTCAAGTGCCCGAGCAAGCCATGGGTGGCGTGTATGGTGTGCTGACTCGC
AGACGCGGTCACGTCTTCAACGAGGAGCAGCGTCCTGGCACTCCTCTATTCAACATCAAGGCCTATCTGCCCGTT
CTCGAGTCGTTTGGCTTCAATGGTGATTTGCGCCAGGCTACTTCTGGCCAGGCCTTCCCCCAATCCGTCTTTGAC
CATTGGCAGGTGCTGCCTGGTGGATCGCCGCTGGATCCTACCAGCAAGGTGGGCCAGATTGTCACCGAGATGCGC
AAGCGCAAGGGCATCAAGGTTGAGGTTCCCGGTGTTGAGAACTACTACGACAAGCTGTGA
Gene >OphauB2|5935
ATGGTCAAGTAGGTGCCTATAATGCCTCGCCAAGCTTGGCAGGAAGCTCAGCTGTCCGTCATGGCCGCTTTTGCT
CGCGCGCACAAGCTGGCCCTTGGCCCTTGGCTTGCGCCCACCCTTGCTAGACGGAATCAAGCCAAGTGCTGACAG
TCGGGAATAGCTTCACAATCGACGAAATTCGGGCCTTGATGGACAAGCCCTCCAATGTCCGCAACATGTCCGTCA
TTGCCCACGTCGACCACGGAAAGTCGACTCTGACCGACTCCCTGCTGGCCAAGGCCGGCATCATCTCCACTGCCA
AGGCTGGAGACGCTCGAGCAACCGACACTCGTGCAGACGAGCAAGAGCGTGGCATCACCATCAAGTCGACTGCTA
TCTCCCTGTATGGTCATCTTGACGACCCCGAGGACGTAAAAGATATTGTTGGTCAAAAGACGGATGGCCAGGACT
TCCTCATCAACCTCATCGACTCCCCAGGCCACGTTGACTTTTCCTCCGAGGTGACGGCTGCTCTGCGCGTCACTG
ACGGTGCTCTTGTCGTCGTCGACACCGTCGAGGGTGTTTGCGTTCAGACCGAGACAGTCCTTCGTCAGGCCCTGG
GTGAACGCATCAAGCCCGTCGTCATCATCAACAAGGTTGACCGTGCTCTTCTCGAGCTCCAAGTTTCCAAGGAGG
ACCTCTACCAGTCCTTTTCTCGTACCATTGAGTCGGTCAATGTCATCATCTCTACCTACCTCGACAAGGCTTTGG
GTGACGTCCAAGTTTACCCCTACAAGGGTACAGTTGCCTTTGGCTCTGGTCTGCACGGCTGGGCTTTTACCATTC
GCCAATTCGCTGTTCGCTATGCCAAGAAGTTTGGTGTTGATAAGAACAAGATGATGGAGCGTCTGTGGGTACGTT
TAAATGATTTCTCGGCGTAGCTTATGCCCCCTACTAGGCTTGGGGCTAATGATTTGCTTTCACAGGGCGACAACT
ACTTCAACCCTCACACCAAGAAGTGGACCAAGAGCGACAGCTATGAGGGCAAGCCCCTGGAGCGTGCTTTTAACC
AATTCATTTTGGACCCCATATTCAAGATTTTTGCCGCCGTCATGAACTTCCGCAAGGAGGAAATTGCCACTCTGC
TCGAGAAGCTCAACCTCAAGCTATCGCCCGAAGATAAGCAGAAGGAGGGCAAGCAGCTGCTCAAGGCCGTCATGC
GCACCTTCCTTCCCGCTGCCGACTCGCTTCTTGAGATGATGATTTTGCATCTGCCTTCGCCCGTCACGGCCCAGA
GATATCGCGTGGAAACTCTATATGAGGGTCCCATGGATGACGAAGCTGCGCTTGGCATTCGTGACTGCGACCCCA
AAGCTCCTTTGATGCTTTACGTTTCCAAGATGGTGCCGACTTCGGACAAGGGCCGCTTCTATGCTTTTGGCCGTG
TCTTTTCTGGTACTGTGCGCTCCGGTCTCAAGGTGCGCATCCAGGGCCCCAACTATGTTCCCGGCAAGAAGGAGG
ATCTCTTCATCAAGGCCATTCAGCGCACCGTTCTCATGATGGGCGGCAAGGTGGAGCCCATTGACGACATGCCTG
CTGGTAACATTGTTGGTCTGGTTGGCATTGACCAGTTCCTGCTCAAGTCTGGTACTCTGACTACAAGCGACACTG
CTCATAACCTCAAGGTGATGAAGTTCTCAGTCTCGCCCGTTGTCCAGCGCTCTGTGCAGGTCAAGAATGCTCAGG
ATCTGCCCAAGCTGGTTGAAGGTCTCAAGCGTTTGTCCAAGTCTGATCCATGTGTCCTGACCATGACATCTGAGT
CTGGTGAGCACATTGTCGCTGGTGCTGGTGAGCTGCATCTCGAGATTTGCTTGAAGGATCTCGAAGAGGACCACG
CTTCGGTGCCGCTCATCATCTCGGATCCTGTTGTGCAGTACCGCGAAACGGTTCAGAGCAAGTCGAGCATGACGG
CCCTGTCCAAGTCGCCCAACAAGCACAATCGTCTGTACATGGTGGCCGAGCCTATGGATGAAGAGCTGTCTCTTG
CCATTGAAGCCGGCAAGGTCAGTCCTCGTGACGACTTCAAGGCACGTGCCCGTGTCTTGGCAGATGACTTTGGCT
GGGACGTGACGGATGCTCGCAAGATCTGGACCTTTGGTCCTGATGGCACTGGCGCCAACCTGTTGGTGGACCAGA
CCAAGGCTGTGCAGTATCTCAACGAAATCAAGGACTCTGTCGTCTCAGGCTTCCAGTGGGCCAGCCGTGAGGGTC
CGGTTGCCGAAGAGCCGATGCGCTCGATCCGCTTCAATATCCTCGATGTGACGTTGCACGCTGATGCCATTCATC
GTGGCGGTGGCCAGATCATCCCGACGACGCGTCGTGTACTGTATGCATCGGCTCTCCTGGCCGAGCCCGCCCTGC
TGGAACCAGTCTATCTGGTTGAGATTCAAGTGCCCGAGCAAGCCATGGGTGGCGTGTATGGTGTGCTGACTCGCA
GACGCGGTCACGTCTTCAACGAGGAGCAGCGTCCTGGCACTCCTCTATTCAACATCAAGGCCTATCTGCCCGTTC
TCGAGTCGTTTGGCTTCAATGGTGATTTGCGCCAGGCTACTTCTGGCCAGGCCTTCCCCCAATCCGTCTTTGACC
ATTGGCAGGTGCTGCCTGGTGGATCGCCGCTGGATCCTACCAGCAAGGTGGGCCAGATTGTCACCGAGATGCGCA
AGCGCAAGGGCATCAAGGTTGAGGTTCCCGGTGTTGAGAACGTGAGTTATGCCCCAACCCCCCATGCAGAGAGGC
AAGAATGGGCGTTAACTCGATGCAGTACTACGACAAGCTGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail