Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|592
Gene name
LocationContig_11:192848..193664
Strand-
Gene length (bp)816
Transcript length (bp)816
Coding sequence length (bp)816
Protein length (aa) 272

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08493 AflR Aflatoxin regulatory protein 1.1E-05 74 168

Swissprot hits

(None)

GO

GO Term Description Terminal node
GO:0045122 aflatoxin biosynthetic process Yes
GO:0003677 DNA binding Yes
GO:0005634 nucleus Yes
GO:0006355 regulation of transcription, DNA-templated Yes
GO:0003676 nucleic acid binding No
GO:0044249 cellular biosynthetic process No
GO:0031323 regulation of cellular metabolic process No
GO:0019748 secondary metabolic process No
GO:1901363 heterocyclic compound binding No
GO:2001141 regulation of RNA biosynthetic process No
GO:0043385 mycotoxin metabolic process No
GO:0003674 molecular_function No
GO:1901378 organic heteropentacyclic compound biosynthetic process No
GO:0043227 membrane-bounded organelle No
GO:0046483 heterocycle metabolic process No
GO:0043386 mycotoxin biosynthetic process No
GO:0080090 regulation of primary metabolic process No
GO:0009404 toxin metabolic process No
GO:0044237 cellular metabolic process No
GO:0005488 binding No
GO:0018130 heterocycle biosynthetic process No
GO:0043231 intracellular membrane-bounded organelle No
GO:1901360 organic cyclic compound metabolic process No
GO:0044424 intracellular part No
GO:0046222 aflatoxin metabolic process No
GO:0044464 cell part No
GO:0010556 regulation of macromolecule biosynthetic process No
GO:0009058 biosynthetic process No
GO:0005575 cellular_component No
GO:0050789 regulation of biological process No
GO:0031326 regulation of cellular biosynthetic process No
GO:0019222 regulation of metabolic process No
GO:0009987 cellular process No
GO:0060255 regulation of macromolecule metabolic process No
GO:1901576 organic substance biosynthetic process No
GO:0008152 metabolic process No
GO:1903506 regulation of nucleic acid-templated transcription No
GO:1901376 organic heteropentacyclic compound metabolic process No
GO:0008150 biological_process No
GO:0051171 regulation of nitrogen compound metabolic process No
GO:0050794 regulation of cellular process No
GO:0010468 regulation of gene expression No
GO:0071704 organic substance metabolic process No
GO:0019219 regulation of nucleobase-containing compound metabolic process No
GO:0009889 regulation of biosynthetic process No
GO:0043229 intracellular organelle No
GO:2000112 regulation of cellular macromolecule biosynthetic process No
GO:0044550 secondary metabolite biosynthetic process No
GO:1901362 organic cyclic compound biosynthetic process No
GO:0043226 organelle No
GO:0065007 biological regulation No
GO:0051252 regulation of RNA metabolic process No
GO:0097159 organic cyclic compound binding No
GO:0009403 toxin biosynthetic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|592
MAMEALDGCQYGSLLSLPSASPDTLLEAEGDVLVSPDLEALNTQPKAAISAQWLDDLLSSTSHGLSEAEGVPLSS
RSSASPSSSPVCHNPHECCSAVATRLLATLHASSPSCLLNASPQLSRAVDSVLASCQEALGAMRGLLACPCYASP
PLQLLVAVIVAETLGWYRRIIDAYSRQGQAQPVVVRRSLFVGNHCLDHDLEAAVIGQVLLRRLQELETLIGDVAW
SGHGDSRSRHMLPEMHSRMHGFLETQLSAVRRALFNLDHDMASAAP*
Coding >OphauB2|592
ATGGCCATGGAAGCGCTGGATGGATGCCAATACGGCTCCTTGCTGTCGCTGCCGTCTGCCTCGCCGGATACCTTG
CTGGAAGCCGAGGGCGACGTGCTCGTCTCGCCCGATCTCGAGGCCTTGAATACACAGCCCAAGGCCGCCATTTCA
GCACAGTGGCTCGACGACCTCCTCTCCTCCACCAGCCACGGCCTGTCCGAGGCAGAGGGCGTGCCCCTGAGCTCC
CGCAGCAGCGCGTCGCCCTCGTCGTCGCCCGTCTGCCACAACCCCCACGAATGCTGCTCCGCCGTGGCCACGCGG
CTCCTGGCAACGCTTCACGCCAGCTCTCCCAGCTGCCTGCTCAACGCCTCGCCCCAGCTTTCCCGCGCCGTCGAC
AGCGTGCTTGCCTCGTGCCAAGAGGCGCTGGGGGCCATGCGCGGCTTACTGGCCTGCCCCTGTTATGCCAGTCCG
CCGCTGCAGCTGCTGGTAGCCGTCATTGTTGCCGAGACGCTCGGCTGGTACCGGCGCATCATTGACGCCTACAGC
CGCCAGGGTCAGGCCCAGCCCGTCGTTGTGAGACGCTCCCTGTTTGTCGGGAACCACTGCCTCGACCATGACTTG
GAGGCGGCTGTCATTGGCCAGGTTTTGCTCCGCCGCCTGCAGGAACTAGAGACGCTCATCGGAGACGTTGCCTGG
AGCGGCCACGGCGATTCTAGAAGCCGTCACATGCTGCCCGAGATGCATTCCAGAATGCATGGCTTTCTCGAAACT
CAGCTAAGCGCGGTGAGGCGCGCGCTATTCAACCTGGACCATGACATGGCGTCAGCAGCCCCATGA
Transcript >OphauB2|592
ATGGCCATGGAAGCGCTGGATGGATGCCAATACGGCTCCTTGCTGTCGCTGCCGTCTGCCTCGCCGGATACCTTG
CTGGAAGCCGAGGGCGACGTGCTCGTCTCGCCCGATCTCGAGGCCTTGAATACACAGCCCAAGGCCGCCATTTCA
GCACAGTGGCTCGACGACCTCCTCTCCTCCACCAGCCACGGCCTGTCCGAGGCAGAGGGCGTGCCCCTGAGCTCC
CGCAGCAGCGCGTCGCCCTCGTCGTCGCCCGTCTGCCACAACCCCCACGAATGCTGCTCCGCCGTGGCCACGCGG
CTCCTGGCAACGCTTCACGCCAGCTCTCCCAGCTGCCTGCTCAACGCCTCGCCCCAGCTTTCCCGCGCCGTCGAC
AGCGTGCTTGCCTCGTGCCAAGAGGCGCTGGGGGCCATGCGCGGCTTACTGGCCTGCCCCTGTTATGCCAGTCCG
CCGCTGCAGCTGCTGGTAGCCGTCATTGTTGCCGAGACGCTCGGCTGGTACCGGCGCATCATTGACGCCTACAGC
CGCCAGGGTCAGGCCCAGCCCGTCGTTGTGAGACGCTCCCTGTTTGTCGGGAACCACTGCCTCGACCATGACTTG
GAGGCGGCTGTCATTGGCCAGGTTTTGCTCCGCCGCCTGCAGGAACTAGAGACGCTCATCGGAGACGTTGCCTGG
AGCGGCCACGGCGATTCTAGAAGCCGTCACATGCTGCCCGAGATGCATTCCAGAATGCATGGCTTTCTCGAAACT
CAGCTAAGCGCGGTGAGGCGCGCGCTATTCAACCTGGACCATGACATGGCGTCAGCAGCCCCATGA
Gene >OphauB2|592
ATGGCCATGGAAGCGCTGGATGGATGCCAATACGGCTCCTTGCTGTCGCTGCCGTCTGCCTCGCCGGATACCTTG
CTGGAAGCCGAGGGCGACGTGCTCGTCTCGCCCGATCTCGAGGCCTTGAATACACAGCCCAAGGCCGCCATTTCA
GCACAGTGGCTCGACGACCTCCTCTCCTCCACCAGCCACGGCCTGTCCGAGGCAGAGGGCGTGCCCCTGAGCTCC
CGCAGCAGCGCGTCGCCCTCGTCGTCGCCCGTCTGCCACAACCCCCACGAATGCTGCTCCGCCGTGGCCACGCGG
CTCCTGGCAACGCTTCACGCCAGCTCTCCCAGCTGCCTGCTCAACGCCTCGCCCCAGCTTTCCCGCGCCGTCGAC
AGCGTGCTTGCCTCGTGCCAAGAGGCGCTGGGGGCCATGCGCGGCTTACTGGCCTGCCCCTGTTATGCCAGTCCG
CCGCTGCAGCTGCTGGTAGCCGTCATTGTTGCCGAGACGCTCGGCTGGTACCGGCGCATCATTGACGCCTACAGC
CGCCAGGGTCAGGCCCAGCCCGTCGTTGTGAGACGCTCCCTGTTTGTCGGGAACCACTGCCTCGACCATGACTTG
GAGGCGGCTGTCATTGGCCAGGTTTTGCTCCGCCGCCTGCAGGAACTAGAGACGCTCATCGGAGACGTTGCCTGG
AGCGGCCACGGCGATTCTAGAAGCCGTCACATGCTGCCCGAGATGCATTCCAGAATGCATGGCTTTCTCGAAACT
CAGCTAAGCGCGGTGAGGCGCGCGCTATTCAACCTGGACCATGACATGGCGTCAGCAGCCCCATGA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail