Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|5913
Gene name
LocationContig_5:159629..160919
Strand-
Gene length (bp)1290
Transcript length (bp)1134
Coding sequence length (bp)1134
Protein length (aa) 378

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF11566 PI31_Prot_N PI31 proteasome regulator N-terminal 6.1E-39 27 186
PF08577 PI31_Prot_C PI31 proteasome regulator 1.4E-11 264 324

Swissprot hits

(None)

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup6059
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|50
Ophiocordyceps australis map64 (Brazil) OphauB2|5913 (this protein)
Ophiocordyceps camponoti-floridani Ophcf2|03083
Ophiocordyceps kimflemingae Ophio5|4113
Ophiocordyceps subramaniannii Hirsu2|2225

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|5913
MASQPSTAAVLQGMAAAMPTHPCNDDSSDLASSYEAVALLVHAYLTARGFVLVSLDQDKLHEECTSLAPRLPPSW
NSRFGTYTFVYILAPWLDRLVVRVDRIGSRVEVRALVHGLDRISRLESAVRDIVAANGLPLRIPISDAQEDRGAA
LLDRLGGLFTSEAVVTSFLQSLDQAIVQPILPQLARQDADASQGDATARAERLASEASHLNLPPRSTIPPPSTVD
DAPPRARPTADFAPPDFEDEHQMLPRPATLPDGTSPFSIGADDLNPPGLGPLDPLRPCFTPGPSQGMQPSFDHPL
FAGRGRRVQDPQHPFGARYDPVGPGDDSLWGGSSGRAFGPRGQGPFGRGGHPFGGDGDGPFGGGGGGPFGGGGDG
II*
Coding >OphauB2|5913
ATGGCGTCGCAGCCAAGCACTGCTGCCGTGCTGCAAGGCATGGCCGCCGCGATGCCCACGCATCCTTGCAACGAC
GACTCGTCCGACCTGGCCAGTTCATACGAGGCTGTTGCCCTGCTTGTTCACGCCTACCTGACTGCCCGGGGCTTT
GTGCTCGTCAGTCTTGATCAAGACAAGCTGCACGAAGAATGCACCTCTCTCGCCCCTCGCCTTCCCCCGTCATGG
AACTCTCGCTTTGGAACCTACACCTTTGTCTACATTCTCGCCCCATGGCTTGACCGCCTCGTAGTTCGCGTCGAC
CGCATCGGCTCTCGCGTCGAAGTGCGCGCCCTCGTTCACGGCCTCGACCGCATTTCTCGCCTTGAAAGCGCCGTG
CGCGATATTGTGGCCGCGAATGGCTTGCCTCTGCGCATACCCATCTCTGACGCCCAAGAGGACAGGGGAGCTGCC
CTGCTTGACAGACTTGGTGGCCTCTTTACCTCTGAGGCTGTCGTTACCTCCTTTTTGCAAAGCCTCGACCAAGCC
ATTGTCCAACCCATCCTGCCCCAACTCGCCCGACAAGACGCAGACGCCTCCCAAGGCGACGCCACAGCTCGCGCC
GAGCGTCTGGCCTCTGAAGCCTCTCACCTCAACCTCCCTCCTCGCTCCACCATTCCCCCTCCTAGCACAGTCGAT
GACGCCCCCCCTCGCGCCCGTCCCACCGCAGACTTTGCTCCTCCCGACTTTGAAGACGAACACCAAATGCTTCCC
CGGCCCGCTACTCTACCCGACGGCACCTCCCCCTTTAGTATTGGCGCAGACGACTTGAACCCCCCGGGTCTCGGC
CCTCTCGATCCGCTGCGTCCTTGCTTCACACCCGGCCCCTCACAGGGCATGCAGCCGTCCTTTGACCATCCGCTC
TTTGCTGGCCGTGGCCGCCGTGTCCAGGACCCCCAGCACCCGTTTGGTGCTAGGTATGATCCAGTGGGACCTGGC
GATGATTCGTTATGGGGTGGCTCATCGGGGCGCGCGTTTGGGCCAAGAGGCCAGGGTCCATTTGGACGAGGAGGC
CATCCTTTTGGTGGTGATGGTGACGGCCCCTTTGGCGGTGGTGGTGGCGGTCCCTTTGGCGGCGGTGGTGACGGC
ATCATTTAG
Transcript >OphauB2|5913
ATGGCGTCGCAGCCAAGCACTGCTGCCGTGCTGCAAGGCATGGCCGCCGCGATGCCCACGCATCCTTGCAACGAC
GACTCGTCCGACCTGGCCAGTTCATACGAGGCTGTTGCCCTGCTTGTTCACGCCTACCTGACTGCCCGGGGCTTT
GTGCTCGTCAGTCTTGATCAAGACAAGCTGCACGAAGAATGCACCTCTCTCGCCCCTCGCCTTCCCCCGTCATGG
AACTCTCGCTTTGGAACCTACACCTTTGTCTACATTCTCGCCCCATGGCTTGACCGCCTCGTAGTTCGCGTCGAC
CGCATCGGCTCTCGCGTCGAAGTGCGCGCCCTCGTTCACGGCCTCGACCGCATTTCTCGCCTTGAAAGCGCCGTG
CGCGATATTGTGGCCGCGAATGGCTTGCCTCTGCGCATACCCATCTCTGACGCCCAAGAGGACAGGGGAGCTGCC
CTGCTTGACAGACTTGGTGGCCTCTTTACCTCTGAGGCTGTCGTTACCTCCTTTTTGCAAAGCCTCGACCAAGCC
ATTGTCCAACCCATCCTGCCCCAACTCGCCCGACAAGACGCAGACGCCTCCCAAGGCGACGCCACAGCTCGCGCC
GAGCGTCTGGCCTCTGAAGCCTCTCACCTCAACCTCCCTCCTCGCTCCACCATTCCCCCTCCTAGCACAGTCGAT
GACGCCCCCCCTCGCGCCCGTCCCACCGCAGACTTTGCTCCTCCCGACTTTGAAGACGAACACCAAATGCTTCCC
CGGCCCGCTACTCTACCCGACGGCACCTCCCCCTTTAGTATTGGCGCAGACGACTTGAACCCCCCGGGTCTCGGC
CCTCTCGATCCGCTGCGTCCTTGCTTCACACCCGGCCCCTCACAGGGCATGCAGCCGTCCTTTGACCATCCGCTC
TTTGCTGGCCGTGGCCGCCGTGTCCAGGACCCCCAGCACCCGTTTGGTGCTAGGTATGATCCAGTGGGACCTGGC
GATGATTCGTTATGGGGTGGCTCATCGGGGCGCGCGTTTGGGCCAAGAGGCCAGGGTCCATTTGGACGAGGAGGC
CATCCTTTTGGTGGTGATGGTGACGGCCCCTTTGGCGGTGGTGGTGGCGGTCCCTTTGGCGGCGGTGGTGACGGC
ATCATTTAG
Gene >OphauB2|5913
ATGGCGTCGCAGCCAAGCACTGCTGCCGTGCTGCAAGGCATGGCCGCCGCGATGCCCACGCATCCTTGCAACGAC
GACTCGTCCGACCTGGCCAGTTCATACGAGGCTGTTGCCCTGCTTGTTCACGCCTACCTGACTGCCCGGGGCTTT
GTGCTCGTCAGTCTTGATCAAGACAAGCTGCACGGTGCGTTTATTCTTGTTGTTTTGCCAGGTCGCTCCCTATAG
TAGAAACTGGTGGCTAACACGACGCAGAAGAATGCACCTCTCTCGCCCCTCGCCTTCCCCCGTCATGGAACTCTC
GCTTTGGAACCTACACCTTTGTCTACATTCTCGCCCCATGGCTTGACCGCCTCGTAGTTCGCGTCGACCGCATCG
GCTCTCGCGTCGAAGTGCGCGCCCTCGTTCACGGCCTCGACCGCATTTCTCGCCTTGAAAGCGCCGTGCGCGATA
TTGTGGCCGCGAATGGCTTGCCTCTGCGCATACCCATCTCTGACGCCCAAGAGGACAGGGGAGCTGCCCTGCTTG
ACAGACTTGGTGGCCTCTTTACCTCTGAGGCTGTCGTTACCTGTTAGTCTAGTCGCCTCATCTCTGCTGCCCTTG
GCCGCGCCATGCTCAAGTTGAACAAGACCATGGCTCAAGCTAACATTGCCCTCAGCCTTTTTGCAAAGCCTCGAC
CAAGCCATTGTCCAACCCATCCTGCCCCAACTCGCCCGACAAGACGCAGACGCCTCCCAAGGCGACGCCACAGCT
CGCGCCGAGCGTCTGGCCTCTGAAGCCTCTCACCTCAACCTCCCTCCTCGCTCCACCATTCCCCCTCCTAGCACA
GTCGATGACGCCCCCCCTCGCGCCCGTCCCACCGCAGACTTTGCTCCTCCCGACTTTGAAGACGAACACCAAATG
CTTCCCCGGCCCGCTACTCTACCCGACGGCACCTCCCCCTTTAGTATTGGCGCAGACGACTTGAACCCCCCGGGT
CTCGGCCCTCTCGATCCGCTGCGTCCTTGCTTCACACCCGGCCCCTCACAGGGCATGCAGCCGTCCTTTGACCAT
CCGCTCTTTGCTGGCCGTGGCCGCCGTGTCCAGGACCCCCAGCACCCGTTTGGTGCTAGGTATGATCCAGTGGGA
CCTGGCGATGATTCGTTATGGGGTGGCTCATCGGGGCGCGCGTTTGGGCCAAGAGGCCAGGGTCCATTTGGACGA
GGAGGCCATCCTTTTGGTGGTGATGGTGACGGCCCCTTTGGCGGTGGTGGTGGCGGTCCCTTTGGCGGCGGTGGT
GACGGCATCATTTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail