Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|5912
Gene name
LocationContig_5:155635..159038
Strand+
Gene length (bp)3403
Transcript length (bp)3195
Coding sequence length (bp)3195
Protein length (aa) 1065

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03810 IBN_N Importin-beta N-terminal domain 4.2E-10 23 98

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q10297|IMB5_SCHPO Importin subunit beta-5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=kap114 PE=3 SV=3 1 1057 8.0E-76
sp|Q91YE6|IPO9_MOUSE Importin-9 OS=Mus musculus GN=Ipo9 PE=1 SV=3 1 993 4.0E-53
sp|Q96P70|IPO9_HUMAN Importin-9 OS=Homo sapiens GN=IPO9 PE=1 SV=3 1 993 2.0E-52
sp|P53067|IMB5_YEAST Importin subunit beta-5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KAP114 PE=1 SV=1 374 957 1.0E-31
sp|P53067|IMB5_YEAST Importin subunit beta-5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KAP114 PE=1 SV=1 7 174 3.0E-12
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q10297|IMB5_SCHPO Importin subunit beta-5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=kap114 PE=3 SV=3 1 1057 8.0E-76
sp|Q91YE6|IPO9_MOUSE Importin-9 OS=Mus musculus GN=Ipo9 PE=1 SV=3 1 993 4.0E-53
sp|Q96P70|IPO9_HUMAN Importin-9 OS=Homo sapiens GN=IPO9 PE=1 SV=3 1 993 2.0E-52
sp|P53067|IMB5_YEAST Importin subunit beta-5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KAP114 PE=1 SV=1 374 957 1.0E-31
sp|P53067|IMB5_YEAST Importin subunit beta-5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KAP114 PE=1 SV=1 7 174 3.0E-12
sp|Q7SZC2|XPO2_DANRE Exportin-2 OS=Danio rerio GN=cse1l PE=2 SV=1 3 469 1.0E-08
sp|Q9PTU3|XPO2_PAGMA Exportin-2 OS=Pagrus major GN=cse1l PE=2 SV=1 3 469 1.0E-07
sp|Q8AY73|XPO2_ORENI Exportin-2 OS=Oreochromis niloticus GN=cse1l PE=2 SV=1 3 469 2.0E-07
sp|O59809|IMA3_SCHPO Probable importin c550.11 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC550.11 PE=3 SV=1 5 261 7.0E-07
sp|Q6GMY9|XPO2_XENLA Exportin-2 OS=Xenopus laevis GN=cse1l PE=2 SV=1 5 151 1.0E-06
sp|Q9XZU1|XPO2_DROME Exportin-2 OS=Drosophila melanogaster GN=Cas PE=2 SV=2 9 460 1.0E-06
sp|O13671|CSE1_SCHPO Importin-alpha re-exporter OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=kap109 PE=3 SV=2 35 138 3.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0031267 small GTPase binding Yes
GO:0006886 intracellular protein transport Yes
GO:0033036 macromolecule localization No
GO:0051641 cellular localization No
GO:0046907 intracellular transport No
GO:0070727 cellular macromolecule localization No
GO:0045184 establishment of protein localization No
GO:0051649 establishment of localization in cell No
GO:0008150 biological_process No
GO:0005488 binding No
GO:0071702 organic substance transport No
GO:0003674 molecular_function No
GO:0015031 protein transport No
GO:0019899 enzyme binding No
GO:0051179 localization No
GO:0006810 transport No
GO:0071705 nitrogen compound transport No
GO:0009987 cellular process No
GO:0005515 protein binding No
GO:0051020 GTPase binding No
GO:0051234 establishment of localization No
GO:0008104 protein localization No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 30 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|5912
MEEQLVQLLANTQLSDQGPRQQAELELKRAQSNPAFPVSLANVASHTSVATSLRQSALSTLRLFIEKNWAREDYD
NDPQVPISDEARALLKQSLLDLALSPEEDRKVKIAASYVVGKIATHDFPDQWPNLLSDVLGLLPSGSDAQLHGAL
RVLGDIVEESLSQDQFFSAASNIANGLTQVALSNARKPMLRALAVSIFRACIEMMNMATIRTARAQEAEAFVQSL
LEGDAATPSPSWISFFMGVLQERLPPADLTSGQPEAWNSIIALKLQVVKILLRLRRGYPHLAAPHSTGFFSAVWD
ELISTQDAHEQLYITSNAQGRLEDSDNLPYTLDFLILEELDLLNQYFRSTRVKAELESQLKGHSSAREVPWVVQL
MTMLVSYGRVTQEEEDLWDIDCSLYLAEETSVSANYTARTAAGDLLIKMGEAFDQQAIDGLYGYTSSLFPGTGTS
WQSQESALYLCVMLLSDFQDMGKTTRIPQPVAIEYYKLVDYAVSRSDQPLLRARGYLVAGMLGRSFPLPMVQSSP
AGPAASLLDHIIKCIATDESEVVQVACIKALEGLILADQVGQEKQVPIILAIQNYVNNKDPSDMEEADELVVTLA
EALRAAMMLNTQIALSNEVQAIDLLFLLAKLGASNYQATMLTTEAFEEIVKTMPNAAAYGALCSKTLPMLTGAFD
VANLTEDNPLVTVASELLLVLAQHGSEPLPDGFVAATFPKLSRLLLESTEGEVLRPGSDTVKWILAHDHQQVFGW
QDSNGVSGLEVCLRIIDRLLKPEIQDNSASEVGGLAAELVEKAGQERLGPFLPQLLQAVATRVDSAQAPPFIQSL
ILVFARLSLHGAHDVVEFLSQLQINGQNGLQTVMSKWLENSVSFAGYDEIRQNVIALSKLYSLNDVRLAQIMVRG
DLVVGADDGRIKTRSRAKQSITRSHDEELTRPIPLVPDHYTTIPATLKIIKVLIEELLSASGAHAAVSAASAAMA
AHAAEDEGGADDDGWEDEDEALEFAKADLWSLNEGNGGRVRDDGTQAYLTEFFIRCGQENVAGFQEWYNMLTDEE
KAKLNELANAAQQT*
Coding >OphauB2|5912
ATGGAGGAGCAGCTCGTGCAGCTCCTCGCCAACACGCAGTTGTCGGACCAAGGCCCGCGTCAACAGGCCGAGCTG
GAGCTAAAACGTGCCCAGTCCAACCCGGCCTTTCCAGTCTCTCTTGCAAACGTTGCTTCTCACACATCCGTCGCC
ACGTCGCTGCGTCAGTCTGCTCTCAGCACTTTGCGCCTCTTTATCGAGAAGAATTGGGCCAGAGAAGACTACGAC
AATGATCCCCAGGTGCCAATCTCGGACGAGGCGCGCGCCTTGCTCAAGCAGTCTCTGCTCGACTTGGCTCTGAGC
CCCGAGGAAGATCGCAAGGTCAAAATTGCTGCCAGCTATGTCGTTGGTAAGATTGCCACGCACGACTTTCCCGAC
CAATGGCCCAATCTTCTTTCCGATGTCCTCGGCCTCCTGCCATCGGGCTCAGATGCGCAACTGCACGGAGCTCTC
AGGGTCCTGGGCGATATTGTCGAAGAGAGTCTGAGCCAGGATCAATTCTTCTCGGCCGCCTCCAACATTGCCAAT
GGACTGACCCAAGTAGCCCTCAGCAATGCCCGCAAGCCTATGCTACGTGCACTCGCCGTTTCCATCTTTCGCGCA
TGCATCGAAATGATGAACATGGCCACGATTAGGACGGCGCGTGCACAAGAGGCAGAAGCCTTTGTGCAAAGTCTT
CTCGAGGGTGACGCAGCCACGCCGTCTCCCAGTTGGATATCCTTCTTCATGGGCGTCCTGCAAGAGCGCTTGCCC
CCAGCAGACTTGACATCTGGCCAGCCCGAGGCATGGAATAGCATCATTGCCCTCAAACTGCAGGTCGTCAAGATA
CTGCTTCGCTTGCGTCGCGGCTATCCTCACCTCGCCGCTCCCCACAGCACAGGCTTCTTTAGCGCCGTTTGGGAT
GAATTGATAAGCACCCAAGACGCACATGAGCAACTCTACATCACCTCAAACGCCCAGGGCCGCCTCGAAGACTCG
GACAATTTGCCCTATACCCTCGACTTTCTCATTCTTGAAGAGCTCGATTTACTCAACCAGTATTTCCGTTCGACA
CGCGTCAAGGCTGAGCTCGAGTCGCAGCTCAAGGGGCATAGCTCAGCCCGCGAGGTGCCGTGGGTGGTGCAGCTC
ATGACAATGCTGGTTAGTTACGGCCGTGTCACTCAGGAAGAGGAGGATCTTTGGGATATTGACTGTTCTCTTTAC
CTGGCCGAAGAAACATCAGTGTCGGCCAACTACACAGCTCGCACAGCTGCCGGGGATTTGCTCATCAAAATGGGC
GAAGCCTTTGACCAGCAGGCCATTGATGGTCTTTACGGCTATACCAGCAGCCTATTCCCCGGCACCGGTACCTCG
TGGCAGAGCCAAGAGTCTGCTCTCTACCTCTGTGTCATGCTTCTCAGCGACTTTCAGGACATGGGCAAGACGACG
CGCATTCCCCAGCCCGTGGCTATCGAGTACTACAAGCTCGTCGACTATGCTGTCTCGAGAAGCGACCAGCCGTTG
CTGCGCGCTCGAGGATACCTGGTTGCCGGCATGCTTGGGCGAAGCTTCCCACTGCCCATGGTTCAGTCGAGCCCG
GCGGGCCCAGCTGCCTCTCTTCTCGACCACATCATCAAGTGTATCGCGACTGACGAGTCGGAAGTGGTGCAAGTG
GCCTGCATCAAGGCCCTCGAAGGTCTGATTCTAGCCGACCAGGTGGGACAGGAAAAGCAAGTGCCCATAATCTTG
GCCATTCAAAACTATGTCAACAACAAGGACCCCAGCGACATGGAGGAGGCTGATGAACTAGTCGTCACCCTGGCC
GAGGCTCTACGGGCCGCCATGATGCTCAATACGCAGATTGCCCTCTCCAACGAGGTGCAAGCCATTGATTTGCTG
TTTTTGCTGGCCAAGCTGGGCGCTAGTAACTACCAGGCCACCATGCTGACCACGGAAGCCTTTGAGGAAATCGTC
AAGACGATGCCCAATGCCGCGGCCTATGGCGCCCTCTGCTCCAAGACACTGCCAATGCTTACCGGTGCCTTTGAC
GTGGCCAACCTTACCGAGGACAACCCGCTGGTGACTGTCGCGTCGGAGCTGCTTCTCGTCTTGGCCCAGCATGGC
TCTGAGCCTCTTCCCGACGGCTTCGTGGCCGCCACCTTTCCCAAGCTCAGTCGACTCCTCCTGGAGTCGACCGAG
GGCGAGGTTCTCCGCCCGGGCTCTGACACAGTCAAGTGGATTCTCGCCCACGACCACCAGCAAGTCTTTGGTTGG
CAAGACTCCAATGGCGTATCAGGCCTCGAGGTTTGTCTTCGTATTATTGATCGTTTGCTCAAGCCCGAGATTCAA
GACAACTCGGCCTCGGAAGTTGGCGGATTGGCTGCCGAGCTTGTTGAGAAGGCTGGCCAAGAAAGACTGGGGCCC
TTTTTACCGCAGCTGCTCCAAGCCGTGGCAACGCGAGTCGACTCTGCTCAAGCGCCGCCTTTTATCCAGTCCCTG
ATACTTGTATTTGCGCGACTGTCCTTGCATGGTGCTCATGACGTGGTTGAGTTTTTGAGCCAACTGCAAATCAAT
GGCCAGAATGGACTACAGACGGTCATGTCTAAGTGGCTGGAGAACTCGGTCAGCTTTGCGGGCTACGACGAGATT
CGACAAAATGTCATTGCCCTGTCCAAACTATATTCTCTCAACGATGTCCGCCTTGCCCAAATCATGGTCAGGGGA
GACTTGGTAGTCGGCGCAGACGACGGACGCATCAAGACGCGATCACGCGCCAAGCAATCCATAACTAGAAGTCAT
GATGAAGAGCTGACGAGGCCAATTCCACTAGTCCCCGACCACTACACGACCATTCCCGCAACGCTAAAGATCATC
AAGGTGCTGATTGAAGAGCTGCTGTCAGCATCTGGCGCGCATGCAGCAGTGAGCGCCGCGTCTGCGGCCATGGCT
GCTCATGCAGCAGAAGACGAAGGCGGTGCCGATGACGACGGGTGGGAAGACGAAGACGAGGCGCTAGAGTTTGCC
AAGGCAGACCTTTGGTCATTGAATGAGGGCAATGGCGGGCGGGTGCGTGACGATGGGACGCAGGCATATCTAACC
GAGTTTTTTATCCGCTGCGGGCAAGAAAACGTGGCGGGATTCCAAGAGTGGTACAATATGCTGACGGATGAGGAA
AAGGCCAAGTTGAACGAATTGGCCAATGCCGCCCAACAGACTTGA
Transcript >OphauB2|5912
ATGGAGGAGCAGCTCGTGCAGCTCCTCGCCAACACGCAGTTGTCGGACCAAGGCCCGCGTCAACAGGCCGAGCTG
GAGCTAAAACGTGCCCAGTCCAACCCGGCCTTTCCAGTCTCTCTTGCAAACGTTGCTTCTCACACATCCGTCGCC
ACGTCGCTGCGTCAGTCTGCTCTCAGCACTTTGCGCCTCTTTATCGAGAAGAATTGGGCCAGAGAAGACTACGAC
AATGATCCCCAGGTGCCAATCTCGGACGAGGCGCGCGCCTTGCTCAAGCAGTCTCTGCTCGACTTGGCTCTGAGC
CCCGAGGAAGATCGCAAGGTCAAAATTGCTGCCAGCTATGTCGTTGGTAAGATTGCCACGCACGACTTTCCCGAC
CAATGGCCCAATCTTCTTTCCGATGTCCTCGGCCTCCTGCCATCGGGCTCAGATGCGCAACTGCACGGAGCTCTC
AGGGTCCTGGGCGATATTGTCGAAGAGAGTCTGAGCCAGGATCAATTCTTCTCGGCCGCCTCCAACATTGCCAAT
GGACTGACCCAAGTAGCCCTCAGCAATGCCCGCAAGCCTATGCTACGTGCACTCGCCGTTTCCATCTTTCGCGCA
TGCATCGAAATGATGAACATGGCCACGATTAGGACGGCGCGTGCACAAGAGGCAGAAGCCTTTGTGCAAAGTCTT
CTCGAGGGTGACGCAGCCACGCCGTCTCCCAGTTGGATATCCTTCTTCATGGGCGTCCTGCAAGAGCGCTTGCCC
CCAGCAGACTTGACATCTGGCCAGCCCGAGGCATGGAATAGCATCATTGCCCTCAAACTGCAGGTCGTCAAGATA
CTGCTTCGCTTGCGTCGCGGCTATCCTCACCTCGCCGCTCCCCACAGCACAGGCTTCTTTAGCGCCGTTTGGGAT
GAATTGATAAGCACCCAAGACGCACATGAGCAACTCTACATCACCTCAAACGCCCAGGGCCGCCTCGAAGACTCG
GACAATTTGCCCTATACCCTCGACTTTCTCATTCTTGAAGAGCTCGATTTACTCAACCAGTATTTCCGTTCGACA
CGCGTCAAGGCTGAGCTCGAGTCGCAGCTCAAGGGGCATAGCTCAGCCCGCGAGGTGCCGTGGGTGGTGCAGCTC
ATGACAATGCTGGTTAGTTACGGCCGTGTCACTCAGGAAGAGGAGGATCTTTGGGATATTGACTGTTCTCTTTAC
CTGGCCGAAGAAACATCAGTGTCGGCCAACTACACAGCTCGCACAGCTGCCGGGGATTTGCTCATCAAAATGGGC
GAAGCCTTTGACCAGCAGGCCATTGATGGTCTTTACGGCTATACCAGCAGCCTATTCCCCGGCACCGGTACCTCG
TGGCAGAGCCAAGAGTCTGCTCTCTACCTCTGTGTCATGCTTCTCAGCGACTTTCAGGACATGGGCAAGACGACG
CGCATTCCCCAGCCCGTGGCTATCGAGTACTACAAGCTCGTCGACTATGCTGTCTCGAGAAGCGACCAGCCGTTG
CTGCGCGCTCGAGGATACCTGGTTGCCGGCATGCTTGGGCGAAGCTTCCCACTGCCCATGGTTCAGTCGAGCCCG
GCGGGCCCAGCTGCCTCTCTTCTCGACCACATCATCAAGTGTATCGCGACTGACGAGTCGGAAGTGGTGCAAGTG
GCCTGCATCAAGGCCCTCGAAGGTCTGATTCTAGCCGACCAGGTGGGACAGGAAAAGCAAGTGCCCATAATCTTG
GCCATTCAAAACTATGTCAACAACAAGGACCCCAGCGACATGGAGGAGGCTGATGAACTAGTCGTCACCCTGGCC
GAGGCTCTACGGGCCGCCATGATGCTCAATACGCAGATTGCCCTCTCCAACGAGGTGCAAGCCATTGATTTGCTG
TTTTTGCTGGCCAAGCTGGGCGCTAGTAACTACCAGGCCACCATGCTGACCACGGAAGCCTTTGAGGAAATCGTC
AAGACGATGCCCAATGCCGCGGCCTATGGCGCCCTCTGCTCCAAGACACTGCCAATGCTTACCGGTGCCTTTGAC
GTGGCCAACCTTACCGAGGACAACCCGCTGGTGACTGTCGCGTCGGAGCTGCTTCTCGTCTTGGCCCAGCATGGC
TCTGAGCCTCTTCCCGACGGCTTCGTGGCCGCCACCTTTCCCAAGCTCAGTCGACTCCTCCTGGAGTCGACCGAG
GGCGAGGTTCTCCGCCCGGGCTCTGACACAGTCAAGTGGATTCTCGCCCACGACCACCAGCAAGTCTTTGGTTGG
CAAGACTCCAATGGCGTATCAGGCCTCGAGGTTTGTCTTCGTATTATTGATCGTTTGCTCAAGCCCGAGATTCAA
GACAACTCGGCCTCGGAAGTTGGCGGATTGGCTGCCGAGCTTGTTGAGAAGGCTGGCCAAGAAAGACTGGGGCCC
TTTTTACCGCAGCTGCTCCAAGCCGTGGCAACGCGAGTCGACTCTGCTCAAGCGCCGCCTTTTATCCAGTCCCTG
ATACTTGTATTTGCGCGACTGTCCTTGCATGGTGCTCATGACGTGGTTGAGTTTTTGAGCCAACTGCAAATCAAT
GGCCAGAATGGACTACAGACGGTCATGTCTAAGTGGCTGGAGAACTCGGTCAGCTTTGCGGGCTACGACGAGATT
CGACAAAATGTCATTGCCCTGTCCAAACTATATTCTCTCAACGATGTCCGCCTTGCCCAAATCATGGTCAGGGGA
GACTTGGTAGTCGGCGCAGACGACGGACGCATCAAGACGCGATCACGCGCCAAGCAATCCATAACTAGAAGTCAT
GATGAAGAGCTGACGAGGCCAATTCCACTAGTCCCCGACCACTACACGACCATTCCCGCAACGCTAAAGATCATC
AAGGTGCTGATTGAAGAGCTGCTGTCAGCATCTGGCGCGCATGCAGCAGTGAGCGCCGCGTCTGCGGCCATGGCT
GCTCATGCAGCAGAAGACGAAGGCGGTGCCGATGACGACGGGTGGGAAGACGAAGACGAGGCGCTAGAGTTTGCC
AAGGCAGACCTTTGGTCATTGAATGAGGGCAATGGCGGGCGGGTGCGTGACGATGGGACGCAGGCATATCTAACC
GAGTTTTTTATCCGCTGCGGGCAAGAAAACGTGGCGGGATTCCAAGAGTGGTACAATATGCTGACGGATGAGGAA
AAGGCCAAGTTGAACGAATTGGCCAATGCCGCCCAACAGACTTGA
Gene >OphauB2|5912
ATGGAGGAGCAGCTCGTGCAGCTCCTCGCCAACACGCAGTTGTCGGACCAAGGCCCGCGTCAACAGGCCGAGCTG
GAGCTAAAACGTGCCCAGTCCAACCCGGCCTTTCCAGTCTCTCTTGCAAACGTTGCTTCTCACACATCCGTCGCC
ACGTCGCTGCGTCAGTCTGCTCTCAGCACTTTGCGCCTCTTTATCGAGAAGAATTGGGCCAGAGAAGACTACGAC
AATGATCCCCAGGTGCCAATCTCGGACGAGGCGCGCGCCTTGCTCAAGCAGTCTCTGCTCGACTTGGCTCTGAGC
CCCGAGGAAGATCGCAAGGTCAAAATTGCTGCCAGGTGCGACCTTGTCATCATGGCTGACAGCATTAATGTCTGG
ACCCTTCAAGGCATGCTGACTCGACTCGTAGCTATGTCGTTGGTAAGATTGCCACGCACGACTTTCCCGACCAAT
GGCCCAATCTTCTTTCCGATGTCCTCGGCCTCCTGCCATCGGGCTCAGATGCGCAACTGCACGGAGCTCTCAGGG
TCCTGGGCGATATTGTCGAAGAGAGTCTGAGCCAGGATCAATTCTTCTCGGCCGCCTCCAACATTGCCAATGGAC
TGACCCAAGTAGCCCTCAGCAATGCCCGCAAGCCTATGCTACGTGCACTCGCCGTTTCCATCTTTCGCGCATGCA
TCGAAATGATGAACATGGCCACGATTAGGACGGCGCGTGCACAAGAGGCAGAAGCCTTTGTGCAAAGTCTTCTCG
AGGGTGACGCAGCCACGCCGTCTCCCAGTTGGATATCCTTCTTCATGGGCGTCCTGCAAGAGCGCTTGCCCCCAG
CAGACTTGACATCTGGCCAGCCCGAGGCATGGAATAGCATCATTGCCCTCAAACTGCAGGTCGTCAAGATACTGC
TTCGCTTGCGTCGCGGCTATCCTCACCTCGCCGCTCCCCACAGCACAGGCTTCTTTAGCGCCGTTTGGGATGAAT
TGATAAGCACCCAAGACGCACATGAGCAACTCTACATCACCTCAAACGCCCAGGGCCGCCTCGAAGACTCGGACA
ATTTGCCCTATACCCTCGACTTTCTCATTCTTGAAGAGCTCGATTTACTCAACCAGTATTTCCGTTCGACACGCG
TCAAGGCTGAGCTCGAGTCGCAGCTCAAGGGGCATAGCTCAGCCCGCGAGGTGCCGTGGGTGGTGCAGCTCATGA
CAATGCTGGTTAGTTACGGCCGTGTCACTCAGGAAGAGGAGGATCTTTGGGATATTGACTGTTCTCTTTACCTGG
CCGAAGAAACATCAGTGTCGGCCAACTACACAGCTCGCACAGCTGCCGGGGATTTGCTCATCAAAATGGGCGAAG
CCTTTGACCAGCAGGCCATTGATGGTCTTTACGGCTATACCAGCAGCCTATTCCCCGGCACCGGTACCTCGTGGC
AGAGCCAAGAGTCTGCTCTCTACCTCTGTGTCATGCTTCTCAGCGACTTTCAGGACATGGGCAAGACGACGCGCA
TTCCCCAGCCCGTGGCTATCGAGTACTACAAGCTCGTCGACTATGCTGTCTCGAGAAGCGACCAGCCGTTGCTGC
GCGCTCGAGGATACCTGGTTGCCGGCATGCTTGGGCGAAGCTTCCCACTGCCCATGGTTCAGTCGAGCCCGGCGG
GCCCAGCTGCCTCTCTTCTCGACCACATCATCAAGTGTATCGCGACTGACGAGTCGGAAGTGGTGCAAGTGGCCT
GCATCAAGGCCCTCGAAGGTCTGATTCTAGCCGACCAGGTGGGACAGGAAAAGCAAGTGCCCATAATCTTGGCCA
TTCAAAACTATGTCAACAACAAGGACCCCAGCGACATGGAGGAGGCTGATGAACTAGTCGTCACCCTGGCCGAGG
CTCTACGGGCCGCCATGATGCTCAATACGCAGATTGCCCTCTCCAACGAGGTGCAAGCCATTGATTTGCTGTTTT
TGCTGGCCAAGCTGGGCGCTAGTAACTACCAGGCCACCATGCTGACCACGGAAGCCTTTGAGGAAATCGTCAAGA
CGATGCCCAATGCCGCGGCCTATGGCGCCCTCTGCTCCAAGACACTGCCAATGCTTACCGGTGCCTTTGACGTGG
CCAACCTTACCGAGGACAACCCGCTGGTGACTGTCGCGTCGGAGCTGCTTCTCGTCTTGGCCCAGCATGGCTCTG
AGCCTCTTCCCGACGGCTTCGTGGCCGCCACCTTTCCCAAGCTCAGTCGACTCCTCCTGGAGTCGACCGAGGGCG
AGGTTCTCCGCCCGGGCTCTGACACAGTCAAGTGGATTCTCGCCCACGACCACCAGCAAGTCTTTGGTTGGCAAG
ACTCCAATGGCGTATCAGGCCTCGAGGTTTGTCTTCGTATTATTGATCGTTTGCTCAAGCCCGAGATTCAAGACA
ACTCGGCCTCGGAAGTTGGCGGATTGGCTGCCGAGCTTGTTGAGAAGGCTGGCCAAGAAAGACTGGGGCCCTTTT
TACCGCAGCTGCTCCAAGCCGTGGCAACGCGAGTCGACTCTGCTCAAGCGCCGCCTTTTATCCAGTCCCTGATAC
TTGTATTTGCGCGACTGTCCTTGCATGGTGCTCATGACGTGGTTGAGTTTTTGAGCCAACTGCAAATCAATGGCC
AGAATGGACTACAGACGGTCATGTCTAAGTGGCTGGAGAACTCGGTCAGCTTTGCGGGCTACGACGAGATTCGAC
AAAAGTGGGTGACTTGTTTTTTTCTCCCATTGACCGACCGCTAAACAACTAACACGTGCTAACCAACTAGTGTCA
TTGCCCTGTCCAAACTATATTCTCTCAACGATGTCCGCCTTGCCCAAATCATGGTCAGGGGAGACTTGGTAGTCG
GCGCAGACGACGGACGCATCAAGACGCGATCACGCGCCAAGCAATGTATTCACACCCCTCCCCCCTCCCCCTTTC
CCCCTCAGCCGCCGACATGCTGACTGCAGAGCGCCCCCAAGCCATAACTAGAAGTCATGATGAAGAGCTGACGAG
GCCAATTCCACTAGTCCCCGACCACTACACGACCATTCCCGCAACGCTAAAGATCATCAAGGTGCTGATTGAAGA
GCTGCTGTCAGCATCTGGCGCGCATGCAGCAGTGAGCGCCGCGTCTGCGGCCATGGCTGCTCATGCAGCAGAAGA
CGAAGGCGGTGCCGATGACGACGGGTGGGAAGACGAAGACGAGGCGCTAGAGTTTGCCAAGGCAGACCTTTGGTC
ATTGAATGAGGGCAATGGCGGGCGGGTGCGTGACGATGGGACGCAGGCATATCTAACCGAGTTTTTTATCCGCTG
CGGGCAAGAAAACGTGGCGGGATTCCAAGAGTGGTACAATATGCTGACGGATGAGGAAAAGGCCAAGTTGAACGA
ATTGGCCAATGCCGCCCAACAGACTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail