Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|591
Gene name
LocationContig_11:189620..191196
Strand-
Gene length (bp)1576
Transcript length (bp)1455
Coding sequence length (bp)1455
Protein length (aa) 485

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01565 FAD_binding_4 FAD binding domain 7.9E-26 59 193

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|D7UQ40|SOL5_ALTSO Bifunctional solanapyrone synthase OS=Alternaria solani GN=sol5 PE=1 SV=1 23 482 2.0E-43
sp|D4B1P2|A2372_ARTBC Uncharacterized FAD-linked oxidoreductase ARB_02372 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_02372 PE=1 SV=1 23 482 3.0E-31
sp|P08159|HDNO_ARTOX 6-hydroxy-D-nicotine oxidase OS=Arthrobacter oxydans PE=1 SV=2 16 244 8.0E-27
sp|Q9FUJ3|CKX2_ARATH Cytokinin dehydrogenase 2 OS=Arabidopsis thaliana GN=CKX2 PE=1 SV=2 38 321 3.0E-19
sp|Q6Z955|CKX11_ORYSJ Cytokinin dehydrogenase 11 OS=Oryza sativa subsp. japonica GN=CKX11 PE=2 SV=1 58 247 4.0E-16
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|D7UQ40|SOL5_ALTSO Bifunctional solanapyrone synthase OS=Alternaria solani GN=sol5 PE=1 SV=1 23 482 2.0E-43
sp|D4B1P2|A2372_ARTBC Uncharacterized FAD-linked oxidoreductase ARB_02372 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_02372 PE=1 SV=1 23 482 3.0E-31
sp|P08159|HDNO_ARTOX 6-hydroxy-D-nicotine oxidase OS=Arthrobacter oxydans PE=1 SV=2 16 244 8.0E-27
sp|Q9FUJ3|CKX2_ARATH Cytokinin dehydrogenase 2 OS=Arabidopsis thaliana GN=CKX2 PE=1 SV=2 38 321 3.0E-19
sp|Q6Z955|CKX11_ORYSJ Cytokinin dehydrogenase 11 OS=Oryza sativa subsp. japonica GN=CKX11 PE=2 SV=1 58 247 4.0E-16
sp|Q9FUJ2|CKX4_ARATH Cytokinin dehydrogenase 4 OS=Arabidopsis thaliana GN=CKX4 PE=1 SV=2 39 223 1.0E-14
sp|Q6YW51|CKX6_ORYSJ Cytokinin dehydrogenase 6 OS=Oryza sativa subsp. japonica GN=CKX6 PE=3 SV=1 59 243 1.0E-11
sp|P43485|MCRA_STRLA Mitomycin radical oxidase OS=Streptomyces lavendulae GN=mcrA PE=1 SV=2 56 231 2.0E-11
sp|Q9LY71|CKX6_ARATH Cytokinin dehydrogenase 6 OS=Arabidopsis thaliana GN=CKX6 PE=2 SV=2 52 251 8.0E-11
sp|Q9FUJ1|CKX7_ARATH Cytokinin dehydrogenase 7 OS=Arabidopsis thaliana GN=CKX7 PE=1 SV=1 57 222 2.0E-10
sp|Q796Y5|YGAK_BACSU Uncharacterized FAD-linked oxidoreductase YgaK OS=Bacillus subtilis (strain 168) GN=ygaK PE=3 SV=4 80 231 2.0E-10
sp|Q5JLP4|CKX4_ORYSJ Cytokinin dehydrogenase 4 OS=Oryza sativa subsp. japonica GN=CKX4 PE=2 SV=1 52 241 2.0E-10
sp|O22213|CKX1_ARATH Cytokinin dehydrogenase 1 OS=Arabidopsis thaliana GN=CKX1 PE=1 SV=1 6 223 2.0E-10
sp|A3AVP1|CKX8_ORYSJ Cytokinin dehydrogenase 8 OS=Oryza sativa subsp. japonica GN=CKX8 PE=3 SV=1 59 222 1.0E-09
sp|A2XVN3|CKX8_ORYSI Cytokinin dehydrogenase 8 OS=Oryza sativa subsp. indica GN=CKX8 PE=3 SV=1 59 222 1.0E-09
sp|Q6YW50|CKX7_ORYSJ Cytokinin dehydrogenase 7 OS=Oryza sativa subsp. japonica GN=CKX7 PE=3 SV=1 59 241 1.0E-09
sp|Q9T0N8|CKX1_MAIZE Cytokinin dehydrogenase 1 OS=Zea mays GN=CKX1 PE=1 SV=2 59 224 1.0E-08
sp|Q75K78|CKX9_ORYSJ Cytokinin dehydrogenase 9 OS=Oryza sativa subsp. japonica GN=CKX9 PE=2 SV=1 59 240 1.0E-08
sp|Q5Z620|CKX10_ORYSJ Cytokinin dehydrogenase 10 OS=Oryza sativa subsp. japonica GN=CKX10 PE=3 SV=1 58 291 2.0E-08
sp|Q9LTS3|CKX3_ARATH Cytokinin dehydrogenase 3 OS=Arabidopsis thaliana GN=CKX3 PE=1 SV=1 52 222 2.0E-08
sp|Q0JQ12|CKX1_ORYSJ Cytokinin dehydrogenase 1 OS=Oryza sativa subsp. japonica GN=CKX1 PE=3 SV=2 59 224 6.0E-08
sp|Q67YU0|CKX5_ARATH Cytokinin dehydrogenase 5 OS=Arabidopsis thaliana GN=CKX5 PE=2 SV=1 1 223 6.0E-08
sp|Q5ZAY9|CKX5_ORYSJ Cytokinin dehydrogenase 5 OS=Oryza sativa subsp. japonica GN=CKX5 PE=2 SV=1 32 223 8.0E-08
sp|Q4ADV8|CKX2_ORYSJ Cytokinin dehydrogenase 2 OS=Oryza sativa subsp. japonica GN=CKX2 PE=2 SV=1 45 222 1.0E-07
sp|Q8LNV6|CKX3_ORYSJ Cytokinin dehydrogenase 3 OS=Oryza sativa subsp. japonica GN=CKX3 PE=2 SV=1 87 261 2.0E-07
sp|Q54H55|Y8969_DICDI FAD-linked oxidoreductase DDB_G0289697 OS=Dictyostelium discoideum GN=DDB_G0289697 PE=2 SV=1 59 218 3.0E-07
sp|A6P6V9|CBDAS_CANSA Cannabidiolic acid synthase OS=Cannabis sativa GN=CBDAS PE=1 SV=1 59 466 5.0E-07
sp|D4B1Z7|A2478_ARTBC Uncharacterized FAD-linked oxidoreductase ARB_02478 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_02478 PE=1 SV=1 137 218 7.0E-07
sp|Q8GTB6|THCAS_CANSA Tetrahydrocannabinolic acid synthase OS=Cannabis sativa PE=1 SV=1 59 217 9.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0055114 oxidation-reduction process Yes
GO:0016491 oxidoreductase activity Yes
GO:0050660 flavin adenine dinucleotide binding Yes
GO:0097159 organic cyclic compound binding No
GO:0008150 biological_process No
GO:0043168 anion binding No
GO:0000166 nucleotide binding No
GO:0050662 coenzyme binding No
GO:0005488 binding No
GO:1901363 heterocyclic compound binding No
GO:1901265 nucleoside phosphate binding No
GO:0036094 small molecule binding No
GO:0003674 molecular_function No
GO:0043167 ion binding No
GO:0008152 metabolic process No
GO:0048037 cofactor binding No
GO:0003824 catalytic activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 18 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|591
MVQFTLVALAAAIPALASPTSRCKALDAQIPGRVSFPSSSPYKLSLSSYYSGQERELNPGCIFRPTTTDEVAKFV
RFVTKSNDTRFAVRGGGHTLWSGAANVNGGITVDMRLMNSLELSSDEKVARLGAGGVWDHYYAQLGPKNLTVMGG
RVPGIGVGGFATGGGITFLSRRHGFSCDNIIGYEIVLASGKVVYVTQQSHPDLWMALKGGSNNFGIITRADVATF
SLDKMWYNLVSYNYSDSVLQAQANAFSNFMKPENFDSAAMMGIFLDYRGGSFAVNDALWYIENKASPAVYKPFTD
IPNNGGPAELTDVNDVVQQFGSSIPATTGRAFQLTFSFTNPSPAVYMQLFKIFEEGMAAVANVQDIFVEFLTQPQ
PVTKGINVFGLETGKSDYVLIDMTAAYTKKSDDGRVKNALNNIVKKQRALLKKNGHLIEFIYLNYADISQPVLQS
WGANNLGKLRAASKKYDPHGVFQRQSPGGYKLFK*
Coding >OphauB2|591
ATGGTTCAATTCACTCTTGTCGCTCTCGCAGCGGCTATACCAGCACTTGCCTCTCCAACATCAAGATGCAAGGCC
CTCGACGCCCAAATTCCAGGCCGCGTCTCCTTTCCCAGCAGCTCACCATACAAGCTCTCGCTCTCCTCCTACTAC
AGCGGCCAGGAGCGCGAGCTCAACCCCGGATGCATCTTCCGGCCCACCACGACGGATGAAGTGGCCAAGTTTGTC
AGGTTCGTCACCAAGAGCAACGACACTCGCTTCGCTGTCCGTGGTGGCGGCCATACTCTTTGGTCTGGCGCGGCA
AACGTCAATGGCGGCATTACGGTGGATATGCGCTTGATGAACTCGCTTGAGCTGAGCAGTGATGAAAAGGTGGCT
CGGCTGGGAGCTGGTGGCGTGTGGGATCATTACTATGCCCAGCTGGGGCCCAAGAACCTGACTGTCATGGGCGGT
CGTGTTCCAGGCATTGGCGTCGGAGGATTTGCTACTGGAGGCGGCATCACCTTTTTGTCTCGTCGACACGGCTTT
AGCTGTGACAACATTATTGGCTACGAAATTGTCCTTGCCAGCGGCAAAGTCGTCTATGTCACTCAGCAGTCCCAC
CCGGACCTCTGGATGGCGCTCAAGGGCGGCTCCAACAACTTTGGCATCATTACGCGCGCCGACGTGGCCACCTTT
TCCCTGGACAAGATGTGGTACAACCTCGTCTCGTACAACTACTCGGACAGCGTGTTGCAGGCGCAGGCAAATGCC
TTTAGCAACTTTATGAAGCCAGAGAATTTTGACAGCGCCGCCATGATGGGCATCTTTTTGGACTACAGGGGGGGG
TCCTTTGCCGTCAATGATGCGCTGTGGTATATCGAGAACAAGGCCAGCCCAGCAGTTTACAAGCCCTTTACCGAT
ATCCCCAACAATGGAGGCCCGGCAGAGCTCACTGATGTGAATGATGTGGTGCAACAGTTTGGAAGCAGCATTCCA
GCCACTACCGGCCGAGCTTTCCAACTCACCTTTTCCTTTACAAACCCCAGCCCCGCCGTCTACATGCAGCTCTTC
AAAATCTTTGAAGAGGGCATGGCCGCCGTGGCAAACGTGCAAGACATTTTTGTCGAGTTCCTCACGCAGCCGCAG
CCCGTAACCAAGGGCATCAACGTCTTTGGCCTCGAGACTGGCAAGTCGGACTATGTCCTCATTGACATGACGGCC
GCCTACACCAAGAAGAGCGACGATGGACGCGTCAAGAATGCACTCAACAATATTGTCAAGAAGCAGCGCGCCCTG
CTCAAGAAGAATGGCCATCTCATTGAATTTATCTATCTCAACTATGCAGACATTTCGCAGCCGGTGCTGCAAAGC
TGGGGCGCAAACAACTTGGGCAAGCTGCGTGCTGCGAGCAAGAAGTATGACCCCCATGGCGTGTTTCAGAGGCAG
TCTCCTGGTGGGTATAAGCTGTTCAAGTAG
Transcript >OphauB2|591
ATGGTTCAATTCACTCTTGTCGCTCTCGCAGCGGCTATACCAGCACTTGCCTCTCCAACATCAAGATGCAAGGCC
CTCGACGCCCAAATTCCAGGCCGCGTCTCCTTTCCCAGCAGCTCACCATACAAGCTCTCGCTCTCCTCCTACTAC
AGCGGCCAGGAGCGCGAGCTCAACCCCGGATGCATCTTCCGGCCCACCACGACGGATGAAGTGGCCAAGTTTGTC
AGGTTCGTCACCAAGAGCAACGACACTCGCTTCGCTGTCCGTGGTGGCGGCCATACTCTTTGGTCTGGCGCGGCA
AACGTCAATGGCGGCATTACGGTGGATATGCGCTTGATGAACTCGCTTGAGCTGAGCAGTGATGAAAAGGTGGCT
CGGCTGGGAGCTGGTGGCGTGTGGGATCATTACTATGCCCAGCTGGGGCCCAAGAACCTGACTGTCATGGGCGGT
CGTGTTCCAGGCATTGGCGTCGGAGGATTTGCTACTGGAGGCGGCATCACCTTTTTGTCTCGTCGACACGGCTTT
AGCTGTGACAACATTATTGGCTACGAAATTGTCCTTGCCAGCGGCAAAGTCGTCTATGTCACTCAGCAGTCCCAC
CCGGACCTCTGGATGGCGCTCAAGGGCGGCTCCAACAACTTTGGCATCATTACGCGCGCCGACGTGGCCACCTTT
TCCCTGGACAAGATGTGGTACAACCTCGTCTCGTACAACTACTCGGACAGCGTGTTGCAGGCGCAGGCAAATGCC
TTTAGCAACTTTATGAAGCCAGAGAATTTTGACAGCGCCGCCATGATGGGCATCTTTTTGGACTACAGGGGGGGG
TCCTTTGCCGTCAATGATGCGCTGTGGTATATCGAGAACAAGGCCAGCCCAGCAGTTTACAAGCCCTTTACCGAT
ATCCCCAACAATGGAGGCCCGGCAGAGCTCACTGATGTGAATGATGTGGTGCAACAGTTTGGAAGCAGCATTCCA
GCCACTACCGGCCGAGCTTTCCAACTCACCTTTTCCTTTACAAACCCCAGCCCCGCCGTCTACATGCAGCTCTTC
AAAATCTTTGAAGAGGGCATGGCCGCCGTGGCAAACGTGCAAGACATTTTTGTCGAGTTCCTCACGCAGCCGCAG
CCCGTAACCAAGGGCATCAACGTCTTTGGCCTCGAGACTGGCAAGTCGGACTATGTCCTCATTGACATGACGGCC
GCCTACACCAAGAAGAGCGACGATGGACGCGTCAAGAATGCACTCAACAATATTGTCAAGAAGCAGCGCGCCCTG
CTCAAGAAGAATGGCCATCTCATTGAATTTATCTATCTCAACTATGCAGACATTTCGCAGCCGGTGCTGCAAAGC
TGGGGCGCAAACAACTTGGGCAAGCTGCGTGCTGCGAGCAAGAAGTATGACCCCCATGGCGTGTTTCAGAGGCAG
TCTCCTGGTGGGTATAAGCTGTTCAAGTAG
Gene >OphauB2|591
ATGGTTCAATTCACTCTTGTCGCTCTCGCAGCGGCTATACCAGCACTTGCCTCTCCAACATCAAGATGCAAGGCC
CTCGACGCCCAAATTCCAGGCCGCGTCTCCTTTCCCAGCAGCTCACCATACAAGCTCTCGCTCTCCTCCTACTAC
AGCGGCCAGGAGCGCGAGCTCAACCCCGGATGCATCTTCCGGCCCACCACGACGGATGAAGTGGCCAAGTTTGTC
AGGTTCGTCACCAAGAGCAACGACACTCGCTTCGCTGTCCGTGGTGGCGGCCATACTCTTTGGTCTGGCGCGGCA
AACGTCAATGGCGGCATTACGGTGGATATGCGCTTGATGAACTCGCTTGAGCTGAGCAGTGATGAAAAGGTGGCT
CGGCTGGGAGCTGGTGGCGTGTGGGATCATTACTATGCCCAGCTGGGGCCCAAGAACCTGACTGTCATGGGCGGT
CGTGTTCCAGGCATTGGCGTCGGAGGATTTGCTACTGGAGGTGAGTCTGAAAAGCCATAAAACTTGCATCTTGCT
TGAAGCTTACCCCTGGTCCCAAGGCGGCATCACCTTTTTGTCTCGTCGACACGGCTTTAGCTGTGACAACATTAT
TGGCTACGAAATTGTCCTTGCCAGCGGCAAAGTCGTCTATGTCACTCAGCAGTCCCACCCGGACCTCTGGATGGC
GCTCAAGGGCGGCTCCAACAACTTTGGCATCATTACGCGCGCCGACGTGGCCACCTTTTCCCTGGACAAGATGTG
GTACAACCTCGTCTCGTACAACTACTCGGACAGCGTGTTGCAGGCGCAGGCAAATGCCTTTAGCAACTTTATGAA
GCCAGAGAATTTTGACAGCGCCGCCATGATGGGCATCTTTTTGGACTACAGGGGGGGGTCCTTTGCCGTCAATGA
TGCGCTGTGGTATATCGAGAACAAGGCCAGCCCAGCAGTTTACAAGCCCTTTACCGATATCCCCAACAATGGAGG
CCCGGCAGAGCTCACTGATGTGAATGATGTGGTGCAACAGTTTGGAAGCAGCATTCCAGCCACTACCGGCCGGTA
AGAAACCCCTACTCTCTACTTTTTGAACAAGCAACTGGTGGTGGCTAACATTCTTTTCAGAGCTTTCCAACTCAC
CTTTTCCTTTACAAACCCCAGCCCCGCCGTCTACATGCAGCTCTTCAAAATCTTTGAAGAGGGCATGGCCGCCGT
GGCAAACGTGCAAGACATTTTTGTCGAGTTCCTCACGCAGCCGCAGCCCGTAACCAAGGGCATCAACGTCTTTGG
CCTCGAGACTGGCAAGTCGGACTATGTCCTCATTGACATGACGGCCGCCTACACCAAGAAGAGCGACGATGGACG
CGTCAAGAATGCACTCAACAATATTGTCAAGAAGCAGCGCGCCCTGCTCAAGAAGAATGGCCATCTCATTGAATT
TATCTATCTCAACTATGCAGACATTTCGCAGCCGGTGCTGCAAAGCTGGGGCGCAAACAACTTGGGCAAGCTGCG
TGCTGCGAGCAAGAAGTATGACCCCCATGGCGTGTTTCAGAGGCAGTCTCCTGGTGGGTATAAGCTGTTCAAGTA
G

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail