Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|59
Gene name
LocationContig_1:140194..141709
Strand+
Gene length (bp)1515
Transcript length (bp)1515
Coding sequence length (bp)1515
Protein length (aa) 505

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13402 Peptidase_M60 Peptidase M60, enhancin and enhancin-like 3.4E-32 157 451
PF17291 M60-like_N N-terminal domain of M60-like peptidases 6.2E-05 41 139

Swissprot hits

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 18 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|59
MAIALLVLLALVTPYAALPLAEEAVIFSQPRSIELRAMPDAQDEKQRLRHRSMCADFQPTGFYLPPSVGLKIRVS
GVDAKGAKLELLVGLQPSVTQRHDAWIDLIATSLQVFGPFEDGHHFISGASELQGIIYLRYTYPAGQDRPRAANV
TLDDSPVPFPFYRQGVTTDQEWMAMLKATRVPYAEMSGKHVIVSGLAHDARRHAERGQKQHKLLESYSRIMQAQD
ALSALSPDAPDARDRSSPLRLMVVQCPLMERPCAFDYGVCAPEGHYMWDSSFKMSFWPVWHELGHHRELGLSLSW
EGTAEASASLYGVAVARSLGFDDWLNYAIFDGNAWNRLSIFFVQDALTDRQWANARAFLDSYFITNETAPDFDRL
DSYVQLFLYEQLRVAFGPDFWPRMHKAARRAPIIAPTISPPAHSPQDTTNQLKHFFATQAANLAGVDLTDFFAKW
RLNLPQSAIHHMQRLPKPTQDYAALKVGFCRQHPANQSCAQDPLSPLPPSLLID*
Coding >OphauB2|59
ATGGCCATTGCCCTTCTTGTCCTTTTGGCTCTAGTCACGCCCTATGCAGCTTTGCCCCTGGCAGAGGAGGCGGTA
ATATTCTCACAGCCACGCTCCATTGAGCTGCGCGCTATGCCTGATGCTCAAGATGAGAAGCAGCGCTTGCGACAC
AGGTCCATGTGTGCCGACTTCCAGCCCACGGGCTTCTACCTGCCCCCCTCTGTTGGCCTGAAAATAAGAGTTTCG
GGAGTGGACGCCAAGGGAGCCAAACTCGAGCTTCTGGTTGGCCTTCAACCGTCAGTCACGCAGCGACATGATGCT
TGGATCGACTTGATTGCCACTTCTCTGCAGGTATTTGGGCCCTTTGAGGATGGACACCATTTCATCTCGGGCGCC
AGTGAGCTGCAAGGCATCATCTATCTTCGCTATACCTACCCAGCCGGTCAGGACAGACCCAGGGCAGCCAACGTG
ACCTTGGACGACTCGCCTGTGCCATTTCCCTTTTATCGTCAAGGCGTGACGACGGACCAAGAGTGGATGGCCATG
CTCAAGGCCACACGCGTTCCCTATGCCGAAATGTCTGGCAAACACGTCATCGTCTCGGGCCTTGCCCACGACGCC
AGGAGACACGCCGAGCGCGGCCAGAAGCAGCACAAGTTGCTCGAGTCGTATTCGCGCATCATGCAGGCCCAGGAT
GCCCTGAGCGCCCTCAGCCCAGACGCGCCAGACGCCAGAGACAGAAGCAGCCCCCTCCGGCTCATGGTGGTGCAG
TGTCCGCTCATGGAGCGTCCATGTGCCTTTGACTACGGCGTGTGTGCTCCCGAGGGCCACTACATGTGGGACAGC
AGCTTCAAGATGTCCTTTTGGCCCGTCTGGCACGAGCTGGGCCATCATCGTGAGCTGGGCCTATCCTTGAGCTGG
GAGGGCACGGCCGAGGCCAGCGCCAGCCTCTACGGCGTGGCTGTGGCCAGGAGCCTCGGCTTCGACGACTGGCTC
AACTACGCCATCTTTGACGGCAACGCTTGGAACAGACTGTCCATCTTCTTTGTCCAGGACGCCCTGACAGACCGC
CAGTGGGCCAACGCAAGGGCCTTTCTCGACAGCTACTTCATCACAAACGAGACTGCTCCCGACTTTGACCGCCTC
GACTCCTATGTCCAGCTCTTTTTATACGAGCAGCTCCGAGTTGCCTTTGGTCCCGACTTTTGGCCGCGCATGCAC
AAGGCTGCTCGCCGCGCCCCCATCATTGCTCCCACCATTTCGCCTCCTGCCCATTCGCCCCAAGACACTACCAAC
CAACTAAAGCATTTCTTCGCCACCCAGGCTGCCAACCTTGCTGGCGTCGACTTGACCGACTTCTTCGCCAAGTGG
CGACTCAATCTTCCCCAGTCTGCTATTCACCACATGCAGCGCCTGCCCAAGCCTACTCAAGACTACGCCGCCCTC
AAAGTCGGCTTCTGTAGGCAACATCCAGCCAACCAATCTTGCGCCCAAGACCCCCTGTCGCCGCTGCCCCCGAGT
CTGCTCATAGACTAG
Transcript >OphauB2|59
ATGGCCATTGCCCTTCTTGTCCTTTTGGCTCTAGTCACGCCCTATGCAGCTTTGCCCCTGGCAGAGGAGGCGGTA
ATATTCTCACAGCCACGCTCCATTGAGCTGCGCGCTATGCCTGATGCTCAAGATGAGAAGCAGCGCTTGCGACAC
AGGTCCATGTGTGCCGACTTCCAGCCCACGGGCTTCTACCTGCCCCCCTCTGTTGGCCTGAAAATAAGAGTTTCG
GGAGTGGACGCCAAGGGAGCCAAACTCGAGCTTCTGGTTGGCCTTCAACCGTCAGTCACGCAGCGACATGATGCT
TGGATCGACTTGATTGCCACTTCTCTGCAGGTATTTGGGCCCTTTGAGGATGGACACCATTTCATCTCGGGCGCC
AGTGAGCTGCAAGGCATCATCTATCTTCGCTATACCTACCCAGCCGGTCAGGACAGACCCAGGGCAGCCAACGTG
ACCTTGGACGACTCGCCTGTGCCATTTCCCTTTTATCGTCAAGGCGTGACGACGGACCAAGAGTGGATGGCCATG
CTCAAGGCCACACGCGTTCCCTATGCCGAAATGTCTGGCAAACACGTCATCGTCTCGGGCCTTGCCCACGACGCC
AGGAGACACGCCGAGCGCGGCCAGAAGCAGCACAAGTTGCTCGAGTCGTATTCGCGCATCATGCAGGCCCAGGAT
GCCCTGAGCGCCCTCAGCCCAGACGCGCCAGACGCCAGAGACAGAAGCAGCCCCCTCCGGCTCATGGTGGTGCAG
TGTCCGCTCATGGAGCGTCCATGTGCCTTTGACTACGGCGTGTGTGCTCCCGAGGGCCACTACATGTGGGACAGC
AGCTTCAAGATGTCCTTTTGGCCCGTCTGGCACGAGCTGGGCCATCATCGTGAGCTGGGCCTATCCTTGAGCTGG
GAGGGCACGGCCGAGGCCAGCGCCAGCCTCTACGGCGTGGCTGTGGCCAGGAGCCTCGGCTTCGACGACTGGCTC
AACTACGCCATCTTTGACGGCAACGCTTGGAACAGACTGTCCATCTTCTTTGTCCAGGACGCCCTGACAGACCGC
CAGTGGGCCAACGCAAGGGCCTTTCTCGACAGCTACTTCATCACAAACGAGACTGCTCCCGACTTTGACCGCCTC
GACTCCTATGTCCAGCTCTTTTTATACGAGCAGCTCCGAGTTGCCTTTGGTCCCGACTTTTGGCCGCGCATGCAC
AAGGCTGCTCGCCGCGCCCCCATCATTGCTCCCACCATTTCGCCTCCTGCCCATTCGCCCCAAGACACTACCAAC
CAACTAAAGCATTTCTTCGCCACCCAGGCTGCCAACCTTGCTGGCGTCGACTTGACCGACTTCTTCGCCAAGTGG
CGACTCAATCTTCCCCAGTCTGCTATTCACCACATGCAGCGCCTGCCCAAGCCTACTCAAGACTACGCCGCCCTC
AAAGTCGGCTTCTGTAGGCAACATCCAGCCAACCAATCTTGCGCCCAAGACCCCCTGTCGCCGCTGCCCCCGAGT
CTGCTCATAGACTAG
Gene >OphauB2|59
ATGGCCATTGCCCTTCTTGTCCTTTTGGCTCTAGTCACGCCCTATGCAGCTTTGCCCCTGGCAGAGGAGGCGGTA
ATATTCTCACAGCCACGCTCCATTGAGCTGCGCGCTATGCCTGATGCTCAAGATGAGAAGCAGCGCTTGCGACAC
AGGTCCATGTGTGCCGACTTCCAGCCCACGGGCTTCTACCTGCCCCCCTCTGTTGGCCTGAAAATAAGAGTTTCG
GGAGTGGACGCCAAGGGAGCCAAACTCGAGCTTCTGGTTGGCCTTCAACCGTCAGTCACGCAGCGACATGATGCT
TGGATCGACTTGATTGCCACTTCTCTGCAGGTATTTGGGCCCTTTGAGGATGGACACCATTTCATCTCGGGCGCC
AGTGAGCTGCAAGGCATCATCTATCTTCGCTATACCTACCCAGCCGGTCAGGACAGACCCAGGGCAGCCAACGTG
ACCTTGGACGACTCGCCTGTGCCATTTCCCTTTTATCGTCAAGGCGTGACGACGGACCAAGAGTGGATGGCCATG
CTCAAGGCCACACGCGTTCCCTATGCCGAAATGTCTGGCAAACACGTCATCGTCTCGGGCCTTGCCCACGACGCC
AGGAGACACGCCGAGCGCGGCCAGAAGCAGCACAAGTTGCTCGAGTCGTATTCGCGCATCATGCAGGCCCAGGAT
GCCCTGAGCGCCCTCAGCCCAGACGCGCCAGACGCCAGAGACAGAAGCAGCCCCCTCCGGCTCATGGTGGTGCAG
TGTCCGCTCATGGAGCGTCCATGTGCCTTTGACTACGGCGTGTGTGCTCCCGAGGGCCACTACATGTGGGACAGC
AGCTTCAAGATGTCCTTTTGGCCCGTCTGGCACGAGCTGGGCCATCATCGTGAGCTGGGCCTATCCTTGAGCTGG
GAGGGCACGGCCGAGGCCAGCGCCAGCCTCTACGGCGTGGCTGTGGCCAGGAGCCTCGGCTTCGACGACTGGCTC
AACTACGCCATCTTTGACGGCAACGCTTGGAACAGACTGTCCATCTTCTTTGTCCAGGACGCCCTGACAGACCGC
CAGTGGGCCAACGCAAGGGCCTTTCTCGACAGCTACTTCATCACAAACGAGACTGCTCCCGACTTTGACCGCCTC
GACTCCTATGTCCAGCTCTTTTTATACGAGCAGCTCCGAGTTGCCTTTGGTCCCGACTTTTGGCCGCGCATGCAC
AAGGCTGCTCGCCGCGCCCCCATCATTGCTCCCACCATTTCGCCTCCTGCCCATTCGCCCCAAGACACTACCAAC
CAACTAAAGCATTTCTTCGCCACCCAGGCTGCCAACCTTGCTGGCGTCGACTTGACCGACTTCTTCGCCAAGTGG
CGACTCAATCTTCCCCAGTCTGCTATTCACCACATGCAGCGCCTGCCCAAGCCTACTCAAGACTACGCCGCCCTC
AAAGTCGGCTTCTGTAGGCAACATCCAGCCAACCAATCTTGCGCCCAAGACCCCCTGTCGCCGCTGCCCCCGAGT
CTGCTCATAGACTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail