Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|5894
Gene name
LocationContig_5:115583..117083
Strand-
Gene length (bp)1500
Transcript length (bp)1500
Coding sequence length (bp)1500
Protein length (aa) 500

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08491 SE Squalene epoxidase 2.9E-87 193 456
PF01266 DAO FAD dependent oxidoreductase 9.8E-08 21 49
PF01494 FAD_binding_3 FAD binding domain 2.9E-05 18 80
PF13450 NAD_binding_8 NAD(P)-binding Rossmann-like domain 2.1E-05 23 49

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q92206|ERG1_CANAL Squalene monooxygenase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=ERG1 PE=3 SV=1 20 497 3.0E-108
sp|Q9C1W3|ERG1_SCHPO Probable squalene monooxygenase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=erg1 PE=3 SV=1 30 497 2.0E-101
sp|O13306|ERG1_CANGA Squalene monooxygenase OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=ERG1 PE=3 SV=2 20 497 3.0E-101
sp|P52019|ERG1_MOUSE Squalene monooxygenase OS=Mus musculus GN=Sqle PE=2 SV=1 18 497 3.0E-97
sp|P32476|ERG1_YEAST Squalene monooxygenase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ERG1 PE=1 SV=2 20 497 6.0E-96
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q92206|ERG1_CANAL Squalene monooxygenase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=ERG1 PE=3 SV=1 20 497 3.0E-108
sp|Q9C1W3|ERG1_SCHPO Probable squalene monooxygenase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=erg1 PE=3 SV=1 30 497 2.0E-101
sp|O13306|ERG1_CANGA Squalene monooxygenase OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=ERG1 PE=3 SV=2 20 497 3.0E-101
sp|P52019|ERG1_MOUSE Squalene monooxygenase OS=Mus musculus GN=Sqle PE=2 SV=1 18 497 3.0E-97
sp|P32476|ERG1_YEAST Squalene monooxygenase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ERG1 PE=1 SV=2 20 497 6.0E-96
sp|Q14534|ERG1_HUMAN Squalene monooxygenase OS=Homo sapiens GN=SQLE PE=1 SV=3 2 497 2.0E-95
sp|P52020|ERG1_RAT Squalene monooxygenase OS=Rattus norvegicus GN=Sqle PE=2 SV=1 18 497 1.0E-93
sp|O81000|ERG15_ARATH Squalene epoxidase 2, mitochondrial OS=Arabidopsis thaliana GN=SQE2 PE=1 SV=1 19 453 1.0E-92
sp|Q9SM02|ERG14_ARATH Squalene epoxidase 1 OS=Arabidopsis thaliana GN=SQE1 PE=1 SV=1 19 464 6.0E-91
sp|Q75F69|ERG1_ASHGO Squalene monooxygenase OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=ERG1 PE=3 SV=1 10 499 3.0E-88
sp|O48651|ERG1_PANGI Squalene monooxygenase OS=Panax ginseng PE=2 SV=1 18 496 3.0E-87
sp|Q8VYH2|ERG16_ARATH Squalene epoxidase 3 OS=Arabidopsis thaliana GN=SQE3 PE=1 SV=1 33 453 4.0E-85
sp|O65404|ERG11_ARATH Squalene epoxidase 5 OS=Arabidopsis thaliana GN=SQE5 PE=2 SV=2 7 473 1.0E-73
sp|O65402|ERG12_ARATH Squalene epoxidase 6 OS=Arabidopsis thaliana GN=SQE6 PE=2 SV=1 19 496 5.0E-71
sp|O65727|ERG11_BRANA Squalene monooxygenase 1,1 OS=Brassica napus GN=SQP1,1 PE=2 SV=1 8 475 2.0E-69
sp|O65726|ERG12_BRANA Squalene monooxygenase 1,2 OS=Brassica napus GN=SQP1,2 PE=2 SV=1 20 473 2.0E-68
sp|O65403|ERG13_ARATH Squalene epoxidase 4 OS=Arabidopsis thaliana GN=SQE4 PE=2 SV=1 2 453 2.0E-61
[Show less]

GO

GO Term Description Terminal node
GO:0016491 oxidoreductase activity Yes
GO:0071949 FAD binding Yes
GO:0004506 squalene monooxygenase activity Yes
GO:0050660 flavin adenine dinucleotide binding Yes
GO:0016021 integral component of membrane Yes
GO:0003824 catalytic activity No
GO:0043168 anion binding No
GO:0005575 cellular_component No
GO:0005488 binding No
GO:0003674 molecular_function No
GO:0000166 nucleotide binding No
GO:0043167 ion binding No
GO:0031224 intrinsic component of membrane No
GO:0110165 cellular anatomical entity No
GO:0036094 small molecule binding No
GO:0097159 organic cyclic compound binding No
GO:1901265 nucleoside phosphate binding No
GO:0016705 oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen No
GO:1901363 heterocyclic compound binding No
GO:0016709 oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, NAD(P)H as one donor, and incorporation of one atom of oxygen No
GO:0004497 monooxygenase activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 39 0.5

Transmembrane Domains

Domain # Start End Length
1 21 38 17
2 440 462 22
3 469 491 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|5894
MTGSLAAEACLRRKTHHEAEVVVVGAGVFGCAIAYALANQGRSVLLLERWIKEPDRIVGELLQPGGVAALRKLGL
GDCLEGIDAIPCHGYTVFFQGQECPIPYPPVDHGGHVPHKWGGAGDGSSGKRPEGRSFHHGRFIGRLRKACMAHA
NITVVETEVVKLVRGQHANHVLGVESRTKHPHGGEKRPDYFFGHLTIVADGYDSHFRKQVLCGSKSKPIVRSKFY
ALQLIDCDLPRPGLGHVIIGDAYPVLVYQIGAHETRMLIDVPTGIPEASPAAGGVRGYIRDIVLPALPCRIRPSA
ERALADGKIPRSMPNSWLPSSRQSTPGLILLGDAFNMRHPLTGGGMTVALGDALELSQLVQPLPNLEDSRAVQSV
IDTLYWRRKNRTAIINILAQALYSLFAADDRQLRALQAGCFEYFRRGSTDGPCGLLAGIVHQPMVLVYHFFSVAF
LAIWINACAVVGSSLLAPLHVPLALIDMVLILWKASIVFLPLLWREVFQ*
Coding >OphauB2|5894
ATGACAGGCAGTCTCGCAGCCGAAGCGTGTCTGCGCCGCAAGACGCACCACGAGGCAGAAGTCGTTGTCGTTGGC
GCCGGCGTTTTTGGCTGCGCAATTGCCTATGCCCTTGCCAACCAGGGCCGGTCGGTGCTGCTGCTCGAACGATGG
ATCAAGGAACCCGATCGCATTGTTGGCGAGTTGTTACAGCCAGGAGGCGTTGCCGCGCTGCGCAAGCTCGGCCTG
GGCGACTGTCTCGAAGGCATCGACGCTATTCCCTGCCACGGATACACCGTCTTCTTCCAGGGCCAGGAATGCCCC
ATTCCATATCCGCCTGTCGACCATGGGGGCCATGTGCCGCACAAGTGGGGAGGCGCGGGCGATGGAAGCAGCGGC
AAGCGGCCCGAGGGACGCAGCTTTCACCACGGCCGCTTTATTGGGCGGCTGCGCAAAGCTTGCATGGCCCACGCC
AACATTACCGTGGTGGAGACGGAGGTGGTGAAGCTGGTGCGTGGCCAACACGCCAACCATGTCTTGGGCGTCGAG
TCGCGCACCAAGCACCCCCATGGCGGCGAGAAGCGGCCCGACTATTTCTTTGGCCACTTGACCATTGTCGCCGAC
GGCTACGACTCGCACTTTCGCAAGCAAGTCCTCTGCGGCTCCAAGAGCAAGCCCATTGTGCGCTCCAAGTTCTAT
GCCCTCCAACTCATCGACTGCGACTTGCCCCGGCCTGGCCTCGGCCACGTCATTATAGGCGATGCCTACCCCGTC
CTTGTATATCAGATTGGCGCCCACGAGACTCGCATGCTGATTGACGTGCCCACTGGCATCCCCGAAGCCTCTCCT
GCCGCCGGCGGCGTGCGCGGCTACATTCGCGACATTGTCCTTCCAGCACTGCCATGTCGCATCCGGCCGTCTGCA
GAACGCGCCTTGGCCGATGGCAAGATTCCGCGCTCCATGCCAAACAGCTGGCTTCCTTCTTCGCGCCAGTCCACC
CCCGGACTCATCCTGCTCGGCGATGCCTTTAATATGCGCCACCCACTGACTGGCGGCGGCATGACGGTGGCCCTT
GGCGATGCCCTCGAGCTCTCTCAACTCGTCCAACCCCTTCCCAACCTCGAGGACTCGCGCGCCGTCCAGTCGGTC
ATTGACACGCTCTACTGGCGCCGCAAGAACCGCACCGCCATTATCAATATTCTGGCACAGGCCCTCTACTCGCTC
TTTGCCGCAGACGACCGTCAGTTGCGCGCTCTGCAAGCTGGATGCTTTGAGTACTTTCGCCGCGGCTCTACAGAC
GGGCCCTGCGGCCTCCTCGCTGGCATCGTGCACCAGCCCATGGTCCTCGTCTACCACTTCTTCTCCGTCGCCTTT
CTCGCCATTTGGATCAATGCGTGCGCCGTGGTTGGCTCAAGTCTGCTGGCGCCCTTGCATGTGCCCCTTGCCCTA
ATTGACATGGTACTCATTCTGTGGAAAGCGAGTATTGTCTTTTTGCCGCTTCTCTGGCGCGAGGTGTTTCAGTGA
Transcript >OphauB2|5894
ATGACAGGCAGTCTCGCAGCCGAAGCGTGTCTGCGCCGCAAGACGCACCACGAGGCAGAAGTCGTTGTCGTTGGC
GCCGGCGTTTTTGGCTGCGCAATTGCCTATGCCCTTGCCAACCAGGGCCGGTCGGTGCTGCTGCTCGAACGATGG
ATCAAGGAACCCGATCGCATTGTTGGCGAGTTGTTACAGCCAGGAGGCGTTGCCGCGCTGCGCAAGCTCGGCCTG
GGCGACTGTCTCGAAGGCATCGACGCTATTCCCTGCCACGGATACACCGTCTTCTTCCAGGGCCAGGAATGCCCC
ATTCCATATCCGCCTGTCGACCATGGGGGCCATGTGCCGCACAAGTGGGGAGGCGCGGGCGATGGAAGCAGCGGC
AAGCGGCCCGAGGGACGCAGCTTTCACCACGGCCGCTTTATTGGGCGGCTGCGCAAAGCTTGCATGGCCCACGCC
AACATTACCGTGGTGGAGACGGAGGTGGTGAAGCTGGTGCGTGGCCAACACGCCAACCATGTCTTGGGCGTCGAG
TCGCGCACCAAGCACCCCCATGGCGGCGAGAAGCGGCCCGACTATTTCTTTGGCCACTTGACCATTGTCGCCGAC
GGCTACGACTCGCACTTTCGCAAGCAAGTCCTCTGCGGCTCCAAGAGCAAGCCCATTGTGCGCTCCAAGTTCTAT
GCCCTCCAACTCATCGACTGCGACTTGCCCCGGCCTGGCCTCGGCCACGTCATTATAGGCGATGCCTACCCCGTC
CTTGTATATCAGATTGGCGCCCACGAGACTCGCATGCTGATTGACGTGCCCACTGGCATCCCCGAAGCCTCTCCT
GCCGCCGGCGGCGTGCGCGGCTACATTCGCGACATTGTCCTTCCAGCACTGCCATGTCGCATCCGGCCGTCTGCA
GAACGCGCCTTGGCCGATGGCAAGATTCCGCGCTCCATGCCAAACAGCTGGCTTCCTTCTTCGCGCCAGTCCACC
CCCGGACTCATCCTGCTCGGCGATGCCTTTAATATGCGCCACCCACTGACTGGCGGCGGCATGACGGTGGCCCTT
GGCGATGCCCTCGAGCTCTCTCAACTCGTCCAACCCCTTCCCAACCTCGAGGACTCGCGCGCCGTCCAGTCGGTC
ATTGACACGCTCTACTGGCGCCGCAAGAACCGCACCGCCATTATCAATATTCTGGCACAGGCCCTCTACTCGCTC
TTTGCCGCAGACGACCGTCAGTTGCGCGCTCTGCAAGCTGGATGCTTTGAGTACTTTCGCCGCGGCTCTACAGAC
GGGCCCTGCGGCCTCCTCGCTGGCATCGTGCACCAGCCCATGGTCCTCGTCTACCACTTCTTCTCCGTCGCCTTT
CTCGCCATTTGGATCAATGCGTGCGCCGTGGTTGGCTCAAGTCTGCTGGCGCCCTTGCATGTGCCCCTTGCCCTA
ATTGACATGGTACTCATTCTGTGGAAAGCGAGTATTGTCTTTTTGCCGCTTCTCTGGCGCGAGGTGTTTCAGTGA
Gene >OphauB2|5894
ATGACAGGCAGTCTCGCAGCCGAAGCGTGTCTGCGCCGCAAGACGCACCACGAGGCAGAAGTCGTTGTCGTTGGC
GCCGGCGTTTTTGGCTGCGCAATTGCCTATGCCCTTGCCAACCAGGGCCGGTCGGTGCTGCTGCTCGAACGATGG
ATCAAGGAACCCGATCGCATTGTTGGCGAGTTGTTACAGCCAGGAGGCGTTGCCGCGCTGCGCAAGCTCGGCCTG
GGCGACTGTCTCGAAGGCATCGACGCTATTCCCTGCCACGGATACACCGTCTTCTTCCAGGGCCAGGAATGCCCC
ATTCCATATCCGCCTGTCGACCATGGGGGCCATGTGCCGCACAAGTGGGGAGGCGCGGGCGATGGAAGCAGCGGC
AAGCGGCCCGAGGGACGCAGCTTTCACCACGGCCGCTTTATTGGGCGGCTGCGCAAAGCTTGCATGGCCCACGCC
AACATTACCGTGGTGGAGACGGAGGTGGTGAAGCTGGTGCGTGGCCAACACGCCAACCATGTCTTGGGCGTCGAG
TCGCGCACCAAGCACCCCCATGGCGGCGAGAAGCGGCCCGACTATTTCTTTGGCCACTTGACCATTGTCGCCGAC
GGCTACGACTCGCACTTTCGCAAGCAAGTCCTCTGCGGCTCCAAGAGCAAGCCCATTGTGCGCTCCAAGTTCTAT
GCCCTCCAACTCATCGACTGCGACTTGCCCCGGCCTGGCCTCGGCCACGTCATTATAGGCGATGCCTACCCCGTC
CTTGTATATCAGATTGGCGCCCACGAGACTCGCATGCTGATTGACGTGCCCACTGGCATCCCCGAAGCCTCTCCT
GCCGCCGGCGGCGTGCGCGGCTACATTCGCGACATTGTCCTTCCAGCACTGCCATGTCGCATCCGGCCGTCTGCA
GAACGCGCCTTGGCCGATGGCAAGATTCCGCGCTCCATGCCAAACAGCTGGCTTCCTTCTTCGCGCCAGTCCACC
CCCGGACTCATCCTGCTCGGCGATGCCTTTAATATGCGCCACCCACTGACTGGCGGCGGCATGACGGTGGCCCTT
GGCGATGCCCTCGAGCTCTCTCAACTCGTCCAACCCCTTCCCAACCTCGAGGACTCGCGCGCCGTCCAGTCGGTC
ATTGACACGCTCTACTGGCGCCGCAAGAACCGCACCGCCATTATCAATATTCTGGCACAGGCCCTCTACTCGCTC
TTTGCCGCAGACGACCGTCAGTTGCGCGCTCTGCAAGCTGGATGCTTTGAGTACTTTCGCCGCGGCTCTACAGAC
GGGCCCTGCGGCCTCCTCGCTGGCATCGTGCACCAGCCCATGGTCCTCGTCTACCACTTCTTCTCCGTCGCCTTT
CTCGCCATTTGGATCAATGCGTGCGCCGTGGTTGGCTCAAGTCTGCTGGCGCCCTTGCATGTGCCCCTTGCCCTA
ATTGACATGGTACTCATTCTGTGGAAAGCGAGTATTGTCTTTTTGCCGCTTCTCTGGCGCGAGGTGTTTCAGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail