Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|589
Gene name
LocationContig_11:180661..181826
Strand+
Gene length (bp)1165
Transcript length (bp)1020
Coding sequence length (bp)1020
Protein length (aa) 340

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00753 Lactamase_B Metallo-beta-lactamase superfamily 3.1E-13 56 210

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q6NYF0|LACB2_DANRE Beta-lactamase-like protein 2 OS=Danio rerio GN=lactb2 PE=2 SV=1 37 245 5.0E-63
sp|Q561R9|LACB2_RAT Beta-lactamase-like protein 2 OS=Rattus norvegicus GN=Lactb2 PE=2 SV=1 37 235 5.0E-58
sp|Q1LZ83|LACB2_BOVIN Beta-lactamase-like protein 2 OS=Bos taurus GN=LACTB2 PE=2 SV=1 37 239 1.0E-56
sp|Q53H82|LACB2_HUMAN Beta-lactamase-like protein 2 OS=Homo sapiens GN=LACTB2 PE=1 SV=2 37 235 2.0E-55
sp|Q99KR3|LACB2_MOUSE Beta-lactamase-like protein 2 OS=Mus musculus GN=Lactb2 PE=1 SV=1 37 235 8.0E-55
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q6NYF0|LACB2_DANRE Beta-lactamase-like protein 2 OS=Danio rerio GN=lactb2 PE=2 SV=1 37 245 5.0E-63
sp|Q561R9|LACB2_RAT Beta-lactamase-like protein 2 OS=Rattus norvegicus GN=Lactb2 PE=2 SV=1 37 235 5.0E-58
sp|Q1LZ83|LACB2_BOVIN Beta-lactamase-like protein 2 OS=Bos taurus GN=LACTB2 PE=2 SV=1 37 239 1.0E-56
sp|Q53H82|LACB2_HUMAN Beta-lactamase-like protein 2 OS=Homo sapiens GN=LACTB2 PE=1 SV=2 37 235 2.0E-55
sp|Q99KR3|LACB2_MOUSE Beta-lactamase-like protein 2 OS=Mus musculus GN=Lactb2 PE=1 SV=1 37 235 8.0E-55
sp|Q5XGR8|LACB2_XENLA Beta-lactamase-like protein 2 OS=Xenopus laevis GN=lactb2 PE=2 SV=1 25 255 4.0E-53
sp|Q0V9A9|LACB2_XENTR Beta-lactamase-like protein 2 OS=Xenopus tropicalis GN=lactb2 PE=2 SV=1 25 247 3.0E-52
sp|Q95Q18|LACB2_CAEEL Beta-lactamase-like protein 2 homolog OS=Caenorhabditis elegans GN=Y53F4B.39 PE=3 SV=1 27 242 1.0E-45
sp|Q9VLS9|LACB2_DROME Beta-lactamase-like protein 2 homolog OS=Drosophila melanogaster GN=CG12375 PE=2 SV=1 41 244 7.0E-45
sp|Q3IIR9|GLO2_PSEHT Hydroxyacylglutathione hydrolase OS=Pseudoalteromonas haloplanktis (strain TAC 125) GN=gloB PE=3 SV=1 70 181 2.0E-14
sp|A0Q7M7|GLO2_FRATN Hydroxyacylglutathione hydrolase OS=Francisella tularensis subsp. novicida (strain U112) GN=gloB PE=3 SV=1 44 221 4.0E-13
sp|Q5QZL0|GLO2_IDILO Hydroxyacylglutathione hydrolase OS=Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR) GN=gloB PE=3 SV=1 69 201 5.0E-13
sp|A7Z4X7|BAEB_BACMF Probable polyketide biosynthesis zinc-dependent hydrolase BaeB OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=baeB PE=1 SV=1 53 210 1.0E-12
sp|Q4FP49|GLO2_PELUB Hydroxyacylglutathione hydrolase OS=Pelagibacter ubique (strain HTCC1062) GN=gloB PE=3 SV=1 54 181 1.0E-12
sp|B0TXY0|GLO2_FRAP2 Hydroxyacylglutathione hydrolase OS=Francisella philomiragia subsp. philomiragia (strain ATCC 25017) GN=gloB PE=3 SV=1 44 210 7.0E-12
sp|A6VVZ9|GLO2_MARMS Hydroxyacylglutathione hydrolase OS=Marinomonas sp. (strain MWYL1) GN=gloB PE=3 SV=1 80 181 1.0E-11
sp|Q0BMS2|GLO2_FRATO Hydroxyacylglutathione hydrolase OS=Francisella tularensis subsp. holarctica (strain OSU18) GN=gloB PE=3 SV=1 44 221 2.0E-11
sp|Q2A4E2|GLO2_FRATH Hydroxyacylglutathione hydrolase OS=Francisella tularensis subsp. holarctica (strain LVS) GN=gloB PE=3 SV=1 44 221 2.0E-11
sp|A7NB16|GLO2_FRATF Hydroxyacylglutathione hydrolase OS=Francisella tularensis subsp. holarctica (strain FTNF002-00 / FTA) GN=gloB PE=3 SV=1 44 221 2.0E-11
sp|A4IWV0|GLO2_FRATW Hydroxyacylglutathione hydrolase OS=Francisella tularensis subsp. tularensis (strain WY96-3418) GN=gloB PE=3 SV=1 44 221 2.0E-11
sp|Q5NF43|GLO2_FRATT Hydroxyacylglutathione hydrolase OS=Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4) GN=gloB PE=3 SV=1 44 221 2.0E-11
sp|B2SFR3|GLO2_FRATM Hydroxyacylglutathione hydrolase OS=Francisella tularensis subsp. mediasiatica (strain FSC147) GN=gloB PE=3 SV=1 44 221 2.0E-11
sp|Q14GJ6|GLO2_FRAT1 Hydroxyacylglutathione hydrolase OS=Francisella tularensis subsp. tularensis (strain FSC 198) GN=gloB PE=3 SV=1 44 221 2.0E-11
sp|Q31H51|GLO2_THICR Hydroxyacylglutathione hydrolase OS=Thiomicrospira crunogena (strain XCL-2) GN=gloB PE=3 SV=1 70 210 6.0E-10
sp|Q65U07|GLO2_MANSM Hydroxyacylglutathione hydrolase OS=Mannheimia succiniciproducens (strain MBEL55E) GN=gloB PE=3 SV=1 69 181 6.0E-10
sp|A4G7G5|GLO2_HERAR Hydroxyacylglutathione hydrolase OS=Herminiimonas arsenicoxydans GN=gloB PE=3 SV=1 60 181 6.0E-10
sp|Q7VM19|GLO2_HAEDU Hydroxyacylglutathione hydrolase OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=gloB PE=3 SV=1 54 247 7.0E-10
sp|Q13F06|GLO2_RHOPS Hydroxyacylglutathione hydrolase OS=Rhodopseudomonas palustris (strain BisB5) GN=gloB PE=3 SV=1 71 181 3.0E-09
sp|A2BQ40|GLO2_PROMS Hydroxyacylglutathione hydrolase OS=Prochlorococcus marinus (strain AS9601) GN=gloB PE=3 SV=2 54 181 4.0E-09
sp|Q8Z983|GLO2_SALTI Hydroxyacylglutathione hydrolase OS=Salmonella typhi GN=gloB PE=3 SV=1 69 181 4.0E-09
sp|Q8EE27|GLO2_SHEON Hydroxyacylglutathione hydrolase OS=Shewanella oneidensis (strain MR-1) GN=gloB PE=3 SV=1 82 201 4.0E-09
sp|A9BEI3|GLO2_PROM4 Hydroxyacylglutathione hydrolase OS=Prochlorococcus marinus (strain MIT 9211) GN=gloB PE=3 SV=1 69 201 5.0E-09
sp|Q7VQB7|GLO2_BLOFL Hydroxyacylglutathione hydrolase OS=Blochmannia floridanus GN=gloB PE=3 SV=1 69 210 6.0E-09
sp|Q2J429|GLO2_RHOP2 Hydroxyacylglutathione hydrolase OS=Rhodopseudomonas palustris (strain HaA2) GN=gloB PE=3 SV=1 71 235 6.0E-09
sp|A1SS88|GLO2_PSYIN Hydroxyacylglutathione hydrolase OS=Psychromonas ingrahamii (strain 37) GN=gloB PE=3 SV=1 69 181 6.0E-09
sp|B8F6A3|GLO2_HAEPS Hydroxyacylglutathione hydrolase OS=Haemophilus parasuis serovar 5 (strain SH0165) GN=gloB PE=3 SV=1 69 210 6.0E-09
sp|A1WXD9|GLO2_HALHL Hydroxyacylglutathione hydrolase OS=Halorhodospira halophila (strain DSM 244 / SL1) GN=gloB PE=3 SV=1 64 181 6.0E-09
sp|A1JKA9|GLO2_YERE8 Hydroxyacylglutathione hydrolase OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=gloB PE=3 SV=1 69 181 7.0E-09
sp|A0KXS9|GLO2_SHESA Hydroxyacylglutathione hydrolase OS=Shewanella sp. (strain ANA-3) GN=gloB PE=3 SV=1 58 252 7.0E-09
sp|A3PBT3|GLO2_PROM0 Hydroxyacylglutathione hydrolase OS=Prochlorococcus marinus (strain MIT 9301) GN=gloB PE=3 SV=2 54 181 1.0E-08
sp|Q07VA9|GLO2_RHOP5 Hydroxyacylglutathione hydrolase OS=Rhodopseudomonas palustris (strain BisA53) GN=gloB PE=3 SV=1 94 181 2.0E-08
sp|B1XQ70|GLO2_SYNP2 Hydroxyacylglutathione hydrolase OS=Synechococcus sp. (strain ATCC 27264 / PCC 7002 / PR-6) GN=gloB PE=3 SV=1 69 181 2.0E-08
sp|Q5ZVZ3|GLO2_LEGPH Hydroxyacylglutathione hydrolase OS=Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) GN=gloB PE=3 SV=1 71 201 2.0E-08
sp|A5IBE7|GLO2_LEGPC Hydroxyacylglutathione hydrolase OS=Legionella pneumophila (strain Corby) GN=gloB PE=3 SV=1 71 201 2.0E-08
sp|Q6D1V5|GLO2_PECAS Hydroxyacylglutathione hydrolase OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=gloB PE=3 SV=1 54 181 2.0E-08
sp|Q1CFI4|GLO2_YERPN Hydroxyacylglutathione hydrolase OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=gloB PE=3 SV=1 69 181 3.0E-08
sp|Q0WHW5|GLO2_YERPE Hydroxyacylglutathione hydrolase OS=Yersinia pestis GN=gloB PE=3 SV=1 69 181 3.0E-08
sp|Q1CAJ7|GLO2_YERPA Hydroxyacylglutathione hydrolase OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=gloB PE=3 SV=1 69 181 3.0E-08
sp|B1JR44|GLO2_YERPY Hydroxyacylglutathione hydrolase OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=gloB PE=3 SV=1 69 181 3.0E-08
sp|Q667M5|GLO2_YERPS Hydroxyacylglutathione hydrolase OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=gloB PE=3 SV=1 69 181 3.0E-08
sp|B2KAD1|GLO2_YERPB Hydroxyacylglutathione hydrolase OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=gloB PE=3 SV=1 69 181 3.0E-08
sp|A7FFK5|GLO2_YERP3 Hydroxyacylglutathione hydrolase OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=gloB PE=3 SV=1 69 181 3.0E-08
sp|A4TL56|GLO2_YERPP Hydroxyacylglutathione hydrolase OS=Yersinia pestis (strain Pestoides F) GN=gloB PE=3 SV=1 69 181 3.0E-08
sp|Q31BX5|GLO2_PROM9 Hydroxyacylglutathione hydrolase OS=Prochlorococcus marinus (strain MIT 9312) GN=gloB PE=3 SV=1 54 181 3.0E-08
sp|Q5WX41|GLO2_LEGPL Hydroxyacylglutathione hydrolase OS=Legionella pneumophila (strain Lens) GN=gloB PE=3 SV=1 71 201 3.0E-08
sp|A7MI37|GLO2_CROS8 Hydroxyacylglutathione hydrolase OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=gloB PE=3 SV=1 69 181 4.0E-08
sp|B4RJC7|GLO2_NEIG2 Hydroxyacylglutathione hydrolase OS=Neisseria gonorrhoeae (strain NCCP11945) GN=gloB PE=3 SV=1 60 247 4.0E-08
sp|Q7VD23|GLO2_PROMA Hydroxyacylglutathione hydrolase OS=Prochlorococcus marinus (strain SARG / CCMP1375 / SS120) GN=gloB PE=3 SV=1 69 181 4.0E-08
sp|A6T510|GLO2_KLEP7 Hydroxyacylglutathione hydrolase OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=gloB PE=3 SV=1 54 181 4.0E-08
sp|A1RK78|GLO2_SHESW Hydroxyacylglutathione hydrolase OS=Shewanella sp. (strain W3-18-1) GN=gloB PE=3 SV=1 84 181 4.0E-08
sp|A4Y6B8|GLO2_SHEPC Hydroxyacylglutathione hydrolase OS=Shewanella putrefaciens (strain CN-32 / ATCC BAA-453) GN=gloB PE=3 SV=1 84 181 5.0E-08
sp|B5Y1G4|GLO2_KLEP3 Hydroxyacylglutathione hydrolase OS=Klebsiella pneumoniae (strain 342) GN=gloB PE=3 SV=1 54 181 5.0E-08
sp|Q5X5R2|GLO2_LEGPA Hydroxyacylglutathione hydrolase OS=Legionella pneumophila (strain Paris) GN=gloB PE=3 SV=1 71 201 5.0E-08
sp|A4SPI6|GLO2_AERS4 Hydroxyacylglutathione hydrolase OS=Aeromonas salmonicida (strain A449) GN=gloB PE=3 SV=1 60 181 6.0E-08
sp|A4YKS8|GLO2_BRASO Hydroxyacylglutathione hydrolase OS=Bradyrhizobium sp. (strain ORS278) GN=gloB PE=3 SV=1 71 181 6.0E-08
sp|C6DC67|GLO2_PECCP Hydroxyacylglutathione hydrolase OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=gloB PE=3 SV=1 54 181 7.0E-08
sp|A1IPQ8|GLO2_NEIMA Hydroxyacylglutathione hydrolase OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=gloB PE=3 SV=1 60 247 8.0E-08
sp|C5BEP2|GLO2_EDWI9 Hydroxyacylglutathione hydrolase OS=Edwardsiella ictaluri (strain 93-146) GN=gloB PE=3 SV=1 61 181 8.0E-08
sp|Q87C74|GLO2_XYLFT Hydroxyacylglutathione hydrolase OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=gloB PE=3 SV=1 61 181 1.0E-07
sp|B2I5S5|GLO2_XYLF2 Hydroxyacylglutathione hydrolase OS=Xylella fastidiosa (strain M23) GN=gloB PE=3 SV=1 61 181 1.0E-07
sp|Q9PBI4|GLO2_XYLFA Hydroxyacylglutathione hydrolase OS=Xylella fastidiosa (strain 9a5c) GN=gloB PE=3 SV=1 61 181 1.0E-07
sp|A3QET2|GLO2_SHELP Hydroxyacylglutathione hydrolase OS=Shewanella loihica (strain ATCC BAA-1088 / PV-4) GN=gloB PE=3 SV=1 78 181 1.0E-07
sp|B0U365|GLO2_XYLFM Hydroxyacylglutathione hydrolase OS=Xylella fastidiosa (strain M12) GN=gloB PE=3 SV=1 61 181 1.0E-07
sp|Q5F7J0|GLO2_NEIG1 Hydroxyacylglutathione hydrolase OS=Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) GN=gloB PE=3 SV=1 60 239 1.0E-07
sp|Q60BX0|GLO2_METCA Hydroxyacylglutathione hydrolase OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) GN=gloB PE=3 SV=1 78 201 1.0E-07
sp|Q9JXK4|GLO2_NEIMB Hydroxyacylglutathione hydrolase OS=Neisseria meningitidis serogroup B (strain MC58) GN=gloB PE=3 SV=1 60 247 1.0E-07
sp|A9M0M3|GLO2_NEIM0 Hydroxyacylglutathione hydrolase OS=Neisseria meningitidis serogroup C (strain 053442) GN=gloB PE=3 SV=1 60 247 1.0E-07
sp|O34769|PKSB_BACSU Probable polyketide biosynthesis zinc-dependent hydrolase PksB OS=Bacillus subtilis (strain 168) GN=pksB PE=1 SV=1 48 210 2.0E-07
sp|Q3JAC4|GLO2_NITOC Hydroxyacylglutathione hydrolase OS=Nitrosococcus oceani (strain ATCC 19707 / NCIMB 11848) GN=gloB PE=3 SV=1 95 244 2.0E-07
sp|Q9UT36|GLO21_SCHPO Probable hydroxyacylglutathione hydrolase C824.07 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC824.07 PE=3 SV=1 60 181 2.0E-07
sp|Q5E3G3|GLO2_VIBF1 Hydroxyacylglutathione hydrolase OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=gloB PE=3 SV=2 69 201 3.0E-07
sp|A3D437|GLO2_SHEB5 Hydroxyacylglutathione hydrolase OS=Shewanella baltica (strain OS155 / ATCC BAA-1091) GN=gloB PE=3 SV=1 57 181 3.0E-07
sp|Q6P963|GLO2_DANRE Hydroxyacylglutathione hydrolase, mitochondrial OS=Danio rerio GN=hagh PE=2 SV=2 78 221 3.0E-07
sp|A6VNK4|GLO2_ACTSZ Hydroxyacylglutathione hydrolase OS=Actinobacillus succinogenes (strain ATCC 55618 / 130Z) GN=gloB PE=3 SV=1 69 181 4.0E-07
sp|A9L0E9|GLO2_SHEB9 Hydroxyacylglutathione hydrolase OS=Shewanella baltica (strain OS195) GN=gloB PE=3 SV=1 57 181 4.0E-07
sp|B8E5A2|GLO2_SHEB2 Hydroxyacylglutathione hydrolase OS=Shewanella baltica (strain OS223) GN=gloB PE=3 SV=1 57 181 4.0E-07
sp|Q3SVQ1|GLO2_NITWN Hydroxyacylglutathione hydrolase OS=Nitrobacter winogradskyi (strain Nb-255 / ATCC 25391) GN=gloB PE=3 SV=1 71 181 4.0E-07
sp|C3LPP0|GLO2_VIBCM Hydroxyacylglutathione hydrolase OS=Vibrio cholerae serotype O1 (strain M66-2) GN=gloB PE=3 SV=1 70 201 4.0E-07
sp|Q9KPX6|GLO2_VIBCH Hydroxyacylglutathione hydrolase OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=gloB PE=3 SV=1 70 201 4.0E-07
sp|A5F635|GLO2_VIBC3 Hydroxyacylglutathione hydrolase OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) GN=gloB PE=3 SV=1 70 201 4.0E-07
sp|A6WMW5|GLO2_SHEB8 Hydroxyacylglutathione hydrolase OS=Shewanella baltica (strain OS185) GN=gloB PE=3 SV=1 57 181 4.0E-07
sp|Q6NC62|GLO2_RHOPA Hydroxyacylglutathione hydrolase OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=gloB PE=3 SV=1 71 181 4.0E-07
sp|A4W6V2|GLO2_ENT38 Hydroxyacylglutathione hydrolase OS=Enterobacter sp. (strain 638) GN=gloB PE=3 SV=1 69 181 5.0E-07
sp|Q6ML19|GLO2_BDEBA Hydroxyacylglutathione hydrolase OS=Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIB 9529 / HD100) GN=gloB PE=3 SV=1 69 181 5.0E-07
sp|Q21J46|GLO2_SACD2 Hydroxyacylglutathione hydrolase OS=Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024) GN=gloB PE=3 SV=1 66 181 5.0E-07
sp|A1U0V1|GLO2_MARHV Hydroxyacylglutathione hydrolase OS=Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8) GN=gloB PE=3 SV=1 69 196 5.0E-07
sp|Q162S3|GLO2_ROSDO Hydroxyacylglutathione hydrolase OS=Roseobacter denitrificans (strain ATCC 33942 / OCh 114) GN=gloB PE=3 SV=1 70 267 5.0E-07
sp|A1KW76|GLO2_NEIMF Hydroxyacylglutathione hydrolase OS=Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18) GN=gloB PE=3 SV=1 60 210 5.0E-07
sp|A7YY46|PNKD_BOVIN Probable hydrolase PNKD OS=Bos taurus GN=PNKD PE=2 SV=1 15 175 5.0E-07
sp|Q8DBD8|GLO2_VIBVU Hydroxyacylglutathione hydrolase OS=Vibrio vulnificus (strain CMCP6) GN=gloB PE=3 SV=1 70 181 6.0E-07
sp|Q7MII4|GLO22_VIBVY Hydroxyacylglutathione hydrolase 2 OS=Vibrio vulnificus (strain YJ016) GN=gloB2 PE=3 SV=1 70 181 6.0E-07
sp|Q0BWR4|GLO2_HYPNA Hydroxyacylglutathione hydrolase OS=Hyphomonas neptunium (strain ATCC 15444) GN=gloB PE=3 SV=1 60 242 6.0E-07
sp|A1S6T3|GLO2_SHEAM Hydroxyacylglutathione hydrolase OS=Shewanella amazonensis (strain ATCC BAA-1098 / SB2B) GN=gloB PE=3 SV=1 69 181 6.0E-07
sp|Q1H188|GLO2_METFK Hydroxyacylglutathione hydrolase OS=Methylobacillus flagellatus (strain KT / ATCC 51484 / DSM 6875) GN=gloB PE=3 SV=1 69 181 7.0E-07
sp|A3PIB4|GLO2_RHOS1 Hydroxyacylglutathione hydrolase OS=Rhodobacter sphaeroides (strain ATCC 17029 / ATH 2.4.9) GN=gloB PE=3 SV=1 63 201 7.0E-07
sp|B5F9V3|GLO2_VIBFM Hydroxyacylglutathione hydrolase OS=Vibrio fischeri (strain MJ11) GN=gloB PE=3 SV=1 69 201 8.0E-07
sp|Q8PNI0|GLO2_XANAC Hydroxyacylglutathione hydrolase OS=Xanthomonas axonopodis pv. citri (strain 306) GN=gloB PE=3 SV=1 61 181 9.0E-07
sp|Q3BWP5|GLO2_XANC5 Hydroxyacylglutathione hydrolase OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) GN=gloB PE=3 SV=1 61 181 1.0E-06
sp|Q21C03|GLO2_RHOPB Hydroxyacylglutathione hydrolase OS=Rhodopseudomonas palustris (strain BisB18) GN=gloB PE=3 SV=1 71 181 1.0E-06
sp|Q3J436|GLO2_RHOS4 Hydroxyacylglutathione hydrolase OS=Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158) GN=gloB PE=3 SV=1 63 201 1.0E-06
sp|P57336|GLO2_BUCAI Hydroxyacylglutathione hydrolase OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=gloB PE=3 SV=1 61 201 1.0E-06
sp|B6EJV4|GLO2_ALISL Hydroxyacylglutathione hydrolase OS=Aliivibrio salmonicida (strain LFI1238) GN=gloB PE=3 SV=1 69 181 1.0E-06
sp|O35952|GLO2_RAT Hydroxyacylglutathione hydrolase, mitochondrial OS=Rattus norvegicus GN=Hagh PE=1 SV=2 78 181 1.0E-06
sp|Q12MM2|GLO2_SHEDO Hydroxyacylglutathione hydrolase OS=Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013) GN=gloB PE=3 SV=1 70 222 1.0E-06
sp|Q16775|GLO2_HUMAN Hydroxyacylglutathione hydrolase, mitochondrial OS=Homo sapiens GN=HAGH PE=1 SV=2 78 181 1.0E-06
sp|Q2NVG1|GLO2_SODGM Hydroxyacylglutathione hydrolase OS=Sodalis glossinidius (strain morsitans) GN=gloB PE=3 SV=1 69 181 1.0E-06
sp|Q2RP80|GLO2_RHORT Hydroxyacylglutathione hydrolase OS=Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1) GN=gloB PE=3 SV=1 78 181 2.0E-06
sp|Q8U9W1|GLO2_AGRFC Hydroxyacylglutathione hydrolase OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=gloB PE=3 SV=2 71 181 2.0E-06
sp|B7VIP5|GLO2_VIBTL Hydroxyacylglutathione hydrolase OS=Vibrio tasmaniensis (strain LGP32) GN=gloB PE=3 SV=1 70 181 2.0E-06
sp|A4XU09|GLO2_PSEMY Hydroxyacylglutathione hydrolase OS=Pseudomonas mendocina (strain ymp) GN=gloB PE=3 SV=1 70 181 2.0E-06
sp|Q21YF8|GLO2_RHOFT Hydroxyacylglutathione hydrolase OS=Rhodoferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118) GN=gloB PE=3 SV=2 69 181 2.0E-06
sp|Q99KB8|GLO2_MOUSE Hydroxyacylglutathione hydrolase, mitochondrial OS=Mus musculus GN=Hagh PE=1 SV=2 78 181 3.0E-06
sp|A9MPF3|GLO2_SALAR Hydroxyacylglutathione hydrolase OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=gloB PE=3 SV=1 69 181 3.0E-06
sp|A7MY07|GLO2_VIBCB Hydroxyacylglutathione hydrolase OS=Vibrio campbellii (strain ATCC BAA-1116 / BB120) GN=gloB PE=3 SV=1 70 181 3.0E-06
sp|Q47FN7|GLO2_DECAR Hydroxyacylglutathione hydrolase OS=Dechloromonas aromatica (strain RCB) GN=gloB PE=3 SV=1 60 181 4.0E-06
sp|A5ETG1|GLO2_BRASB Hydroxyacylglutathione hydrolase OS=Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182) GN=gloB PE=3 SV=1 71 181 4.0E-06
sp|Q8ZRM2|GLO2_SALTY Hydroxyacylglutathione hydrolase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=gloB PE=1 SV=1 69 181 4.0E-06
sp|B3R1Y0|GLO2_CUPTR Hydroxyacylglutathione hydrolase OS=Cupriavidus taiwanensis (strain R1 / LMG 19424) GN=gloB PE=3 SV=1 65 181 4.0E-06
sp|Q8N490|PNKD_HUMAN Probable hydrolase PNKD OS=Homo sapiens GN=PNKD PE=1 SV=2 88 195 4.0E-06
sp|Q89XT5|GLO2_BRADU Hydroxyacylglutathione hydrolase OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=gloB PE=3 SV=1 71 181 4.0E-06
sp|B8ICA2|GLO2_METNO Hydroxyacylglutathione hydrolase OS=Methylobacterium nodulans (strain ORS2060 / LMG 21967) GN=gloB PE=3 SV=1 84 214 4.0E-06
sp|O94250|GLO22_SCHPO Probable hydroxyacylglutathione hydrolase C13B11.03c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC13B11.03c PE=3 SV=1 82 210 5.0E-06
sp|A5GJK5|GLO2_SYNPW Hydroxyacylglutathione hydrolase OS=Synechococcus sp. (strain WH7803) GN=gloB PE=3 SV=1 54 181 6.0E-06
sp|Q3B7M2|GLO2_BOVIN Hydroxyacylglutathione hydrolase, mitochondrial OS=Bos taurus GN=HAGH PE=2 SV=3 78 221 6.0E-06
sp|A8GA75|GLO2_SERP5 Hydroxyacylglutathione hydrolase OS=Serratia proteamaculans (strain 568) GN=gloB PE=3 SV=1 69 181 6.0E-06
sp|Q69ZP3|PNKD_MOUSE Probable hydrolase PNKD OS=Mus musculus GN=Pnkd PE=1 SV=2 67 175 6.0E-06
sp|B5R5L1|GLO2_SALG2 Hydroxyacylglutathione hydrolase OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=gloB PE=3 SV=1 69 181 6.0E-06
sp|B0UBD0|GLO2_METS4 Hydroxyacylglutathione hydrolase OS=Methylobacterium sp. (strain 4-46) GN=gloB PE=3 SV=1 84 214 7.0E-06
sp|B5R447|GLO2_SALEP Hydroxyacylglutathione hydrolase OS=Salmonella enteritidis PT4 (strain P125109) GN=gloB PE=3 SV=1 69 181 7.0E-06
sp|B5FJ56|GLO2_SALDC Hydroxyacylglutathione hydrolase OS=Salmonella dublin (strain CT_02021853) GN=gloB PE=3 SV=1 69 181 7.0E-06
sp|B4TYG8|GLO2_SALSV Hydroxyacylglutathione hydrolase OS=Salmonella schwarzengrund (strain CVM19633) GN=gloB PE=3 SV=1 69 181 7.0E-06
sp|A9MZ21|GLO2_SALPB Hydroxyacylglutathione hydrolase OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=gloB PE=3 SV=1 69 181 7.0E-06
sp|B4SV37|GLO2_SALNS Hydroxyacylglutathione hydrolase OS=Salmonella newport (strain SL254) GN=gloB PE=3 SV=1 69 181 7.0E-06
sp|B4TK83|GLO2_SALHS Hydroxyacylglutathione hydrolase OS=Salmonella heidelberg (strain SL476) GN=gloB PE=3 SV=1 69 181 7.0E-06
sp|Q57SZ8|GLO2_SALCH Hydroxyacylglutathione hydrolase OS=Salmonella choleraesuis (strain SC-B67) GN=gloB PE=3 SV=1 69 181 7.0E-06
sp|B5F8X0|GLO2_SALA4 Hydroxyacylglutathione hydrolase OS=Salmonella agona (strain SL483) GN=gloB PE=3 SV=1 69 181 7.0E-06
sp|B5BDW7|GLO2_SALPK Hydroxyacylglutathione hydrolase OS=Salmonella paratyphi A (strain AKU_12601) GN=gloB PE=3 SV=1 69 181 7.0E-06
sp|Q5PFD6|GLO2_SALPA Hydroxyacylglutathione hydrolase OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=gloB PE=3 SV=1 69 181 7.0E-06
sp|Q9CMW8|GLO2_PASMU Hydroxyacylglutathione hydrolase OS=Pasteurella multocida (strain Pm70) GN=gloB PE=3 SV=1 69 181 8.0E-06
sp|B2FR57|GLO2_STRMK Hydroxyacylglutathione hydrolase OS=Stenotrophomonas maltophilia (strain K279a) GN=gloB PE=3 SV=1 61 181 9.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|589
MASSTKPKGFYASNFWTDYLSTQRSKLPVLADVDDGVSDLVVRFLGGNPGNMQLQGTSTYLVGTGSSRILIDTGE
GHPQWAVNVVRYLEDHDVSISHILLTHWHRDHTGGVADLLAHDADIAVHKHEPEADQHDITDGQVFSTEGATIKA
VWTPGHTTDHMCFLLEEEDALFTGDNVLGHGFSIAEDLESYTQSLRLMQSLQCRIGYPGHGDVIRDFARTITRYI
AQRESREQQVYAALLQQASSRTCRGSSYASDSSSCSDYSSADEDEDDMEQGLSITGIGSRLYGELSIDTATFDSA
LKPLISQVLVMLAEHGKVSSKLVGMDKQRYWFARLQAIN*
Coding >OphauB2|589
ATGGCGTCAAGCACAAAGCCCAAGGGTTTCTACGCATCCAACTTTTGGACAGACTATCTCTCTACACAGAGAAGC
AAATTGCCAGTGTTGGCTGATGTTGACGATGGCGTCTCTGACCTTGTTGTACGGTTTCTGGGCGGCAATCCGGGC
AACATGCAACTCCAGGGGACGAGCACCTATCTTGTTGGAACTGGCAGTTCCAGAATACTGATTGACACGGGCGAG
GGACACCCGCAATGGGCCGTCAATGTGGTTAGATATCTCGAGGACCATGATGTTTCAATCTCTCATATTCTTCTC
ACCCACTGGCACCGAGACCATACCGGCGGCGTGGCCGACCTCCTCGCCCACGACGCAGACATTGCAGTGCACAAG
CACGAGCCCGAGGCCGACCAGCACGACATTACCGACGGCCAAGTCTTTTCCACCGAGGGCGCAACCATCAAGGCC
GTGTGGACGCCCGGCCACACCACGGACCACATGTGTTTTCTACTAGAAGAAGAAGACGCCCTTTTCACCGGCGAC
AATGTCCTCGGCCACGGCTTCAGCATAGCCGAGGACCTCGAATCCTATACCCAAAGCCTGCGCCTGATGCAAAGC
CTGCAATGCCGCATCGGCTACCCCGGCCACGGCGACGTGATTCGAGACTTTGCTCGAACCATTACCCGCTACATT
GCGCAGCGCGAGTCCCGCGAACAGCAAGTCTACGCCGCTCTCCTCCAACAAGCCTCCTCTCGCACCTGCCGAGGC
AGCAGCTACGCCAGCGACTCGAGCAGCTGCAGCGACTACAGCAGCGCAGACGAAGACGAAGACGACATGGAGCAG
GGCCTGTCAATAACGGGCATTGGCTCACGGCTATATGGCGAACTGTCCATCGACACGGCCACGTTTGACTCGGCG
CTCAAGCCGCTGATAAGCCAGGTGCTCGTCATGTTGGCAGAGCATGGAAAAGTTAGCTCCAAGCTGGTGGGCATG
GATAAGCAGAGATATTGGTTTGCTAGGCTGCAGGCGATAAATTAG
Transcript >OphauB2|589
ATGGCGTCAAGCACAAAGCCCAAGGGTTTCTACGCATCCAACTTTTGGACAGACTATCTCTCTACACAGAGAAGC
AAATTGCCAGTGTTGGCTGATGTTGACGATGGCGTCTCTGACCTTGTTGTACGGTTTCTGGGCGGCAATCCGGGC
AACATGCAACTCCAGGGGACGAGCACCTATCTTGTTGGAACTGGCAGTTCCAGAATACTGATTGACACGGGCGAG
GGACACCCGCAATGGGCCGTCAATGTGGTTAGATATCTCGAGGACCATGATGTTTCAATCTCTCATATTCTTCTC
ACCCACTGGCACCGAGACCATACCGGCGGCGTGGCCGACCTCCTCGCCCACGACGCAGACATTGCAGTGCACAAG
CACGAGCCCGAGGCCGACCAGCACGACATTACCGACGGCCAAGTCTTTTCCACCGAGGGCGCAACCATCAAGGCC
GTGTGGACGCCCGGCCACACCACGGACCACATGTGTTTTCTACTAGAAGAAGAAGACGCCCTTTTCACCGGCGAC
AATGTCCTCGGCCACGGCTTCAGCATAGCCGAGGACCTCGAATCCTATACCCAAAGCCTGCGCCTGATGCAAAGC
CTGCAATGCCGCATCGGCTACCCCGGCCACGGCGACGTGATTCGAGACTTTGCTCGAACCATTACCCGCTACATT
GCGCAGCGCGAGTCCCGCGAACAGCAAGTCTACGCCGCTCTCCTCCAACAAGCCTCCTCTCGCACCTGCCGAGGC
AGCAGCTACGCCAGCGACTCGAGCAGCTGCAGCGACTACAGCAGCGCAGACGAAGACGAAGACGACATGGAGCAG
GGCCTGTCAATAACGGGCATTGGCTCACGGCTATATGGCGAACTGTCCATCGACACGGCCACGTTTGACTCGGCG
CTCAAGCCGCTGATAAGCCAGGTGCTCGTCATGTTGGCAGAGCATGGAAAAGTTAGCTCCAAGCTGGTGGGCATG
GATAAGCAGAGATATTGGTTTGCTAGGCTGCAGGCGATAAATTAG
Gene >OphauB2|589
ATGGCGTCAAGCACAAAGCCCAAGGGTTTCTACGCATCCAACTTTTGGACAGACTATCTCTCTACACAGAGAAGC
AAATTGCCAGTGTTGGCTGATGTTGACGATGGCGTCTCTGACCTTGTTGTACGGTTTCTGGGCGGCAATCCGGGC
AACATGCAACTCCAGGGGACGAGCACCTATCTTGTTGGAACTGGCAGTTCCAGAATACTGATTGACACGGGCGAG
GTAAGGGCTTCTTCATTTCCTGCATGTTTGTTTCAGTCTCCCTTTGATCTGCGTGTCGATAAGCATAAAACGACG
TGACCAACCAAGCCACACTTTGTCTCCATGTGTTTCAAAAAAACAAGTCAGACTAAACAGTGAGGAATAGGGACA
CCCGCAATGGGCCGTCAATGTGGTTAGATATCTCGAGGACCATGATGTTTCAATCTCTCATATTCTTCTCACCCA
CTGGCACCGAGACCATACCGGCGGCGTGGCCGACCTCCTCGCCCACGACGCAGACATTGCAGTGCACAAGCACGA
GCCCGAGGCCGACCAGCACGACATTACCGACGGCCAAGTCTTTTCCACCGAGGGCGCAACCATCAAGGCCGTGTG
GACGCCCGGCCACACCACGGACCACATGTGTTTTCTACTAGAAGAAGAAGACGCCCTTTTCACCGGCGACAATGT
CCTCGGCCACGGCTTCAGCATAGCCGAGGACCTCGAATCCTATACCCAAAGCCTGCGCCTGATGCAAAGCCTGCA
ATGCCGCATCGGCTACCCCGGCCACGGCGACGTGATTCGAGACTTTGCTCGAACCATTACCCGCTACATTGCGCA
GCGCGAGTCCCGCGAACAGCAAGTCTACGCCGCTCTCCTCCAACAAGCCTCCTCTCGCACCTGCCGAGGCAGCAG
CTACGCCAGCGACTCGAGCAGCTGCAGCGACTACAGCAGCGCAGACGAAGACGAAGACGACATGGAGCAGGGCCT
GTCAATAACGGGCATTGGCTCACGGCTATATGGCGAACTGTCCATCGACACGGCCACGTTTGACTCGGCGCTCAA
GCCGCTGATAAGCCAGGTGCTCGTCATGTTGGCAGAGCATGGAAAAGTTAGCTCCAAGCTGGTGGGCATGGATAA
GCAGAGATATTGGTTTGCTAGGCTGCAGGCGATAAATTAG

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail