Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|5889
Gene name
LocationContig_5:106691..107770
Strand-
Gene length (bp)1079
Transcript length (bp)1017
Coding sequence length (bp)1017
Protein length (aa) 339

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03101 FAR1 FAR1 DNA-binding domain 4.0E-09 30 108

Swissprot hits

(None)

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup1827
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|7723
Ophiocordyceps australis map64 (Brazil) OphauB2|5889 (this protein)
Ophiocordyceps camponoti-floridani Ophcf2|00478
Ophiocordyceps camponoti-rufipedis Ophun1|4066
Ophiocordyceps kimflemingae Ophio5|1283
Ophiocordyceps subramaniannii Hirsu2|1809

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|5889
MFGILEAVSVPQSGIFASCEDLMRDLNSRAEKEGYKIVKARSHRSRPGAPIIRADLVCERGGRPYRCQATKHKSS
TKKTNCPWKAKAVDRKTVGGWVLTVICDHHNHEPGTPEPPTPSEASEAGDNDADDVPEGPRPDPETSAVLQVAGV
SDAVLRLSGDTFHRFKNDYRKMSQPERLGILAQMQLRIAAIYAVQNEDLQRQKRQDAQQRRHREIEESRRRLEAQ
GVRYVNQHRQRHTARISNPDASVDAVNAAPPTPEAPQREYPRLAPAPSMHETPFDPASPDPAQTSGAENLYSFQI
FPGPPKRLRGGRPLQLSPQAAQQMQQTVMQTTEQSTQV*
Coding >OphauB2|5889
ATGTTTGGCATTCTAGAAGCTGTCAGTGTGCCTCAATCCGGCATCTTTGCTTCGTGCGAAGACCTCATGCGCGAC
CTCAACTCGCGTGCCGAAAAAGAAGGCTACAAGATTGTCAAAGCCCGCTCGCATCGTAGCCGTCCTGGGGCTCCA
ATAATTCGCGCAGATCTGGTCTGCGAGAGAGGAGGCCGCCCTTACCGATGTCAAGCGACCAAACACAAGTCGTCG
ACCAAGAAGACGAATTGTCCCTGGAAGGCAAAGGCGGTTGACCGTAAAACTGTTGGGGGTTGGGTCTTGACGGTA
ATATGTGACCACCACAATCACGAGCCCGGGACTCCTGAGCCTCCAACACCCTCGGAAGCAAGTGAGGCTGGAGAC
AATGACGCTGACGACGTGCCTGAAGGACCTCGACCCGACCCTGAAACATCGGCAGTGCTCCAGGTCGCAGGAGTC
TCTGATGCAGTCCTCCGACTCAGCGGTGACACGTTCCACCGATTCAAAAATGATTATCGCAAAATGTCACAGCCT
GAACGATTGGGTATTCTAGCCCAGATGCAGCTAAGAATTGCTGCAATCTATGCGGTTCAGAACGAAGACCTGCAG
CGCCAAAAGCGACAGGATGCGCAGCAAAGGAGGCACCGAGAAATCGAGGAGAGCAGAAGGAGGCTCGAGGCACAG
GGCGTTAGATACGTCAACCAGCACCGACAGCGACATACGGCGCGCATATCTAACCCAGATGCATCTGTCGATGCT
GTCAATGCGGCCCCGCCAACGCCAGAAGCTCCTCAACGCGAATATCCTCGGCTTGCGCCGGCTCCCTCAATGCAC
GAGACTCCTTTTGATCCAGCTTCACCAGACCCTGCACAGACATCGGGTGCAGAAAATCTGTATTCATTTCAAATT
TTTCCAGGTCCTCCCAAGCGGCTTCGTGGCGGGCGGCCCTTGCAACTGTCACCTCAGGCAGCCCAGCAGATGCAG
CAGACGGTTATGCAAACAACCGAGCAGAGCACTCAGGTTTAA
Transcript >OphauB2|5889
ATGTTTGGCATTCTAGAAGCTGTCAGTGTGCCTCAATCCGGCATCTTTGCTTCGTGCGAAGACCTCATGCGCGAC
CTCAACTCGCGTGCCGAAAAAGAAGGCTACAAGATTGTCAAAGCCCGCTCGCATCGTAGCCGTCCTGGGGCTCCA
ATAATTCGCGCAGATCTGGTCTGCGAGAGAGGAGGCCGCCCTTACCGATGTCAAGCGACCAAACACAAGTCGTCG
ACCAAGAAGACGAATTGTCCCTGGAAGGCAAAGGCGGTTGACCGTAAAACTGTTGGGGGTTGGGTCTTGACGGTA
ATATGTGACCACCACAATCACGAGCCCGGGACTCCTGAGCCTCCAACACCCTCGGAAGCAAGTGAGGCTGGAGAC
AATGACGCTGACGACGTGCCTGAAGGACCTCGACCCGACCCTGAAACATCGGCAGTGCTCCAGGTCGCAGGAGTC
TCTGATGCAGTCCTCCGACTCAGCGGTGACACGTTCCACCGATTCAAAAATGATTATCGCAAAATGTCACAGCCT
GAACGATTGGGTATTCTAGCCCAGATGCAGCTAAGAATTGCTGCAATCTATGCGGTTCAGAACGAAGACCTGCAG
CGCCAAAAGCGACAGGATGCGCAGCAAAGGAGGCACCGAGAAATCGAGGAGAGCAGAAGGAGGCTCGAGGCACAG
GGCGTTAGATACGTCAACCAGCACCGACAGCGACATACGGCGCGCATATCTAACCCAGATGCATCTGTCGATGCT
GTCAATGCGGCCCCGCCAACGCCAGAAGCTCCTCAACGCGAATATCCTCGGCTTGCGCCGGCTCCCTCAATGCAC
GAGACTCCTTTTGATCCAGCTTCACCAGACCCTGCACAGACATCGGGTGCAGAAAATCTGTATTCATTTCAAATT
TTTCCAGGTCCTCCCAAGCGGCTTCGTGGCGGGCGGCCCTTGCAACTGTCACCTCAGGCAGCCCAGCAGATGCAG
CAGACGGTTATGCAAACAACCGAGCAGAGCACTCAGGTTTAA
Gene >OphauB2|5889
ATGTTTGGCATTCTAGAAGCTGTCAGTGTGCCTCAATCCGGCATCTTTGCTTCGTGCGAAGACCTCATGCGCGAC
CTCAACTCGCGTGCCGAAAAAGAAGGCTACAAGATTGTCAAAGCCCGCTCGCATCGTAGCCGTCCTGGGGCTCCA
ATAATTCGCGCAGATCTGGTCTGCGAGAGAGGAGGCCGCCCTTACCGATGTCAAGCGACCAAACACAAGTCGTCG
ACCAAGAAGACGAATTGTCCCTGGAAGGCAAAGGCGGTTGACCGTAAAACTGTTGGGGGTTGGGTCTTGACGGTA
ATATGTGACCACCACAATCACGAGCCCGGGACTCCTGAGCCTCCAACACCCTCGGAAGCAAGTGAGGCTGGAGAC
AATGACGCTGACGACGTGCCTGGTGGGTTCTGACATGCCATTGCCAAATCCGGAGTGCCTGGCTCATGTTCTCAC
GCTTATCAGAAGGACCTCGACCCGACCCTGAAACATCGGCAGTGCTCCAGGTCGCAGGAGTCTCTGATGCAGTCC
TCCGACTCAGCGGTGACACGTTCCACCGATTCAAAAATGATTATCGCAAAATGTCACAGCCTGAACGATTGGGTA
TTCTAGCCCAGATGCAGCTAAGAATTGCTGCAATCTATGCGGTTCAGAACGAAGACCTGCAGCGCCAAAAGCGAC
AGGATGCGCAGCAAAGGAGGCACCGAGAAATCGAGGAGAGCAGAAGGAGGCTCGAGGCACAGGGCGTTAGATACG
TCAACCAGCACCGACAGCGACATACGGCGCGCATATCTAACCCAGATGCATCTGTCGATGCTGTCAATGCGGCCC
CGCCAACGCCAGAAGCTCCTCAACGCGAATATCCTCGGCTTGCGCCGGCTCCCTCAATGCACGAGACTCCTTTTG
ATCCAGCTTCACCAGACCCTGCACAGACATCGGGTGCAGAAAATCTGTATTCATTTCAAATTTTTCCAGGTCCTC
CCAAGCGGCTTCGTGGCGGGCGGCCCTTGCAACTGTCACCTCAGGCAGCCCAGCAGATGCAGCAGACGGTTATGC
AAACAACCGAGCAGAGCACTCAGGTTTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail