Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|5883
Gene name
LocationContig_5:90211..91126
Strand+
Gene length (bp)915
Transcript length (bp)915
Coding sequence length (bp)915
Protein length (aa) 305

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12224 Amidoligase_2 Putative amidoligase enzyme 4.8E-05 6 99

Swissprot hits

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 46 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|5883
MDETWRGLELTSPVFDKTEIYHGMPQLRQVIAAMRSMKTSFVANSSCGLHLHVGIEGGMNLLVAKQLTTLVLLLE
RPLLFRLCGPTRVGNRHSPPVADMSRFSQEAHKAGCGQLRSDSLQMKASIPFSIRNLDPRSWNGYNPERLRKMLR
LVWQADSLLDIMSGLTKSTSGRCAFALSLRPGELRPEMSYNFAEAQSYYNGTPSTFEFRHSQMSFDSIHIGNWAE
LCCRLVEIATLPPRTFKLQLEEIINCLPMHGNRGQGKWCEILATLGLKHQIAEWKAQLACYDKGTEICLVDRLGV
LQKE*
Coding >OphauB2|5883
ATGGACGAGACTTGGAGAGGCTTGGAATTGACAAGTCCGGTTTTTGACAAGACTGAGATTTATCACGGCATGCCT
CAGCTTAGGCAGGTTATTGCTGCCATGAGGTCTATGAAGACTTCGTTTGTGGCAAACTCGTCCTGTGGGCTCCAC
CTTCATGTGGGAATCGAGGGCGGCATGAATCTTTTGGTTGCCAAGCAGCTTACCACCTTGGTCTTGCTGCTGGAG
CGACCGCTCCTCTTCCGTCTTTGCGGTCCGACACGCGTTGGGAACAGGCACTCTCCACCCGTGGCTGACATGTCT
CGATTCTCCCAAGAGGCACACAAGGCTGGATGCGGCCAGCTGCGATCAGACAGCCTCCAGATGAAGGCGTCTATT
CCATTCTCAATCCGAAACCTCGACCCGCGATCGTGGAACGGATACAACCCCGAGCGGCTCCGCAAGATGCTTCGG
CTTGTTTGGCAGGCAGATTCGCTACTCGACATAATGTCTGGCCTGACAAAGAGCACATCTGGTCGTTGCGCCTTT
GCCCTCTCCCTTCGACCGGGCGAGCTGAGGCCTGAGATGTCGTATAATTTTGCAGAGGCTCAAAGCTACTACAAC
GGCACGCCCTCGACGTTTGAGTTTCGACACTCGCAAATGTCATTTGACAGCATCCACATTGGAAACTGGGCAGAG
CTGTGCTGCAGACTCGTCGAGATTGCCACGCTTCCACCCCGCACATTTAAGCTCCAGCTCGAAGAAATCATCAAC
TGTCTTCCTATGCATGGAAACCGCGGACAAGGAAAATGGTGCGAGATTCTCGCTACCCTGGGCCTAAAGCACCAG
ATTGCAGAGTGGAAGGCCCAGCTCGCATGCTACGACAAAGGTACAGAGATATGCCTCGTTGATCGACTTGGAGTA
TTACAAAAGGAGTAA
Transcript >OphauB2|5883
ATGGACGAGACTTGGAGAGGCTTGGAATTGACAAGTCCGGTTTTTGACAAGACTGAGATTTATCACGGCATGCCT
CAGCTTAGGCAGGTTATTGCTGCCATGAGGTCTATGAAGACTTCGTTTGTGGCAAACTCGTCCTGTGGGCTCCAC
CTTCATGTGGGAATCGAGGGCGGCATGAATCTTTTGGTTGCCAAGCAGCTTACCACCTTGGTCTTGCTGCTGGAG
CGACCGCTCCTCTTCCGTCTTTGCGGTCCGACACGCGTTGGGAACAGGCACTCTCCACCCGTGGCTGACATGTCT
CGATTCTCCCAAGAGGCACACAAGGCTGGATGCGGCCAGCTGCGATCAGACAGCCTCCAGATGAAGGCGTCTATT
CCATTCTCAATCCGAAACCTCGACCCGCGATCGTGGAACGGATACAACCCCGAGCGGCTCCGCAAGATGCTTCGG
CTTGTTTGGCAGGCAGATTCGCTACTCGACATAATGTCTGGCCTGACAAAGAGCACATCTGGTCGTTGCGCCTTT
GCCCTCTCCCTTCGACCGGGCGAGCTGAGGCCTGAGATGTCGTATAATTTTGCAGAGGCTCAAAGCTACTACAAC
GGCACGCCCTCGACGTTTGAGTTTCGACACTCGCAAATGTCATTTGACAGCATCCACATTGGAAACTGGGCAGAG
CTGTGCTGCAGACTCGTCGAGATTGCCACGCTTCCACCCCGCACATTTAAGCTCCAGCTCGAAGAAATCATCAAC
TGTCTTCCTATGCATGGAAACCGCGGACAAGGAAAATGGTGCGAGATTCTCGCTACCCTGGGCCTAAAGCACCAG
ATTGCAGAGTGGAAGGCCCAGCTCGCATGCTACGACAAAGGTACAGAGATATGCCTCGTTGATCGACTTGGAGTA
TTACAAAAGGAGTAA
Gene >OphauB2|5883
ATGGACGAGACTTGGAGAGGCTTGGAATTGACAAGTCCGGTTTTTGACAAGACTGAGATTTATCACGGCATGCCT
CAGCTTAGGCAGGTTATTGCTGCCATGAGGTCTATGAAGACTTCGTTTGTGGCAAACTCGTCCTGTGGGCTCCAC
CTTCATGTGGGAATCGAGGGCGGCATGAATCTTTTGGTTGCCAAGCAGCTTACCACCTTGGTCTTGCTGCTGGAG
CGACCGCTCCTCTTCCGTCTTTGCGGTCCGACACGCGTTGGGAACAGGCACTCTCCACCCGTGGCTGACATGTCT
CGATTCTCCCAAGAGGCACACAAGGCTGGATGCGGCCAGCTGCGATCAGACAGCCTCCAGATGAAGGCGTCTATT
CCATTCTCAATCCGAAACCTCGACCCGCGATCGTGGAACGGATACAACCCCGAGCGGCTCCGCAAGATGCTTCGG
CTTGTTTGGCAGGCAGATTCGCTACTCGACATAATGTCTGGCCTGACAAAGAGCACATCTGGTCGTTGCGCCTTT
GCCCTCTCCCTTCGACCGGGCGAGCTGAGGCCTGAGATGTCGTATAATTTTGCAGAGGCTCAAAGCTACTACAAC
GGCACGCCCTCGACGTTTGAGTTTCGACACTCGCAAATGTCATTTGACAGCATCCACATTGGAAACTGGGCAGAG
CTGTGCTGCAGACTCGTCGAGATTGCCACGCTTCCACCCCGCACATTTAAGCTCCAGCTCGAAGAAATCATCAAC
TGTCTTCCTATGCATGGAAACCGCGGACAAGGAAAATGGTGCGAGATTCTCGCTACCCTGGGCCTAAAGCACCAG
ATTGCAGAGTGGAAGGCCCAGCTCGCATGCTACGACAAAGGTACAGAGATATGCCTCGTTGATCGACTTGGAGTA
TTACAAAAGGAGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail