Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|588
Gene name
LocationContig_11:176391..179762
Strand-
Gene length (bp)3371
Transcript length (bp)2886
Coding sequence length (bp)2886
Protein length (aa) 962

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04820 Trp_halogenase Tryptophan halogenase 2.2E-13 10 91
PF04820 Trp_halogenase Tryptophan halogenase 2.3E-12 101 378
PF00891 Methyltransf_2 O-methyltransferase domain 2.1E-16 799 939
PF01494 FAD_binding_3 FAD binding domain 9.0E-13 7 363

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9UQY0|OMTB_ASPPA Demethylsterigmatocystin 6-O-methyltransferase OS=Aspergillus parasiticus GN=omtB PE=1 SV=2 601 961 9.0E-70
sp|Q9P900|OMTB_ASPFL Demethylsterigmatocystin 6-O-methyltransferase OS=Aspergillus flavus GN=omtB PE=3 SV=1 601 947 3.0E-69
sp|Q0VZ69|THAL_CHOCO Tryptophan 2-halogenase OS=Chondromyces crocatus GN=cmdE PE=4 SV=1 4 378 2.0E-67
sp|Q12120|OMTA_ASPPA Sterigmatocystin 8-O-methyltransferase OS=Aspergillus parasiticus GN=omtA PE=1 SV=1 651 934 1.0E-23
sp|P55790|OMTA_ASPFL Sterigmatocystin 8-O-methyltransferase OS=Aspergillus flavus GN=omtA PE=3 SV=1 651 934 2.0E-21
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9UQY0|OMTB_ASPPA Demethylsterigmatocystin 6-O-methyltransferase OS=Aspergillus parasiticus GN=omtB PE=1 SV=2 601 961 9.0E-70
sp|Q9P900|OMTB_ASPFL Demethylsterigmatocystin 6-O-methyltransferase OS=Aspergillus flavus GN=omtB PE=3 SV=1 601 947 3.0E-69
sp|Q0VZ69|THAL_CHOCO Tryptophan 2-halogenase OS=Chondromyces crocatus GN=cmdE PE=4 SV=1 4 378 2.0E-67
sp|Q12120|OMTA_ASPPA Sterigmatocystin 8-O-methyltransferase OS=Aspergillus parasiticus GN=omtA PE=1 SV=1 651 934 1.0E-23
sp|P55790|OMTA_ASPFL Sterigmatocystin 8-O-methyltransferase OS=Aspergillus flavus GN=omtA PE=3 SV=1 651 934 2.0E-21
sp|B9WZX2|FTMD_ASPFM 6-hydroxytryprostatin B O-methyltransferase OS=Neosartorya fumigata GN=ftmMT PE=1 SV=1 667 949 2.0E-14
sp|B0CN39|SFMM3_STRLA O-methyltransferase SfmM3 OS=Streptomyces lavendulae GN=sfmM3 PE=3 SV=1 798 940 2.0E-14
sp|Q54S95|OMT7_DICDI O-methyltransferase 7 OS=Dictyostelium discoideum GN=omt7 PE=3 SV=1 800 940 9.0E-14
sp|P42712|DMPM_STRAD O-demethylpuromycin-O-methyltransferase OS=Streptomyces alboniger GN=dmpM PE=3 SV=1 670 960 1.0E-13
sp|Q4WAW6|FTMD_ASPFU 6-hydroxytryprostatin B O-methyltransferase OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=ftmMT PE=1 SV=1 667 949 2.0E-13
sp|A1DA61|FTMD_NEOFI 6-hydroxytryprostatin B O-methyltransferase OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=ftmMT PE=3 SV=1 800 949 3.0E-13
sp|Q7XB10|4OMT2_PAPSO 3'-hydroxy-N-methyl-(S)-coclaurine 4'-O-methyltransferase 2 OS=Papaver somniferum GN=4'OMT2 PE=1 SV=1 658 960 6.0E-13
sp|Q54GZ0|OMT9_DICDI O-methyltransferase 9 OS=Dictyostelium discoideum GN=omt9 PE=3 SV=1 657 940 1.0E-12
sp|Q6WUC1|6OMT_PAPSO (RS)-norcoclaurine 6-O-methyltransferase OS=Papaver somniferum GN=6OMT PE=1 SV=1 800 960 9.0E-12
sp|Q9LEL6|6OMT_COPJA (RS)-norcoclaurine 6-O-methyltransferase OS=Coptis japonica PE=1 SV=1 626 960 2.0E-11
sp|Q54B59|OMT12_DICDI O-methyltransferase 12 OS=Dictyostelium discoideum GN=omt12 PE=1 SV=1 672 944 2.0E-11
sp|P93324|CHOMT_MEDSA Isoliquiritigenin 2'-O-methyltransferase OS=Medicago sativa PE=1 SV=1 800 944 3.0E-11
sp|Q86I40|OMT4_DICDI O-methyltransferase 4 OS=Dictyostelium discoideum GN=omt4 PE=3 SV=1 800 949 3.0E-11
sp|Q39522|SMT_COPJA (S)-scoulerine 9-O-methyltransferase OS=Coptis japonica GN=SMT PE=1 SV=1 800 950 4.0E-11
sp|Q9LEL5|4OMT_COPJA 3'-hydroxy-N-methyl-(S)-coclaurine 4'-O-methyltransferase OS=Coptis japonica PE=1 SV=1 724 960 6.0E-11
sp|P96800|Y1602_METBF Uncharacterized protein Mbar_A1602 OS=Methanosarcina barkeri (strain Fusaro / DSM 804) GN=Mbar_A1602 PE=3 SV=2 6 349 6.0E-11
sp|P16559|TCMN_STRGA Multifunctional cyclase-dehydratase-3-O-methyl transferase TcmN OS=Streptomyces glaucescens GN=tcmN PE=1 SV=2 632 934 7.0E-11
sp|B0EXJ8|HTOMT_CATRO Tabersonine 16-O-methyltransferase OS=Catharanthus roseus GN=16OMT PE=1 SV=1 800 939 1.0E-10
sp|Q8GSN1|MOMT_CATRO Myricetin O-methyltransferase OS=Catharanthus roseus PE=1 SV=1 800 939 2.0E-10
sp|Q84HC8|NCSB1_STRCZ 2,7-dihydroxy-5-methyl-1-naphthoate 7-O-methyltransferase OS=Streptomyces carzinostaticus GN=ncsB1 PE=1 SV=1 843 956 2.0E-10
sp|Q84KK5|D7OMT_GLYEC Isoflavone 7-O-methyltransferase OS=Glycyrrhiza echinata GN=D7OMT PE=1 SV=1 674 952 4.0E-10
sp|O24305|M3OM1_PEA (+)-6a-hydroxymaackiain 3-O-methyltransferase 1 OS=Pisum sativum GN=HMM1 PE=1 SV=1 800 960 9.0E-09
sp|C7SDN9|N7OMT_PAPSO Norreticuline-7-O-methyltransferase OS=Papaver somniferum PE=1 SV=1 638 939 1.0E-08
sp|Q7XB11|4OMT1_PAPSO 3'-hydroxy-N-methyl-(S)-coclaurine 4'-O-methyltransferase 1 OS=Papaver somniferum GN=4'OMT1 PE=2 SV=1 654 960 1.0E-08
sp|O22308|7OMT6_MEDSA Isoflavone-7-O-methyltransferase 6 OS=Medicago sativa PE=2 SV=1 674 952 2.0E-08
sp|O22309|7OMT9_MEDSA Isoflavone-7-O-methyltransferase 9 OS=Medicago sativa PE=2 SV=1 674 952 3.0E-08
sp|O24529|7OMT8_MEDSA Isoflavone-7-O-methyltransferase 8 OS=Medicago sativa PE=1 SV=1 674 952 4.0E-08
sp|P10950|ASMT_BOVIN Acetylserotonin O-methyltransferase OS=Bos taurus GN=ASMT PE=1 SV=2 798 946 4.0E-08
sp|Q8HZJ0|ASMT_MACMU Acetylserotonin O-methyltransferase OS=Macaca mulatta GN=ASMT PE=2 SV=1 798 956 5.0E-08
sp|A8QW52|OMT1_SORBI Eugenol O-methyltransferase OS=Sorghum bicolor GN=EOMT PE=1 SV=1 799 939 8.0E-08
sp|Q92056|ASMT_CHICK Acetylserotonin O-methyltransferase OS=Gallus gallus GN=ASMT PE=2 SV=1 845 952 1.0E-07
sp|Q6WUC2|7OMT_PAPSO (R,S)-reticuline 7-O-methyltransferase OS=Papaver somniferum GN=7OMT PE=1 SV=1 800 946 1.0E-07
sp|Q6T1F6|BMT_AMMMJ Bergaptol O-methyltransferase OS=Ammi majus GN=BMT PE=1 SV=1 659 940 2.0E-07
sp|P46597|ASMT_HUMAN Acetylserotonin O-methyltransferase OS=Homo sapiens GN=ASMT PE=1 SV=1 798 950 2.0E-07
sp|Q9FQY8|COMT1_CAPAN Caffeic acid 3-O-methyltransferase OS=Capsicum annuum GN=COMT PE=2 SV=2 800 939 3.0E-07
sp|Q55216|DNRK_STRS5 Carminomycin 4-O-methyltransferase DauK OS=Streptomyces sp. (strain C5) GN=dauK PE=1 SV=1 663 939 5.0E-07
sp|A8J6X1|BMT_GLELI Bergaptol O-methyltransferase OS=Glehnia littoralis GN=BMT PE=1 SV=1 800 940 8.0E-07
sp|Q06528|DNRK_STRPE Carminomycin 4-O-methyltransferase DnrK OS=Streptomyces peucetius GN=dnrK PE=1 SV=2 663 939 8.0E-07
sp|Q42653|OMT2_CHRAE Quercetin 3-O-methyltransferase 2 OS=Chrysosplenium americanum GN=OMT2 PE=1 SV=1 800 940 8.0E-07
sp|P59049|OMT1_CHRAE Quercetin 3-O-methyltransferase 1 OS=Chrysosplenium americanum GN=OMT1 PE=1 SV=1 800 940 9.0E-07
sp|Q29U70|I4OMT_MEDTR Isoflavone 4'-O-methyltransferase OS=Medicago truncatula GN=HI4'OMT PE=1 SV=1 824 960 9.0E-07
sp|O95671|ASML_HUMAN N-acetylserotonin O-methyltransferase-like protein OS=Homo sapiens GN=ASMTL PE=1 SV=3 766 951 1.0E-06
sp|Q93WU2|EOMT1_OCIBA Eugenol O-methyltransferase OS=Ocimum basilicum GN=EOMT1 PE=1 SV=1 800 960 2.0E-06
sp|O29786|GGR_ARCFU Digeranylgeranylglycerophospholipid reductase OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=AF_0464 PE=1 SV=2 10 349 2.0E-06
sp|Q54527|RDMB_STREF Aclacinomycin 10-hydroxylase RdmB OS=Streptomyces purpurascens GN=rdmB PE=1 SV=1 800 938 3.0E-06
sp|Q54B60|OMT11_DICDI Probable inactive O-methyltransferase 11 OS=Dictyostelium discoideum GN=omt11 PE=3 SV=1 800 940 5.0E-06
sp|B4XY98|AZIB2_STREG 3-hydroxy-5-methyl-1-naphthoate 3-O-methyltransferase OS=Streptomyces sahachiroi GN=aziB2 PE=1 SV=1 800 956 6.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0071949 FAD binding Yes
GO:0008171 O-methyltransferase activity Yes
GO:0097159 organic cyclic compound binding No
GO:0048037 cofactor binding No
GO:0043168 anion binding No
GO:0000166 nucleotide binding No
GO:0008168 methyltransferase activity No
GO:0016741 transferase activity, transferring one-carbon groups No
GO:0050662 coenzyme binding No
GO:0005488 binding No
GO:1901363 heterocyclic compound binding No
GO:1901265 nucleoside phosphate binding No
GO:0036094 small molecule binding No
GO:0003674 molecular_function No
GO:0050660 flavin adenine dinucleotide binding No
GO:0043167 ion binding No
GO:0016740 transferase activity No
GO:0003824 catalytic activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 28 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|588
MASIPEKCTVLVIGGGPAGSFASSALAREGINVVLLEAEKFPRYHIGESMLPSMRHFLKFIDCYEKWDAHGFNIK
NGGAFRLNWSRPETYTDFIAAGGSQGYAWNVVRSEADELLFKHAGECGVKTFDETKVASIEFAPREADAPEKQPF
GRPVSATWTRKDGSSGVIAVDYIVDASGRNGLISTRYLKNRAYNQGLKNIANWGYWKGGGVHGVGTFKEGAPYFE
ALKDASGWVWFIPLHNGTHSVGIVQNQEMATAKKRKMAEPSSKGFYLETLELVPGIKELLAKAELVSEIKSASDW
SYSASNYAFPGVRIAGDAGSFIDPFFSSGVHLALSGGLSAATTICAALRGDCDEKFAASWHDKKTAESYTRFLVV
VSSALKQIRAQDQPVINDFDEDTFERAFDLFRPIIQGQADSDFKGKLSQAEISKTVEFCFKAFAHVSYEDKEALV
KKLKDLGLDGDAHDEKNRQALDELEKKLTPEERSILTTLKGRRMVRPEDSLNIDNFTLDSIDGFAPRLERGRLGL
ASAEKAKVKYTTHDSLSYLNGEARAANKVPANGAVVKNGCNGANGHHAANGVNGSANKNMAALVADDENLPQTTL
DEASRHKLMSSLHESAEQLETPYDTMLRFLNAGRQVALIKLGGDMQIFKSLVDSKTPLSSAQLAKPTAADPRLVA
RIVRYLAANRLVAQVAPDQFTAQQTTHTLADPRIQGPMRFFHAVSNPAFHALPDFLQETGYQNKSETCAFQRGLK
TDLGLFPWLKQHPDLLKDFQSLMGVPKEGNCLNVISLDASVSSEHRGPILVDIGGNTGQQAGNILAKHPELAGRV
VVQDREEAVKNASDIKGCQFMAHDFFKPQPIKGAKYYYLRAILHNWDDEKAAQILANIVPAMTADSLVLIDETVI
ADEGAHVWPAGLDLQMFTLFGATERTTTQWDAILDRAGLRPVAVKRYAPVMGSSVIFAAPK*
Coding >OphauB2|588
ATGGCTAGCATTCCGGAAAAGTGCACCGTCTTGGTGATTGGAGGCGGACCGGCAGGCTCGTTTGCCTCGTCAGCT
CTTGCTCGCGAGGGCATAAATGTTGTTCTTCTCGAAGCTGAGAAATTCCCCAGATACCACATTGGCGAAAGCATG
CTGCCATCCATGAGGCATTTCCTCAAGTTTATCGACTGCTACGAGAAGTGGGATGCCCACGGCTTCAACATCAAG
AACGGAGGTGCATTCCGCCTCAACTGGTCTCGGCCAGAGACTTATACCGACTTTATCGCGGCTGGTGGTTCCCAG
GGCTATGCGTGGAACGTGGTCCGCTCCGAGGCGGACGAGCTGCTCTTCAAGCATGCGGGTGAATGCGGCGTCAAG
ACGTTTGACGAGACAAAGGTTGCCTCTATTGAATTCGCGCCTCGCGAGGCCGACGCGCCAGAGAAGCAGCCCTTT
GGCCGCCCCGTGTCTGCGACGTGGACTCGCAAAGATGGCTCGTCGGGCGTCATTGCCGTAGACTACATTGTCGAC
GCGTCTGGACGCAATGGGCTTATTAGCACCCGCTACCTCAAGAACCGGGCCTACAACCAGGGACTCAAGAATATC
GCCAACTGGGGCTACTGGAAGGGCGGCGGTGTCCACGGCGTCGGCACCTTTAAAGAAGGCGCTCCATACTTTGAA
GCTCTCAAGGACGCCAGCGGATGGGTATGGTTTATCCCTCTCCACAACGGCACCCACTCTGTCGGCATTGTGCAA
AACCAGGAAATGGCCACGGCCAAGAAGCGCAAAATGGCCGAACCCTCGTCCAAGGGCTTCTACCTCGAGACGCTT
GAGCTCGTGCCCGGCATCAAGGAGCTGCTTGCAAAAGCCGAGCTCGTCTCGGAAATCAAGTCGGCGTCGGACTGG
TCCTACAGCGCCTCCAACTATGCCTTTCCGGGCGTGCGCATTGCCGGCGACGCAGGCTCCTTTATCGACCCCTTT
TTCTCGTCGGGCGTCCACTTGGCGCTGTCGGGCGGTCTCTCTGCCGCAACGACGATTTGCGCAGCGCTTCGCGGC
GACTGCGATGAAAAGTTTGCCGCGTCGTGGCATGACAAGAAGACGGCGGAGAGTTATACTCGCTTCCTGGTTGTC
GTGTCGAGTGCCCTGAAGCAAATCCGGGCTCAGGATCAGCCCGTCATCAACGACTTTGACGAGGACACGTTTGAG
CGTGCCTTTGACCTCTTTCGCCCTATCATTCAAGGCCAGGCCGACTCGGACTTCAAGGGCAAGCTCAGCCAGGCC
GAAATCTCCAAGACTGTTGAATTCTGCTTCAAGGCCTTTGCCCACGTCTCCTACGAAGACAAGGAGGCCCTTGTC
AAGAAACTCAAGGACCTCGGCCTCGACGGCGACGCCCATGACGAAAAGAACCGCCAGGCGCTCGATGAGCTGGAG
AAGAAGCTGACGCCCGAGGAGCGCTCCATTCTCACCACGCTAAAGGGCCGCCGCATGGTGCGCCCCGAGGACTCG
CTAAACATTGACAACTTTACCCTGGACTCGATTGACGGCTTTGCGCCGCGGCTGGAGCGCGGACGGCTGGGGCTG
GCCTCGGCGGAAAAGGCAAAGGTCAAGTATACCACTCACGACTCGCTTTCATACTTGAACGGCGAGGCCAGAGCG
GCCAACAAGGTGCCGGCAAATGGTGCCGTTGTCAAGAATGGATGCAACGGCGCCAATGGACACCATGCTGCAAAC
GGGGTCAATGGCTCGGCAAACAAGAACATGGCAGCTCTCGTGGCAGATGATGAAAATCTCCCGCAGACGACGCTC
GATGAAGCCAGCAGACACAAGCTCATGTCGTCGCTACACGAATCAGCCGAACAACTCGAAACGCCATACGACACC
ATGCTGCGTTTTCTCAATGCTGGCCGTCAAGTCGCCCTCATCAAACTTGGCGGCGACATGCAAATCTTCAAGTCG
CTGGTCGACAGCAAAACCCCCCTCTCCTCCGCCCAGCTCGCCAAGCCCACCGCCGCCGACCCCCGCCTCGTGGCC
CGCATCGTGCGCTACCTCGCCGCCAACCGTCTAGTCGCCCAAGTCGCCCCCGACCAATTCACCGCGCAGCAAACC
ACACATACCCTCGCTGACCCTCGCATCCAAGGCCCCATGCGCTTCTTCCACGCCGTTAGCAACCCTGCCTTCCAC
GCGCTGCCTGATTTTCTCCAGGAGACGGGATATCAGAATAAGAGTGAGACGTGTGCCTTTCAAAGGGGGCTCAAG
ACGGACCTTGGTCTGTTTCCTTGGCTCAAGCAGCATCCCGACTTGCTCAAGGACTTTCAGAGCCTCATGGGCGTT
CCAAAGGAGGGAAACTGTCTCAATGTGATTTCGCTAGACGCCTCGGTTAGTAGTGAGCACCGCGGGCCTATTCTT
GTCGACATTGGCGGAAACACGGGCCAGCAGGCTGGAAACATCTTGGCCAAGCATCCCGAGCTGGCCGGCCGCGTC
GTTGTTCAGGACCGCGAAGAGGCGGTCAAGAATGCCTCTGACATCAAGGGCTGCCAATTCATGGCCCACGACTTT
TTCAAGCCCCAGCCCATCAAGGGTGCCAAATACTACTACTTGCGAGCCATCTTGCACAACTGGGATGACGAAAAG
GCGGCGCAAATCTTGGCCAATATTGTGCCTGCCATGACGGCCGACTCGCTCGTGCTCATTGACGAAACCGTCATT
GCAGACGAGGGAGCTCACGTGTGGCCTGCAGGCCTCGATTTGCAAATGTTTACTCTGTTTGGGGCGACGGAGCGC
ACAACCACCCAGTGGGATGCTATCCTCGACCGGGCTGGACTGCGCCCCGTGGCCGTCAAGAGATATGCCCCCGTC
ATGGGAAGCTCCGTCATTTTTGCTGCACCAAAATAA
Transcript >OphauB2|588
ATGGCTAGCATTCCGGAAAAGTGCACCGTCTTGGTGATTGGAGGCGGACCGGCAGGCTCGTTTGCCTCGTCAGCT
CTTGCTCGCGAGGGCATAAATGTTGTTCTTCTCGAAGCTGAGAAATTCCCCAGATACCACATTGGCGAAAGCATG
CTGCCATCCATGAGGCATTTCCTCAAGTTTATCGACTGCTACGAGAAGTGGGATGCCCACGGCTTCAACATCAAG
AACGGAGGTGCATTCCGCCTCAACTGGTCTCGGCCAGAGACTTATACCGACTTTATCGCGGCTGGTGGTTCCCAG
GGCTATGCGTGGAACGTGGTCCGCTCCGAGGCGGACGAGCTGCTCTTCAAGCATGCGGGTGAATGCGGCGTCAAG
ACGTTTGACGAGACAAAGGTTGCCTCTATTGAATTCGCGCCTCGCGAGGCCGACGCGCCAGAGAAGCAGCCCTTT
GGCCGCCCCGTGTCTGCGACGTGGACTCGCAAAGATGGCTCGTCGGGCGTCATTGCCGTAGACTACATTGTCGAC
GCGTCTGGACGCAATGGGCTTATTAGCACCCGCTACCTCAAGAACCGGGCCTACAACCAGGGACTCAAGAATATC
GCCAACTGGGGCTACTGGAAGGGCGGCGGTGTCCACGGCGTCGGCACCTTTAAAGAAGGCGCTCCATACTTTGAA
GCTCTCAAGGACGCCAGCGGATGGGTATGGTTTATCCCTCTCCACAACGGCACCCACTCTGTCGGCATTGTGCAA
AACCAGGAAATGGCCACGGCCAAGAAGCGCAAAATGGCCGAACCCTCGTCCAAGGGCTTCTACCTCGAGACGCTT
GAGCTCGTGCCCGGCATCAAGGAGCTGCTTGCAAAAGCCGAGCTCGTCTCGGAAATCAAGTCGGCGTCGGACTGG
TCCTACAGCGCCTCCAACTATGCCTTTCCGGGCGTGCGCATTGCCGGCGACGCAGGCTCCTTTATCGACCCCTTT
TTCTCGTCGGGCGTCCACTTGGCGCTGTCGGGCGGTCTCTCTGCCGCAACGACGATTTGCGCAGCGCTTCGCGGC
GACTGCGATGAAAAGTTTGCCGCGTCGTGGCATGACAAGAAGACGGCGGAGAGTTATACTCGCTTCCTGGTTGTC
GTGTCGAGTGCCCTGAAGCAAATCCGGGCTCAGGATCAGCCCGTCATCAACGACTTTGACGAGGACACGTTTGAG
CGTGCCTTTGACCTCTTTCGCCCTATCATTCAAGGCCAGGCCGACTCGGACTTCAAGGGCAAGCTCAGCCAGGCC
GAAATCTCCAAGACTGTTGAATTCTGCTTCAAGGCCTTTGCCCACGTCTCCTACGAAGACAAGGAGGCCCTTGTC
AAGAAACTCAAGGACCTCGGCCTCGACGGCGACGCCCATGACGAAAAGAACCGCCAGGCGCTCGATGAGCTGGAG
AAGAAGCTGACGCCCGAGGAGCGCTCCATTCTCACCACGCTAAAGGGCCGCCGCATGGTGCGCCCCGAGGACTCG
CTAAACATTGACAACTTTACCCTGGACTCGATTGACGGCTTTGCGCCGCGGCTGGAGCGCGGACGGCTGGGGCTG
GCCTCGGCGGAAAAGGCAAAGGTCAAGTATACCACTCACGACTCGCTTTCATACTTGAACGGCGAGGCCAGAGCG
GCCAACAAGGTGCCGGCAAATGGTGCCGTTGTCAAGAATGGATGCAACGGCGCCAATGGACACCATGCTGCAAAC
GGGGTCAATGGCTCGGCAAACAAGAACATGGCAGCTCTCGTGGCAGATGATGAAAATCTCCCGCAGACGACGCTC
GATGAAGCCAGCAGACACAAGCTCATGTCGTCGCTACACGAATCAGCCGAACAACTCGAAACGCCATACGACACC
ATGCTGCGTTTTCTCAATGCTGGCCGTCAAGTCGCCCTCATCAAACTTGGCGGCGACATGCAAATCTTCAAGTCG
CTGGTCGACAGCAAAACCCCCCTCTCCTCCGCCCAGCTCGCCAAGCCCACCGCCGCCGACCCCCGCCTCGTGGCC
CGCATCGTGCGCTACCTCGCCGCCAACCGTCTAGTCGCCCAAGTCGCCCCCGACCAATTCACCGCGCAGCAAACC
ACACATACCCTCGCTGACCCTCGCATCCAAGGCCCCATGCGCTTCTTCCACGCCGTTAGCAACCCTGCCTTCCAC
GCGCTGCCTGATTTTCTCCAGGAGACGGGATATCAGAATAAGAGTGAGACGTGTGCCTTTCAAAGGGGGCTCAAG
ACGGACCTTGGTCTGTTTCCTTGGCTCAAGCAGCATCCCGACTTGCTCAAGGACTTTCAGAGCCTCATGGGCGTT
CCAAAGGAGGGAAACTGTCTCAATGTGATTTCGCTAGACGCCTCGGTTAGTAGTGAGCACCGCGGGCCTATTCTT
GTCGACATTGGCGGAAACACGGGCCAGCAGGCTGGAAACATCTTGGCCAAGCATCCCGAGCTGGCCGGCCGCGTC
GTTGTTCAGGACCGCGAAGAGGCGGTCAAGAATGCCTCTGACATCAAGGGCTGCCAATTCATGGCCCACGACTTT
TTCAAGCCCCAGCCCATCAAGGGTGCCAAATACTACTACTTGCGAGCCATCTTGCACAACTGGGATGACGAAAAG
GCGGCGCAAATCTTGGCCAATATTGTGCCTGCCATGACGGCCGACTCGCTCGTGCTCATTGACGAAACCGTCATT
GCAGACGAGGGAGCTCACGTGTGGCCTGCAGGCCTCGATTTGCAAATGTTTACTCTGTTTGGGGCGACGGAGCGC
ACAACCACCCAGTGGGATGCTATCCTCGACCGGGCTGGACTGCGCCCCGTGGCCGTCAAGAGATATGCCCCCGTC
ATGGGAAGCTCCGTCATTTTTGCTGCACCAAAATAA
Gene >OphauB2|588
ATGGCTAGCATTCCGGAAAAGTGCACCGTCTTGGTGATTGGAGGCGGACCGGCAGGCTCGTTTGCCTCGTCAGCT
CTTGCTCGCGAGGGCATAAATGTTGTTCTTCTCGAAGCTGAGAAATTCCCCAGGTGAGACTTGGCGCATCTCCGT
GGCCTGATTTTTGTGGCTTGTCAGGAGCGACTAACCAACACAATGCTAGATACCACATTGGCGAAAGCATGCTGC
CATCCATGAGGCATTTCCTCAAGTTTATCGACTGCTACGAGAAGTGGGATGCCCACGGCTTCAACATCAAGGTGT
GTGCAAAAAAAGACTTTTTGCTCGTTTCCGGGCCCGATTAGGAATATTCGTGTTAATTCCCGCGTCATAGAACGG
AGGTGCATTCCGCCTCAACTGGTCTCGGCCAGAGACTTGTAAGTTTTTACACCGCAGCCAACAAGGTGGGAGCAA
ATGACTCATTTGCCATCTTAGATACCGACTTTATCGCGGCTGGTGGTTCCCAGGGCTATGCGTGGAACGTGGTCC
GCTCCGAGGCGGACGAGCTGCTCTTCAAGCATGCGGGTGAATGCGGCGTCAAGACGTTTGACGAGACAAAGGTTG
CCTCTATTGAATTCGCGCCTCGCGAGGCCGACGCGCCAGAGAAGCAGCCCTTTGGCCGCCCCGTGTCTGCGACGT
GGACTCGCAAAGATGGCTCGTCGGGCGTCATTGCCGTAGACTACATTGTCGACGCGTCTGGACGCAATGGGCTTA
TTAGCACCCGCTACCTCAAGAACCGGGCCTACAACCAGGGACTCAAGAATATCGCCAACTGGGGCTACTGGAAGG
GCGGCGGTGTCCACGGCGTCGGCACCTTTAAAGAAGGCGCTCCATACTTTGAAGCTCTCAAGGGTACGCTACCCT
CGTCTGCCTTGCCCCCCTGAAAACGACTCTTTTTGCTAACAAACCACTACAGACGCCAGCGGATGGGTATGGTTT
ATCCCTCTCCACAACGGCACCCACTCTGTCGGCATTGTGCAAAACCAGGAAATGGCCACGGCCAAGAAGCGCAAA
ATGGCCGAACCCTCGTCCAAGGGCTTCTACCTCGAGACGCTTGAGCTCGTGCCCGGCATCAAGGAGCTGCTTGCA
AAAGCCGAGCTCGTCTCGGAAATCAAGTCGGCGTCGGACTGGTCCTACAGCGCCTCCAACTATGCCTTTCCGGGC
GTGCGCATTGCCGGCGACGCAGGCTCCTTTATCGACCCCTTTTTCTCGTCGGGCGTCCACTTGGCGCTGTCGGGC
GGTCTCTCTGCCGCAACGACGATTTGCGCAGCGCTTCGCGGCGACTGCGATGAAAAGTTTGCCGCGTCGTGGCAT
GACAAGAAGACGGCGGAGAGTTATACTCGCTTCCTGGTTGTCGTGTCGAGTGCCCTGAAGCAAATCCGGGCTCAG
GATCAGCCCGTCATCAACGACTTTGACGAGGACACGTTTGAGCGTGCCTTTGACCTCTTTCGCCCTAGTAAGTCG
ATGCCACTCTAGCCTCTTTCTCTTGAGACATGAAGAGCAAGACTCTAACGCATCTGCGCAGTCATTCAAGGCCAG
GCCGACTCGGACTTCAAGGGCAAGCTCAGCCAGGCCGAAATCTCCAAGACTGTTGAATTCTGCTTCAAGGCCTTT
GCCCACGTCTCCTACGAAGACAAGGAGGCCCTTGTCAAGAAACTCAAGGACCTCGGCCTCGACGGCGACGCCCAT
GACGAAAAGAACCGCCAGGCGCTCGATGAGCTGGAGAAGAAGCTGACGCCCGAGGAGCGCTCCATTCTCACCACG
CTAAAGGGCCGCCGCATGGTGCGCCCCGAGGACTCGCTAAACATTGACAACTTTACCCTGGACTCGATTGACGGC
TTTGCGCCGCGGCTGGAGCGCGGACGGCTGGGGCTGGCCTCGGCGGAAAAGGCAAAGGTCAAGTATACCACTCAC
GACTCGCTTTCATACTTGAACGGCGAGGCCAGAGCGGCCAACAAGGTGCCGGCAAATGGTGCCGTTGTCAAGAAT
GGATGCAACGGCGCCAATGGACACCATGCTGCAAACGGGGTCAATGGCTCGGCAAACAAGAACATGGCAGCTCTC
GTGGCAGATGATGAAAATCTCCCGCAGACGACGCTCGATGAAGCCAGCAGACACAAGCTCATGTCGTCGCTACAC
GAATCAGCCGAACAACTCGAAACGCCATACGACACCATGCTGCGTTTTCTCAATGCTGTTAGTCCTCCCCCAATC
ATTCCCTCTTCTTCTTCTACTTATACTCACACCCCATTGCCAACCAGGGCCGTCAAGTCGCCCTCATCAAACTTG
GCGGCGACATGCAAATCTTCAAGTCGCTGGTCGACAGCAAAACCCCCCTCTCCTCCGCCCAGCTCGCCAAGCCCA
CCGCCGCCGACCCCCGCCTCGTGGCCCGCATCGTGCGCTACCTCGCCGCCAACCGTCTAGTCGCCCAAGTCGCCC
CCGACCAATTCACCGCGCAGCAAACCACACATACCCTCGCTGACCCTCGCATCCAAGGCCCCATGCGCTTCTTCC
ACGCCGTTAGCAACCCTGCCTTCCACGCGCTGCCTGATTTTCTCCAGGAGACGGGATATCAGAATAAGAGTGAGA
CGTGTGCCTTTCAAAGGGGGCTCAAGACGGACCTTGGTCTGTTTCCTTGGCTCAAGCAGCATCCCGACTTGCTCA
AGGACTTTCAGAGCCTCATGGGCGTTCCAAAGGAGGGAAACTGTCTCAATGTGATTTCGCTAGACGCCTCGGTTA
GTAGTGAGCACCGCGGGCCTATTCTTGTCGACATTGGCGGAAACACGGGCCAGCAGGCTGGAAACATCTTGGCCA
AGCATCCCGAGCTGGCCGGCCGCGTCGTTGTTCAGGACCGCGAAGAGGCGGTCAAGAATGCCTCTGACATCAAGG
GCTGCCAATTCATGGCCCACGACTTTTTCAAGCCCCAGCCCATCAAGGGTGAGTTTTTCTTCTTTTTTTTTTCCG
TGACGAGCCAATATAGGCTAGACACTTTTAGAGCCATGACTGACAGACTTGTACAAGGTGCCAAATACTACTACT
TGCGAGCCATCTTGCACAACTGGGATGACGAAAAGGCGGCGCAAATCTTGGCCAATATTGTGCCTGCCATGACGG
CCGACTCGCTCGTGCTCATTGACGAAACCGTCATTGCAGACGAGGGAGCTCACGTGTGGCCTGCAGGCCTCGATT
TGCAAATGTTTACTCTGTTTGGGGCGACGGAGCGCACAACCACCCAGTGGGATGCTATCCTCGACCGGGCTGGAC
TGCGCCCCGTGGCCGTCAAGAGATATGCCCCCGTCATGGGAAGCTCCGTCATTTTTGCTGCACCAAAATAA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail