Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|5876
Gene name
LocationContig_5:59179..60361
Strand-
Gene length (bp)1182
Transcript length (bp)1182
Coding sequence length (bp)1182
Protein length (aa) 394

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01008 IF-2B Initiation factor 2 subunit family 7.2E-75 46 367

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|C7Z638|MTNA_NECH7 Methylthioribose-1-phosphate isomerase OS=Nectria haematococca (strain 77-13-4 / ATCC MYA-4622 / FGSC 9596 / MPVI) GN=MRI1 PE=3 SV=1 1 385 0.0E+00
sp|C9SB02|MTNA_VERA1 Methylthioribose-1-phosphate isomerase OS=Verticillium alfalfae (strain VaMs.102 / ATCC MYA-4576 / FGSC 10136) GN=MRI1 PE=3 SV=1 1 385 0.0E+00
sp|Q2GM68|MTNA_CHAGB Methylthioribose-1-phosphate isomerase OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=MRI1 PE=3 SV=1 1 383 3.0E-179
sp|P0CI29|MTNA_SORMK Methylthioribose-1-phosphate isomerase OS=Sordaria macrospora (strain ATCC MYA-333 / DSM 997 / K(L3346) / K-hell) GN=MRI1 PE=3 SV=1 1 383 5.0E-173
sp|Q7S4G7|MTNA_NEUCR Methylthioribose-1-phosphate isomerase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=mri-1 PE=3 SV=1 1 383 2.0E-172
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|C7Z638|MTNA_NECH7 Methylthioribose-1-phosphate isomerase OS=Nectria haematococca (strain 77-13-4 / ATCC MYA-4622 / FGSC 9596 / MPVI) GN=MRI1 PE=3 SV=1 1 385 0.0E+00
sp|C9SB02|MTNA_VERA1 Methylthioribose-1-phosphate isomerase OS=Verticillium alfalfae (strain VaMs.102 / ATCC MYA-4576 / FGSC 10136) GN=MRI1 PE=3 SV=1 1 385 0.0E+00
sp|Q2GM68|MTNA_CHAGB Methylthioribose-1-phosphate isomerase OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=MRI1 PE=3 SV=1 1 383 3.0E-179
sp|P0CI29|MTNA_SORMK Methylthioribose-1-phosphate isomerase OS=Sordaria macrospora (strain ATCC MYA-333 / DSM 997 / K(L3346) / K-hell) GN=MRI1 PE=3 SV=1 1 383 5.0E-173
sp|Q7S4G7|MTNA_NEUCR Methylthioribose-1-phosphate isomerase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=mri-1 PE=3 SV=1 1 383 2.0E-172
sp|B2AML6|MTNA_PODAN Methylthioribose-1-phosphate isomerase OS=Podospora anserina (strain S / ATCC MYA-4624 / DSM 980 / FGSC 10383) GN=MRI1 PE=3 SV=2 1 386 5.0E-171
sp|A7EGZ3|MTNA_SCLS1 Methylthioribose-1-phosphate isomerase OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=mri1 PE=3 SV=1 1 385 1.0E-149
sp|A6RHT9|MTNA_BOTFB Methylthioribose-1-phosphate isomerase OS=Botryotinia fuckeliana (strain B05.10) GN=mri1 PE=3 SV=1 1 385 2.0E-149
sp|C1G9Q3|MTNA_PARBD Methylthioribose-1-phosphate isomerase OS=Paracoccidioides brasiliensis (strain Pb18) GN=MRI1 PE=3 SV=1 3 376 2.0E-132
sp|B8M7D2|MTNA_TALSN Methylthioribose-1-phosphate isomerase OS=Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006) GN=mri1 PE=3 SV=1 4 382 1.0E-131
sp|B6QRG1|MTNA_TALMQ Methylthioribose-1-phosphate isomerase OS=Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333) GN=mri1 PE=3 SV=1 4 382 7.0E-129
sp|C0S1C8|MTNA_PARBP Methylthioribose-1-phosphate isomerase OS=Paracoccidioides brasiliensis (strain Pb03) GN=MRI1 PE=3 SV=1 3 376 2.0E-128
sp|B2VZQ8|MTNA_PYRTR Methylthioribose-1-phosphate isomerase OS=Pyrenophora tritici-repentis (strain Pt-1C-BFP) GN=mri1 PE=3 SV=1 4 376 3.0E-128
sp|Q5B590|MTNA_EMENI Methylthioribose-1-phosphate isomerase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=mri1 PE=3 SV=1 4 376 1.0E-126
sp|C5PBM5|MTNA_COCP7 Methylthioribose-1-phosphate isomerase OS=Coccidioides posadasii (strain C735) GN=MRI1 PE=3 SV=1 2 379 2.0E-125
sp|C5FY68|MTNA_ARTOC Methylthioribose-1-phosphate isomerase OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=MRI1 PE=3 SV=1 4 376 9.0E-125
sp|C0P108|MTNA_AJECG Methylthioribose-1-phosphate isomerase OS=Ajellomyces capsulatus (strain G186AR / H82 / ATCC MYA-2454 / RMSCC 2432) GN=MRI1 PE=3 SV=1 4 376 2.0E-124
sp|A6R364|MTNA_AJECN Methylthioribose-1-phosphate isomerase OS=Ajellomyces capsulatus (strain NAm1 / WU24) GN=MRI1 PE=3 SV=1 4 376 8.0E-124
sp|B6H5R4|MTNA_PENRW Methylthioribose-1-phosphate isomerase OS=Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255) GN=mri1 PE=3 SV=1 4 379 2.0E-123
sp|C4JWQ7|MTNA_UNCRE Methylthioribose-1-phosphate isomerase OS=Uncinocarpus reesii (strain UAMH 1704) GN=MRI1 PE=3 SV=1 2 379 2.0E-122
sp|A1CY38|MTNA_NEOFI Methylthioribose-1-phosphate isomerase OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=mri1 PE=3 SV=1 2 386 3.0E-122
sp|Q2UIM3|MTNA_ASPOR Methylthioribose-1-phosphate isomerase OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=mri1 PE=3 SV=1 4 376 3.0E-120
sp|Q4WNI1|MTNA_ASPFU Methylthioribose-1-phosphate isomerase OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=mri1 PE=3 SV=1 2 386 9.0E-120
sp|B0Y5C3|MTNA_ASPFC Methylthioribose-1-phosphate isomerase OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=mri1 PE=3 SV=1 2 386 9.0E-120
sp|A1CGN9|MTNA_ASPCL Methylthioribose-1-phosphate isomerase OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=mri1 PE=3 SV=1 4 385 4.0E-119
sp|C5JGS0|MTNA_AJEDS Methylthioribose-1-phosphate isomerase OS=Ajellomyces dermatitidis (strain SLH14081) GN=MRI1 PE=3 SV=1 4 376 2.0E-118
sp|C5GGE5|MTNA_AJEDR Methylthioribose-1-phosphate isomerase OS=Ajellomyces dermatitidis (strain ER-3 / ATCC MYA-2586) GN=MRI1 PE=3 SV=1 4 376 2.0E-118
sp|Q6CGS4|MTNA_YARLI Methylthioribose-1-phosphate isomerase OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=MRI1 PE=3 SV=1 4 379 5.0E-118
sp|Q0VFN1|MTNA_XENTR Methylthioribose-1-phosphate isomerase OS=Xenopus tropicalis GN=mri1 PE=2 SV=1 4 367 4.0E-116
sp|Q4FZP2|MTNA_XENLA Methylthioribose-1-phosphate isomerase OS=Xenopus laevis GN=mri1 PE=2 SV=1 4 367 6.0E-116
sp|A7RF00|MTNA_NEMVE Methylthioribose-1-phosphate isomerase OS=Nematostella vectensis GN=v1g237765 PE=3 SV=1 4 364 9.0E-115
sp|A9UQ62|MTNA_MONBE Methylthioribose-1-phosphate isomerase OS=Monosiga brevicollis GN=34861 PE=3 SV=1 1 379 4.0E-114
sp|Q0CFY3|MTNA_ASPTN Methylthioribose-1-phosphate isomerase OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=mri1 PE=3 SV=1 4 376 2.0E-112
sp|Q9CQT1|MTNA_MOUSE Methylthioribose-1-phosphate isomerase OS=Mus musculus GN=Mri1 PE=1 SV=1 4 366 8.0E-111
sp|B4NG41|MTNA_DROWI Methylthioribose-1-phosphate isomerase OS=Drosophila willistoni GN=GK22419 PE=3 SV=1 4 367 1.0E-110
sp|Q948X8|MTNA_TOBAC Methylthioribose-1-phosphate isomerase OS=Nicotiana tabacum GN=CIG2 PE=2 SV=1 4 380 1.0E-110
sp|Q9BV20|MTNA_HUMAN Methylthioribose-1-phosphate isomerase OS=Homo sapiens GN=MRI1 PE=1 SV=1 4 366 9.0E-110
sp|Q5HZE4|MTNA_RAT Methylthioribose-1-phosphate isomerase OS=Rattus norvegicus GN=Mri1 PE=1 SV=1 4 366 1.0E-109
sp|B9HCR2|MTNA_POPTR Methylthioribose-1-phosphate isomerase OS=Populus trichocarpa GN=POPTRDRAFT_832064 PE=3 SV=2 4 380 2.0E-108
sp|B6TZD1|MTNA_MAIZE Methylthioribose-1-phosphate isomerase OS=Zea mays GN=IDI2 PE=2 SV=1 4 380 3.0E-108
sp|Q9ZUG4|MTNA_ARATH Methylthioribose-1-phosphate isomerase OS=Arabidopsis thaliana GN=At2g05830 PE=1 SV=2 4 379 6.0E-108
sp|Q2NL31|MTNA_BOVIN Methylthioribose-1-phosphate isomerase OS=Bos taurus GN=MRI1 PE=2 SV=1 4 366 4.0E-106
sp|B4K8A4|MTNA_DROMO Methylthioribose-1-phosphate isomerase OS=Drosophila mojavensis GN=GI10562 PE=3 SV=1 4 367 7.0E-106
sp|B3M098|MTNA_DROAN Methylthioribose-1-phosphate isomerase OS=Drosophila ananassae GN=GF17194 PE=3 SV=1 4 367 2.0E-105
sp|B3P538|MTNA_DROER Methylthioribose-1-phosphate isomerase OS=Drosophila erecta GN=GG11866 PE=3 SV=1 4 367 3.0E-105
sp|Q0ZB81|MTNA_BOMMO Methylthioribose-1-phosphate isomerase OS=Bombyx mori PE=2 SV=1 4 371 6.0E-105
sp|Q9AYT7|MTNA_HORVU Methylthioribose-1-phosphate isomerase OS=Hordeum vulgare GN=IDI2 PE=2 SV=1 2 380 9.0E-105
sp|B9RR88|MTNA_RICCO Methylthioribose-1-phosphate isomerase OS=Ricinus communis GN=RCOM_0711420 PE=2 SV=1 4 380 1.0E-104
sp|A2ZCP0|MTNA_ORYSI Methylthioribose-1-phosphate isomerase OS=Oryza sativa subsp. indica GN=OsI_35550 PE=2 SV=1 1 380 2.0E-104
sp|O60185|MTNA_SCHPO Methylthioribose-1-phosphate isomerase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mri1 PE=3 SV=1 4 376 4.0E-104
sp|B4PNE2|MTNA_DROYA Methylthioribose-1-phosphate isomerase OS=Drosophila yakuba GN=GE23315 PE=3 SV=1 4 367 6.0E-104
sp|Q9V9X4|MTNA_DROME Methylthioribose-1-phosphate isomerase OS=Drosophila melanogaster GN=CG11334 PE=2 SV=1 4 367 6.0E-104
sp|Q29BB3|MTNA_DROPS Methylthioribose-1-phosphate isomerase OS=Drosophila pseudoobscura pseudoobscura GN=GA10928 PE=3 SV=1 4 367 7.0E-104
sp|Q0ITU1|MTNA_ORYSJ Methylthioribose-1-phosphate isomerase OS=Oryza sativa subsp. japonica GN=IDI2 PE=2 SV=1 1 380 8.0E-104
sp|B4I029|MTNA_DROSE Methylthioribose-1-phosphate isomerase OS=Drosophila sechellia GN=GM12085 PE=3 SV=1 4 367 8.0E-104
sp|B4GYU1|MTNA_DROPE Methylthioribose-1-phosphate isomerase OS=Drosophila persimilis GN=GL27236 PE=3 SV=1 4 367 9.0E-104
sp|B4QSM8|MTNA_DROSI Methylthioribose-1-phosphate isomerase OS=Drosophila simulans GN=GD16414 PE=3 SV=1 4 367 9.0E-104
sp|Q16I17|MTNA_AEDAE Methylthioribose-1-phosphate isomerase OS=Aedes aegypti GN=AAEL013828 PE=3 SV=1 4 367 1.0E-103
sp|A9JRE2|MTNA_DANRE Methylthioribose-1-phosphate isomerase OS=Danio rerio GN=mri1 PE=2 SV=1 4 366 2.0E-103
sp|D7TCD0|MTNA_VITVI Methylthioribose-1-phosphate isomerase OS=Vitis vinifera GN=VIT_11s0016g00830 PE=2 SV=2 4 380 4.0E-103
sp|B4LWZ8|MTNA_DROVI Methylthioribose-1-phosphate isomerase OS=Drosophila virilis GN=GJ22917 PE=3 SV=1 4 367 9.0E-103
sp|B4JRX2|MTNA_DROGR Methylthioribose-1-phosphate isomerase OS=Drosophila grimshawi GN=GH21593 PE=3 SV=1 4 367 6.0E-102
sp|Q7PKS9|MTNA_ANOGA Methylthioribose-1-phosphate isomerase OS=Anopheles gambiae GN=AGAP001589 PE=3 SV=1 4 367 6.0E-101
sp|D2VAA9|MTNA_NAEGR Methylthioribose-1-phosphate isomerase OS=Naegleria gruberi GN=NAEGRDRAFT_32363 PE=3 SV=1 4 366 1.0E-99
sp|B3RLE6|MTNA_TRIAD Methylthioribose-1-phosphate isomerase OS=Trichoplax adhaerens GN=TRIADDRAFT_19292 PE=3 SV=1 4 366 3.0E-99
sp|A4HQ10|MTNA_LEIBR Methylthioribose-1-phosphate isomerase OS=Leishmania braziliensis GN=LbrM35_V2.5180 PE=3 SV=1 4 383 2.0E-97
sp|A3LN21|MTNA_PICST Methylthioribose-1-phosphate isomerase OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=MRI1 PE=3 SV=2 4 376 4.0E-97
sp|C7GXT0|MTNA_YEAS2 Methylthioribose-1-phosphate isomerase OS=Saccharomyces cerevisiae (strain JAY291) GN=MRI1 PE=3 SV=1 4 376 9.0E-97
sp|B8C6V3|MTNA_THAPS Methylthioribose-1-phosphate isomerase OS=Thalassiosira pseudonana GN=THAPSDRAFT_35896 PE=3 SV=1 10 380 1.0E-96
sp|A7TSA5|MTNA_VANPO Methylthioribose-1-phosphate isomerase OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=MRI1 PE=3 SV=1 4 376 1.0E-96
sp|Q06489|MTNA_YEAST Methylthioribose-1-phosphate isomerase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MRI1 PE=1 SV=1 4 376 4.0E-96
sp|C8ZJE0|MTNA_YEAS8 Methylthioribose-1-phosphate isomerase OS=Saccharomyces cerevisiae (strain Lalvin EC1118 / Prise de mousse) GN=MRI1 PE=3 SV=1 4 376 4.0E-96
sp|A6ZWZ9|MTNA_YEAS7 Methylthioribose-1-phosphate isomerase OS=Saccharomyces cerevisiae (strain YJM789) GN=MRI1 PE=3 SV=1 4 376 4.0E-96
sp|B5VTQ8|MTNA_YEAS6 Methylthioribose-1-phosphate isomerase OS=Saccharomyces cerevisiae (strain AWRI1631) GN=MRI1 PE=3 SV=1 4 376 4.0E-96
sp|B3LK82|MTNA_YEAS1 Methylthioribose-1-phosphate isomerase OS=Saccharomyces cerevisiae (strain RM11-1a) GN=MRI1 PE=3 SV=1 4 376 4.0E-96
sp|A4ICE5|MTNA_LEIIN Methylthioribose-1-phosphate isomerase OS=Leishmania infantum GN=LinJ36.0740 PE=3 SV=1 4 382 3.0E-95
sp|C5M614|MTNA_CANTT Methylthioribose-1-phosphate isomerase OS=Candida tropicalis (strain ATCC MYA-3404 / T1) GN=MRI1 PE=3 SV=1 4 376 9.0E-95
sp|Q6BZH5|MTNA_DEBHA Methylthioribose-1-phosphate isomerase OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=MRI1 PE=3 SV=2 4 376 2.0E-94
sp|B9WAG5|MTNA_CANDC Methylthioribose-1-phosphate isomerase OS=Candida dubliniensis (strain CD36 / ATCC MYA-646 / CBS 7987 / NCPF 3949 / NRRL Y-17841) GN=MRI1 PE=3 SV=1 4 376 5.0E-94
sp|C4YC37|MTNA_CLAL4 Methylthioribose-1-phosphate isomerase OS=Clavispora lusitaniae (strain ATCC 42720) GN=MRI1 PE=3 SV=1 4 376 6.0E-94
sp|C5DHL1|MTNA_LACTC Methylthioribose-1-phosphate isomerase OS=Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284) GN=MRI1 PE=3 SV=1 4 379 2.0E-93
sp|Q4Q0R9|MTNA_LEIMA Methylthioribose-1-phosphate isomerase OS=Leishmania major GN=LmjF36.4930 PE=1 SV=2 4 382 2.0E-93
sp|Q5AD59|MTNA_CANAL Methylthioribose-1-phosphate isomerase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=MRI1 PE=3 SV=1 4 376 5.0E-93
sp|C4YJ78|MTNA_CANAW Methylthioribose-1-phosphate isomerase OS=Candida albicans (strain WO-1) GN=MRI1 PE=3 SV=1 4 376 4.0E-92
sp|C5DU12|MTNA_ZYGRC Methylthioribose-1-phosphate isomerase OS=Zygosaccharomyces rouxii (strain ATCC 2623 / CBS 732 / NBRC 1130 / NCYC 568 / NRRL Y-229) GN=MRI1 PE=3 SV=1 4 376 3.0E-91
sp|A5DNT0|MTNA_PICGU Methylthioribose-1-phosphate isomerase OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=MRI1 PE=3 SV=2 1 376 1.0E-90
sp|Q6CQP3|MTNA_KLULA Methylthioribose-1-phosphate isomerase OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=MRI1 PE=3 SV=1 4 376 8.0E-90
sp|A4S068|MTNA_OSTLU Methylthioribose-1-phosphate isomerase OS=Ostreococcus lucimarinus (strain CCE9901) GN=OSTLU_35743 PE=3 SV=1 1 389 2.0E-89
sp|A5DUX4|MTNA_LODEL Methylthioribose-1-phosphate isomerase OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=MRI1 PE=3 SV=1 4 376 2.0E-89
sp|C4QYS6|MTNA_PICPG Methylthioribose-1-phosphate isomerase OS=Komagataella pastoris (strain GS115 / ATCC 20864) GN=MRI1 PE=3 SV=1 4 376 3.0E-89
sp|B8PBR2|MTNA_POSPM Methylthioribose-1-phosphate isomerase OS=Postia placenta (strain ATCC 44394 / Madison 698-R) GN=MRI1 PE=3 SV=1 1 380 2.0E-88
sp|B8GRR4|MTNA_THISH Methylthioribose-1-phosphate isomerase OS=Thioalkalivibrio sulfidiphilus (strain HL-EbGR7) GN=mtnA PE=3 SV=1 4 371 1.0E-86
sp|B6K4Q2|MTNA_SCHJY Methylthioribose-1-phosphate isomerase OS=Schizosaccharomyces japonicus (strain yFS275 / FY16936) GN=mri1 PE=3 SV=1 4 372 2.0E-85
sp|A4XKS3|MTNA_CALS8 Methylthioribose-1-phosphate isomerase OS=Caldicellulosiruptor saccharolyticus (strain ATCC 43494 / DSM 8903 / Tp8T 6331) GN=mtnA PE=3 SV=1 4 366 3.0E-85
sp|Q75EI1|MTNA_ASHGO Methylthioribose-1-phosphate isomerase OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=MRI1 PE=3 SV=1 4 376 4.0E-84
sp|B0D0U4|MTNA_LACBS Methylthioribose-1-phosphate isomerase OS=Laccaria bicolor (strain S238N-H82 / ATCC MYA-4686) GN=MRI1 PE=3 SV=1 4 376 6.0E-84
sp|Q87A92|MTNA_XYLFT Methylthioribose-1-phosphate isomerase OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=mtnA PE=3 SV=1 14 373 2.0E-83
sp|B2I9S0|MTNA_XYLF2 Methylthioribose-1-phosphate isomerase OS=Xylella fastidiosa (strain M23) GN=mtnA PE=3 SV=1 14 373 2.0E-83
sp|Q3BV11|MTNA_XANC5 Methylthioribose-1-phosphate isomerase OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) GN=mtnA PE=3 SV=1 9 371 5.0E-83
sp|Q8PM04|MTNA_XANAC Methylthioribose-1-phosphate isomerase OS=Xanthomonas axonopodis pv. citri (strain 306) GN=mtnA PE=3 SV=1 9 371 7.0E-83
sp|B0U5G3|MTNA_XYLFM Methylthioribose-1-phosphate isomerase OS=Xylella fastidiosa (strain M12) GN=mtnA PE=3 SV=1 14 373 1.0E-82
sp|Q9PAG5|MTNA_XYLFA Methylthioribose-1-phosphate isomerase OS=Xylella fastidiosa (strain 9a5c) GN=mtnA PE=3 SV=1 14 373 2.0E-82
sp|Q0VPK6|MTNA_ALCBS Methylthioribose-1-phosphate isomerase OS=Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2) GN=mtnA PE=3 SV=1 6 371 5.0E-82
sp|D0A8W2|MTNA_TRYB9 Methylthioribose-1-phosphate isomerase OS=Trypanosoma brucei gambiense (strain MHOM/CI/86/DAL972) GN=TbgDal_XI12320 PE=3 SV=1 4 380 5.0E-82
sp|Q383H9|MTNA_TRYB2 Methylthioribose-1-phosphate isomerase OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) GN=Tb11.01.2780 PE=3 SV=1 4 380 6.0E-82
sp|A8XDI8|MTNA_CAEBR Methylthioribose-1-phosphate isomerase OS=Caenorhabditis briggsae GN=CBG11572 PE=3 SV=1 4 364 1.0E-81
sp|Q5H060|MTNA_XANOR Methylthioribose-1-phosphate isomerase OS=Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85) GN=mtnA PE=3 SV=2 9 371 1.0E-81
sp|B2SIW1|MTNA_XANOP Methylthioribose-1-phosphate isomerase OS=Xanthomonas oryzae pv. oryzae (strain PXO99A) GN=mtnA PE=3 SV=1 9 371 1.0E-81
sp|Q2P337|MTNA_XANOM Methylthioribose-1-phosphate isomerase OS=Xanthomonas oryzae pv. oryzae (strain MAFF 311018) GN=mtnA PE=3 SV=1 9 371 1.0E-81
sp|Q9HZ65|MTNA_PSEAE Methylthioribose-1-phosphate isomerase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=mtnA PE=3 SV=1 4 371 2.0E-81
sp|Q02PX5|MTNA_PSEAB Methylthioribose-1-phosphate isomerase OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=mtnA PE=3 SV=1 4 371 2.0E-81
sp|B7V9J7|MTNA_PSEA8 Methylthioribose-1-phosphate isomerase OS=Pseudomonas aeruginosa (strain LESB58) GN=mtnA PE=3 SV=1 4 371 2.0E-81
sp|Q48FM6|MTNA_PSE14 Methylthioribose-1-phosphate isomerase OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=mtnA PE=3 SV=1 4 371 5.0E-81
sp|Q4ZQ92|MTNA_PSEU2 Methylthioribose-1-phosphate isomerase OS=Pseudomonas syringae pv. syringae (strain B728a) GN=mtnA PE=3 SV=2 4 371 1.0E-80
sp|Q8PAB2|MTNA_XANCP Methylthioribose-1-phosphate isomerase OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=mtnA PE=3 SV=1 9 371 1.0E-80
sp|B0RUX9|MTNA_XANCB Methylthioribose-1-phosphate isomerase OS=Xanthomonas campestris pv. campestris (strain B100) GN=mtnA PE=3 SV=2 9 371 1.0E-80
sp|Q4UTB3|MTNA_XANC8 Methylthioribose-1-phosphate isomerase OS=Xanthomonas campestris pv. campestris (strain 8004) GN=mtnA PE=3 SV=1 9 371 1.0E-80
sp|Q93169|MTNA_CAEEL Methylthioribose-1-phosphate isomerase OS=Caenorhabditis elegans GN=C01G10.9 PE=3 SV=1 4 382 2.0E-80
sp|A4VLZ8|MTNA_PSEU5 Methylthioribose-1-phosphate isomerase OS=Pseudomonas stutzeri (strain A1501) GN=mtnA PE=3 SV=2 4 368 2.0E-80
sp|Q4D6B2|MTNA2_TRYCC Methylthioribose-1-phosphate isomerase 2 OS=Trypanosoma cruzi (strain CL Brener) GN=Tc00.1047053508269.30 PE=3 SV=1 4 374 3.0E-80
sp|Q6FVY2|MTNA_CANGA Methylthioribose-1-phosphate isomerase OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=MRI1 PE=3 SV=1 1 376 3.0E-80
sp|Q606P2|MTNA_METCA Methylthioribose-1-phosphate isomerase OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) GN=mtnA PE=3 SV=1 1 371 3.0E-80
sp|Q4CY36|MTNA1_TRYCC Methylthioribose-1-phosphate isomerase 1 OS=Trypanosoma cruzi (strain CL Brener) GN=Tc00.1047053503971.40 PE=3 SV=1 4 374 4.0E-80
sp|Q885T7|MTNA_PSESM Methylthioribose-1-phosphate isomerase OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=mtnA PE=3 SV=1 4 371 7.0E-80
sp|P0CN41|MTNA_CRYNB Methylthioribose-1-phosphate isomerase OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=MRI1 PE=3 SV=1 12 368 3.0E-79
sp|P0CN40|MTNA_CRYNJ Methylthioribose-1-phosphate isomerase OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=MRI1 PE=3 SV=1 12 368 4.0E-79
sp|A3DD27|MTNA_CLOTH Methylthioribose-1-phosphate isomerase OS=Clostridium thermocellum (strain ATCC 27405 / DSM 1237 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) GN=mtnA PE=3 SV=1 1 366 6.0E-79
sp|A6V2Q6|MTNA_PSEA7 Methylthioribose-1-phosphate isomerase OS=Pseudomonas aeruginosa (strain PA7) GN=mtnA PE=3 SV=1 4 371 6.0E-79
sp|Q3K8T8|MTNA_PSEPF Methylthioribose-1-phosphate isomerase OS=Pseudomonas fluorescens (strain Pf0-1) GN=mtnA PE=3 SV=1 4 371 2.0E-78
sp|B9LBK4|MTNA_CHLSY Methylthioribose-1-phosphate isomerase OS=Chloroflexus aurantiacus (strain ATCC 29364 / DSM 637 / Y-400-fl) GN=mtnA PE=3 SV=1 4 366 3.0E-78
sp|A9WGQ8|MTNA_CHLAA Methylthioribose-1-phosphate isomerase OS=Chloroflexus aurantiacus (strain ATCC 29366 / DSM 635 / J-10-fl) GN=mtnA PE=3 SV=1 4 366 3.0E-78
sp|Q2SE63|MTNA_HAHCH Methylthioribose-1-phosphate isomerase OS=Hahella chejuensis (strain KCTC 2396) GN=mtnA PE=3 SV=1 2 366 3.0E-78
sp|B2J5P6|MTNA_NOSP7 Methylthioribose-1-phosphate isomerase OS=Nostoc punctiforme (strain ATCC 29133 / PCC 73102) GN=mtnA PE=3 SV=1 7 380 4.0E-78
sp|B1WQH2|MTNA_CYAA5 Methylthioribose-1-phosphate isomerase OS=Cyanothece sp. (strain ATCC 51142) GN=mtnA PE=3 SV=2 1 366 6.0E-78
sp|C1DRQ7|MTNA_AZOVD Methylthioribose-1-phosphate isomerase OS=Azotobacter vinelandii (strain DJ / ATCC BAA-1303) GN=mtnA PE=3 SV=1 4 368 2.0E-77
sp|A6LJM7|MTNA_THEM4 Methylthioribose-1-phosphate isomerase OS=Thermosipho melanesiensis (strain DSM 12029 / CIP 104789 / BI429) GN=mtnA PE=3 SV=1 7 366 4.0E-76
sp|B1I2P1|MTNA_DESAP Methylthioribose-1-phosphate isomerase OS=Desulforudis audaxviator (strain MP104C) GN=mtnA PE=3 SV=1 3 373 5.0E-76
sp|A4J678|MTNA_DESRM Methylthioribose-1-phosphate isomerase OS=Desulfotomaculum reducens (strain MI-1) GN=mtnA PE=3 SV=1 4 366 9.0E-76
sp|B7IFW5|MTNA_THEAB Methylthioribose-1-phosphate isomerase OS=Thermosipho africanus (strain TCF52B) GN=mtnA PE=3 SV=1 7 366 1.0E-75
sp|Q39ZK3|MTNA_GEOMG Methylthioribose-1-phosphate isomerase OS=Geobacter metallireducens (strain GS-15 / ATCC 53774 / DSM 7210) GN=mtnA PE=3 SV=1 4 366 2.0E-75
sp|A7Z3X0|MTNA_BACMF Methylthioribose-1-phosphate isomerase OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=mtnA PE=3 SV=1 6 366 2.0E-75
sp|B8FRM1|MTNA_DESHD Methylthioribose-1-phosphate isomerase OS=Desulfitobacterium hafniense (strain DCB-2 / DSM 10664) GN=mtnA PE=3 SV=1 4 366 6.0E-75
sp|C5D7U5|MTNA_GEOSW Methylthioribose-1-phosphate isomerase OS=Geobacillus sp. (strain WCH70) GN=mtnA PE=3 SV=1 6 366 8.0E-75
sp|Q8YR82|MTNA_NOSS1 Methylthioribose-1-phosphate isomerase OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=mtnA PE=3 SV=1 7 364 8.0E-75
sp|Q746Y8|MTNA_GEOSL Methylthioribose-1-phosphate isomerase OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) GN=mtnA PE=3 SV=1 4 366 2.0E-74
sp|Q053E2|MTNA_LEPBL Methylthioribose-1-phosphate isomerase OS=Leptospira borgpetersenii serovar Hardjo-bovis (strain L550) GN=mtnA PE=3 SV=1 2 366 2.0E-74
sp|Q04RD6|MTNA_LEPBJ Methylthioribose-1-phosphate isomerase OS=Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) GN=mtnA PE=3 SV=1 2 366 2.0E-74
sp|A5G9J7|MTNA_GEOUR Methylthioribose-1-phosphate isomerase OS=Geobacter uraniireducens (strain Rf4) GN=mtnA PE=3 SV=1 4 366 3.0E-74
sp|A1ALC1|MTNA_PELPD Methylthioribose-1-phosphate isomerase OS=Pelobacter propionicus (strain DSM 2379) GN=mtnA PE=3 SV=1 4 366 3.0E-74
sp|Q24UA0|MTNA_DESHY Methylthioribose-1-phosphate isomerase OS=Desulfitobacterium hafniense (strain Y51) GN=mtnA PE=3 SV=1 4 366 4.0E-74
sp|B2FKI7|MTNA_STRMK Methylthioribose-1-phosphate isomerase OS=Stenotrophomonas maltophilia (strain K279a) GN=mtnA PE=3 SV=1 4 366 4.0E-74
sp|A5D1G8|MTNA_PELTS Methylthioribose-1-phosphate isomerase OS=Pelotomaculum thermopropionicum (strain DSM 13744 / JCM 10971 / SI) GN=mtnA PE=3 SV=1 12 374 4.0E-74
sp|A8YD90|MTNA_MICAE Methylthioribose-1-phosphate isomerase OS=Microcystis aeruginosa GN=mtnA PE=3 SV=1 7 366 4.0E-74
sp|B4SP84|MTNA_STRM5 Methylthioribose-1-phosphate isomerase OS=Stenotrophomonas maltophilia (strain R551-3) GN=mtnA PE=3 SV=1 4 366 5.0E-74
sp|B9LZ20|MTNA_GEODF Methylthioribose-1-phosphate isomerase OS=Geobacter daltonii (strain DSM 22248 / JCM 15807 / FRC-32) GN=mtnA PE=3 SV=1 4 366 6.0E-74
sp|C0QUC0|MTNA_PERMH Methylthioribose-1-phosphate isomerase OS=Persephonella marina (strain DSM 14350 / EX-H1) GN=mtnA PE=3 SV=1 13 366 7.0E-74
sp|A1U3J9|MTNA_MARHV Methylthioribose-1-phosphate isomerase OS=Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8) GN=mtnA PE=3 SV=1 6 368 7.0E-74
sp|B0JPT8|MTNA_MICAN Methylthioribose-1-phosphate isomerase OS=Microcystis aeruginosa (strain NIES-843) GN=mtnA PE=3 SV=1 7 366 8.0E-74
sp|Q3M785|MTNA_ANAVT Methylthioribose-1-phosphate isomerase OS=Anabaena variabilis (strain ATCC 29413 / PCC 7937) GN=mtnA PE=3 SV=1 7 364 1.0E-73
sp|O31662|MTNA_BACSU Methylthioribose-1-phosphate isomerase OS=Bacillus subtilis (strain 168) GN=mtnA PE=1 SV=1 6 366 2.0E-73
sp|A8F3A3|MTNA1_PSELT Methylthioribose-1-phosphate isomerase 1 OS=Pseudothermotoga lettingae (strain ATCC BAA-301 / DSM 14385 / NBRC 107922 / TMO) GN=mtnA1 PE=3 SV=1 7 366 5.0E-73
sp|B0K2V6|MTNA_THEPX Methylthioribose-1-phosphate isomerase OS=Thermoanaerobacter sp. (strain X514) GN=mtnA PE=3 SV=1 1 367 8.0E-73
sp|B0K8S2|MTNA_THEP3 Methylthioribose-1-phosphate isomerase OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) GN=mtnA PE=3 SV=1 1 367 8.0E-73
sp|Q3ABU6|MTNA_CARHZ Methylthioribose-1-phosphate isomerase OS=Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901) GN=mtnA PE=3 SV=1 4 366 1.0E-72
sp|Q65KK2|MTNA_BACLD Methylthioribose-1-phosphate isomerase OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=mtnA PE=3 SV=1 6 366 2.0E-72
sp|B2A5S2|MTNA_NATTJ Methylthioribose-1-phosphate isomerase OS=Natranaerobius thermophilus (strain ATCC BAA-1301 / DSM 18059 / JW/NM-WN-LF) GN=mtnA PE=3 SV=1 1 372 3.0E-72
sp|Q3ZZT1|MTNA_DEHMC Methylthioribose-1-phosphate isomerase OS=Dehalococcoides mccartyi (strain CBDB1) GN=mtnA PE=3 SV=1 4 369 3.0E-72
sp|A5FRU8|MTNA_DEHMB Methylthioribose-1-phosphate isomerase OS=Dehalococcoides mccartyi (strain ATCC BAA-2100 / JCM 16839 / KCTC 5957 / BAV1) GN=mtnA PE=3 SV=1 4 369 4.0E-72
sp|Q8R9L7|MTNA_CALS4 Methylthioribose-1-phosphate isomerase OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=mtnA PE=3 SV=1 1 366 6.0E-72
sp|P74497|MTNA_SYNY3 Methylthioribose-1-phosphate isomerase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=mtnA PE=3 SV=1 7 376 9.0E-72
sp|Q21S04|MTNA_RHOFT Methylthioribose-1-phosphate isomerase OS=Rhodoferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118) GN=mtnA PE=3 SV=1 4 392 1.0E-71
sp|B2V8N9|MTNA_SULSY Methylthioribose-1-phosphate isomerase OS=Sulfurihydrogenibium sp. (strain YO3AOP1) GN=mtnA PE=3 SV=1 14 368 2.0E-71
sp|Q5N076|MTNA_SYNP6 Methylthioribose-1-phosphate isomerase OS=Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1) GN=mtnA PE=3 SV=1 1 366 3.0E-71
sp|Q31LP7|MTNA_SYNE7 Methylthioribose-1-phosphate isomerase OS=Synechococcus elongatus (strain PCC 7942) GN=mtnA PE=3 SV=1 1 366 3.0E-71
sp|Q3Z937|MTNA_DEHM1 Methylthioribose-1-phosphate isomerase OS=Dehalococcoides mccartyi (strain ATCC BAA-2266 / KCTC 15142 / 195) GN=mtnA PE=3 SV=1 4 368 4.0E-71
sp|B1IJF0|MTNA_CLOBK Methylthioribose-1-phosphate isomerase OS=Clostridium botulinum (strain Okra / Type B1) GN=mtnA PE=3 SV=1 1 366 7.0E-71
sp|A7HIG6|MTNA_ANADF Methylthioribose-1-phosphate isomerase OS=Anaeromyxobacter sp. (strain Fw109-5) GN=mtnA PE=3 SV=1 2 368 7.0E-71
sp|B1KZY3|MTNA_CLOBM Methylthioribose-1-phosphate isomerase OS=Clostridium botulinum (strain Loch Maree / Type A3) GN=mtnA PE=3 SV=1 1 366 7.0E-71
sp|A4XTE5|MTNA_PSEMY Methylthioribose-1-phosphate isomerase OS=Pseudomonas mendocina (strain ymp) GN=mtnA PE=3 SV=1 4 373 7.0E-71
sp|B1YIY4|MTNA_EXIS2 Methylthioribose-1-phosphate isomerase OS=Exiguobacterium sibiricum (strain DSM 17290 / JCM 13490 / 255-15) GN=mtnA PE=3 SV=1 4 371 7.0E-71
sp|Q8DK09|MTNA_THEEB Methylthioribose-1-phosphate isomerase OS=Thermosynechococcus elongatus (strain BP-1) GN=mtnA PE=3 SV=1 7 366 9.0E-71
sp|A7NFR2|MTNA_ROSCS Methylthioribose-1-phosphate isomerase OS=Roseiflexus castenholzii (strain DSM 13941 / HLO8) GN=mtnA PE=3 SV=1 2 366 9.0E-71
sp|Q7NP62|MTNA_GLOVI Methylthioribose-1-phosphate isomerase OS=Gloeobacter violaceus (strain PCC 7421) GN=mtnA PE=3 SV=1 2 369 1.0E-70
sp|A5UQK6|MTNA_ROSS1 Methylthioribose-1-phosphate isomerase OS=Roseiflexus sp. (strain RS-1) GN=mtnA PE=3 SV=1 2 366 3.0E-70
sp|Q1ISH2|MTNA_KORVE Methylthioribose-1-phosphate isomerase OS=Koribacter versatilis (strain Ellin345) GN=mtnA PE=3 SV=1 2 374 3.0E-70
sp|Q4K8M6|MTNA_PSEF5 Methylthioribose-1-phosphate isomerase OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=mtnA PE=3 SV=1 4 371 3.0E-70
sp|A5I1A6|MTNA_CLOBH Methylthioribose-1-phosphate isomerase OS=Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A) GN=mtnA PE=3 SV=1 1 366 4.0E-70
sp|A7FTE6|MTNA_CLOB1 Methylthioribose-1-phosphate isomerase OS=Clostridium botulinum (strain ATCC 19397 / Type A) GN=mtnA PE=3 SV=1 1 366 4.0E-70
sp|Q9X013|MTNA_THEMA Methylthioribose-1-phosphate isomerase OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=mtnA PE=1 SV=1 5 366 5.0E-70
sp|Q028S4|MTNA_SOLUE Methylthioribose-1-phosphate isomerase OS=Solibacter usitatus (strain Ellin6076) GN=mtnA PE=3 SV=1 4 365 5.0E-70
sp|Q0AYV4|MTNA_SYNWW Methylthioribose-1-phosphate isomerase OS=Syntrophomonas wolfei subsp. wolfei (strain DSM 2245B / Goettingen) GN=mtnA PE=3 SV=1 9 373 6.0E-70
sp|B1LC23|MTNA_THESQ Methylthioribose-1-phosphate isomerase OS=Thermotoga sp. (strain RQ2) GN=mtnA PE=3 SV=1 5 366 7.0E-70
sp|A5IIM2|MTNA_THEP1 Methylthioribose-1-phosphate isomerase OS=Thermotoga petrophila (strain RKU-1 / ATCC BAA-488 / DSM 13995) GN=mtnA PE=3 SV=1 5 366 7.0E-70
sp|C6E6Z4|MTNA_GEOSM Methylthioribose-1-phosphate isomerase OS=Geobacter sp. (strain M21) GN=mtnA PE=3 SV=1 4 366 8.0E-70
sp|A8FCG5|MTNA_BACP2 Methylthioribose-1-phosphate isomerase OS=Bacillus pumilus (strain SAFR-032) GN=mtnA PE=3 SV=1 6 366 9.0E-70
sp|B9KA57|MTNA_THENN Methylthioribose-1-phosphate isomerase OS=Thermotoga neapolitana (strain ATCC 49049 / DSM 4359 / NS-E) GN=mtnA PE=3 SV=1 5 367 2.0E-69
sp|Q2LXN1|MTNA_SYNAS Methylthioribose-1-phosphate isomerase OS=Syntrophus aciditrophicus (strain SB) GN=mtnA PE=3 SV=1 7 375 2.0E-69
sp|A9BHC5|MTNA2_PETMO Methylthioribose-1-phosphate isomerase 2 OS=Petrotoga mobilis (strain DSM 10674 / SJ95) GN=mtnA2 PE=3 SV=1 7 366 3.0E-69
sp|B3E3M5|MTNA_GEOLS Methylthioribose-1-phosphate isomerase OS=Geobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ) GN=mtnA PE=3 SV=1 4 365 3.0E-69
sp|A8F7V1|MTNA2_PSELT Methylthioribose-1-phosphate isomerase 2 OS=Pseudothermotoga lettingae (strain ATCC BAA-301 / DSM 14385 / NBRC 107922 / TMO) GN=mtnA2 PE=3 SV=1 1 366 3.0E-69
sp|A7HN79|MTNA_FERNB Methylthioribose-1-phosphate isomerase OS=Fervidobacterium nodosum (strain ATCC 35602 / DSM 5306 / Rt17-B1) GN=mtnA PE=3 SV=1 7 366 3.0E-69
sp|B1XJK0|MTNA_SYNP2 Methylthioribose-1-phosphate isomerase OS=Synechococcus sp. (strain ATCC 27264 / PCC 7002 / PR-6) GN=mtnA PE=3 SV=2 4 371 8.0E-69
sp|C1FKZ3|MTNA_CLOBJ Methylthioribose-1-phosphate isomerase OS=Clostridium botulinum (strain Kyoto / Type A2) GN=mtnA PE=3 SV=1 1 366 9.0E-69
sp|B5ED21|MTNA_GEOBB Methylthioribose-1-phosphate isomerase OS=Geobacter bemidjiensis (strain Bem / ATCC BAA-1014 / DSM 16622) GN=mtnA PE=3 SV=1 4 366 1.0E-68
sp|A4ILL1|MTNA_GEOTN Methylthioribose-1-phosphate isomerase OS=Geobacillus thermodenitrificans (strain NG80-2) GN=mtnA PE=3 SV=1 6 366 1.0E-68
sp|A0L909|MTNA_MAGMM Methylthioribose-1-phosphate isomerase OS=Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1) GN=mtnA PE=3 SV=1 16 371 2.0E-68
sp|Q72T46|MTNA_LEPIC Methylthioribose-1-phosphate isomerase OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130) GN=mtnA PE=3 SV=1 2 366 4.0E-68
sp|B0C8J2|MTNA_ACAM1 Methylthioribose-1-phosphate isomerase OS=Acaryochloris marina (strain MBIC 11017) GN=mtnA PE=3 SV=1 2 369 4.0E-68
sp|Q8F2A8|MTNA_LEPIN Methylthioribose-1-phosphate isomerase OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601) GN=mtnA PE=3 SV=1 2 366 4.0E-68
sp|Q1IDA4|MTNA_PSEE4 Methylthioribose-1-phosphate isomerase OS=Pseudomonas entomophila (strain L48) GN=mtnA PE=3 SV=1 7 373 6.0E-68
sp|Q731R7|MTNA_BACC1 Methylthioribose-1-phosphate isomerase OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=mtnA PE=3 SV=1 6 366 6.0E-68
sp|B5YGA0|MTNA_THEYD Methylthioribose-1-phosphate isomerase OS=Thermodesulfovibrio yellowstonii (strain ATCC 51303 / DSM 11347 / YP87) GN=mtnA PE=3 SV=1 1 367 6.0E-68
sp|A7GCV8|MTNA_CLOBL Methylthioribose-1-phosphate isomerase OS=Clostridium botulinum (strain Langeland / NCTC 10281 / Type F) GN=mtnA PE=3 SV=1 1 366 6.0E-68
sp|Q113K5|MTNA_TRIEI Methylthioribose-1-phosphate isomerase OS=Trichodesmium erythraeum (strain IMS101) GN=mtnA PE=3 SV=1 7 380 8.0E-68
sp|Q2RKL8|MTNA_MOOTA Methylthioribose-1-phosphate isomerase OS=Moorella thermoacetica (strain ATCC 39073) GN=mtnA PE=3 SV=1 2 366 9.0E-68
sp|C3KTV5|MTNA_CLOB6 Methylthioribose-1-phosphate isomerase OS=Clostridium botulinum (strain 657 / Type Ba4) GN=mtnA PE=3 SV=1 1 366 1.0E-67
sp|Q81MJ6|MTNA2_BACAN Methylthioribose-1-phosphate isomerase 2 OS=Bacillus anthracis GN=mtnA2 PE=3 SV=1 6 366 2.0E-67
sp|Q0AA70|MTNA_ALKEH Methylthioribose-1-phosphate isomerase OS=Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1) GN=mtnA PE=3 SV=1 4 366 4.0E-67
sp|Q6HED3|MTNA2_BACHK Methylthioribose-1-phosphate isomerase 2 OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=mtnA2 PE=3 SV=1 6 366 4.0E-67
sp|Q3J8U5|MTNA_NITOC Methylthioribose-1-phosphate isomerase OS=Nitrosococcus oceani (strain ATCC 19707 / NCIMB 11848) GN=mtnA PE=3 SV=1 4 368 4.0E-67
sp|A9VFD5|MTNA2_BACWK Methylthioribose-1-phosphate isomerase 2 OS=Bacillus weihenstephanensis (strain KBAB4) GN=mtnA2 PE=3 SV=1 6 366 5.0E-67
sp|A0RI38|MTNA2_BACAH Methylthioribose-1-phosphate isomerase 2 OS=Bacillus thuringiensis (strain Al Hakam) GN=mtnA2 PE=3 SV=1 6 366 6.0E-67
sp|Q635P7|MTNA2_BACCZ Methylthioribose-1-phosphate isomerase 2 OS=Bacillus cereus (strain ZK / E33L) GN=mtnA2 PE=3 SV=1 6 366 1.0E-66
sp|Q317L9|MTNA_DESAG Methylthioribose-1-phosphate isomerase OS=Desulfovibrio alaskensis (strain G20) GN=mtnA PE=3 SV=1 7 366 1.0E-66
sp|A9VRK3|MTNA1_BACWK Methylthioribose-1-phosphate isomerase 1 OS=Bacillus weihenstephanensis (strain KBAB4) GN=mtnA1 PE=3 SV=2 7 366 2.0E-66
sp|B0TH58|MTNA_HELMI Methylthioribose-1-phosphate isomerase OS=Heliobacterium modesticaldum (strain ATCC 51547 / Ice1) GN=mtnA PE=3 SV=1 4 366 2.0E-66
sp|Q819F2|MTNA2_BACCR Methylthioribose-1-phosphate isomerase 2 OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=mtnA2 PE=3 SV=1 6 366 2.0E-66
sp|Q67MP0|MTNA_SYMTH Methylthioribose-1-phosphate isomerase OS=Symbiobacterium thermophilum (strain T / IAM 14863) GN=mtnA PE=3 SV=1 14 365 6.0E-66
sp|Q3A2J8|MTNA_PELCD Methylthioribose-1-phosphate isomerase OS=Pelobacter carbinolicus (strain DSM 2380 / Gra Bd 1) GN=mtnA PE=3 SV=1 4 366 1.0E-65
sp|A9AYL1|MTNA_HERA2 Methylthioribose-1-phosphate isomerase OS=Herpetosiphon aurantiacus (strain ATCC 23779 / DSM 785) GN=mtnA PE=3 SV=2 16 365 3.0E-65
sp|A1WUJ7|MTNA_HALHL Methylthioribose-1-phosphate isomerase OS=Halorhodospira halophila (strain DSM 244 / SL1) GN=mtnA PE=3 SV=1 4 371 5.0E-65
sp|C6C0F7|MTNA_DESAD Methylthioribose-1-phosphate isomerase OS=Desulfovibrio salexigens (strain ATCC 14822 / DSM 2638 / NCIB 8403 / VKM B-1763) GN=mtnA PE=3 SV=1 5 366 9.0E-65
sp|A9KIE9|MTNA_CLOPH Methylthioribose-1-phosphate isomerase OS=Clostridium phytofermentans (strain ATCC 700394 / DSM 18823 / ISDg) GN=mtnA PE=3 SV=1 14 370 1.0E-64
sp|B0SNY3|MTNA_LEPBP Methylthioribose-1-phosphate isomerase OS=Leptospira biflexa serovar Patoc (strain Patoc 1 / ATCC 23582 / Paris) GN=mtnA PE=3 SV=1 7 383 1.0E-64
sp|B0SFD6|MTNA_LEPBA Methylthioribose-1-phosphate isomerase OS=Leptospira biflexa serovar Patoc (strain Patoc 1 / Ames) GN=mtnA PE=3 SV=1 7 383 1.0E-64
sp|B8J4S7|MTNA_DESDA Methylthioribose-1-phosphate isomerase OS=Desulfovibrio desulfuricans (strain ATCC 27774 / DSM 6949) GN=mtnA PE=3 SV=1 13 366 1.0E-64
sp|A1VHH2|MTNA_DESVV Methylthioribose-1-phosphate isomerase OS=Desulfovibrio vulgaris subsp. vulgaris (strain DP4) GN=mtnA PE=3 SV=1 14 366 3.0E-64
sp|Q72FX9|MTNA_DESVH Methylthioribose-1-phosphate isomerase OS=Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / NCIMB 8303) GN=mtnA PE=3 SV=1 14 366 3.0E-64
sp|A8GAB1|MTNA_SERP5 Methylthioribose-1-phosphate isomerase OS=Serratia proteamaculans (strain 568) GN=mtnA PE=3 SV=1 6 366 5.0E-64
sp|B8DQQ9|MTNA_DESVM Methylthioribose-1-phosphate isomerase OS=Desulfovibrio vulgaris (strain Miyazaki F / DSM 19637) GN=mtnA PE=3 SV=1 14 366 8.0E-64
sp|B1J5G5|MTNA_PSEPW Methylthioribose-1-phosphate isomerase OS=Pseudomonas putida (strain W619) GN=mtnA PE=3 SV=1 7 371 9.0E-64
sp|Q57896|MTNA_METJA Putative methylthioribose-1-phosphate isomerase OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ0454 PE=3 SV=1 10 376 9.0E-64
sp|Q5L1E6|MTNA_GEOKA Methylthioribose-1-phosphate isomerase OS=Geobacillus kaustophilus (strain HTA426) GN=mtnA PE=3 SV=1 6 366 2.0E-63
sp|Q63GN3|MTNA1_BACCZ Methylthioribose-1-phosphate isomerase 1 OS=Bacillus cereus (strain ZK / E33L) GN=mtnA1 PE=3 SV=2 7 370 2.0E-63
sp|Q81ZC2|MTNA1_BACAN Methylthioribose-1-phosphate isomerase 1 OS=Bacillus anthracis GN=mtnA1 PE=3 SV=1 7 370 2.0E-63
sp|A0R946|MTNA1_BACAH Methylthioribose-1-phosphate isomerase 1 OS=Bacillus thuringiensis (strain Al Hakam) GN=mtnA1 PE=3 SV=2 7 370 2.0E-63
sp|O58433|MTNA_PYRHO Putative methylthioribose-1-phosphate isomerase OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=PH0702 PE=3 SV=1 7 366 3.0E-63
sp|Q6HP54|MTNA1_BACHK Methylthioribose-1-phosphate isomerase 1 OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=mtnA1 PE=3 SV=2 7 370 4.0E-63
sp|Q72JR1|MTNA_THET2 Methylthioribose-1-phosphate isomerase OS=Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) GN=mtnA PE=3 SV=1 12 366 4.0E-63
sp|A9BJF6|MTNA1_PETMO Methylthioribose-1-phosphate isomerase 1 OS=Petrotoga mobilis (strain DSM 10674 / SJ95) GN=mtnA1 PE=3 SV=2 11 366 6.0E-63
sp|Q81IK7|MTNA1_BACCR Methylthioribose-1-phosphate isomerase 1 OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=mtnA1 PE=3 SV=2 7 370 1.0E-62
sp|A8ANI3|MTNA_CITK8 Methylthioribose-1-phosphate isomerase OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=mtnA PE=3 SV=1 6 366 1.0E-62
sp|A4W7Z1|MTNA_ENT38 Methylthioribose-1-phosphate isomerase OS=Enterobacter sp. (strain 638) GN=mtnA PE=3 SV=1 6 366 2.0E-62
sp|A7GS56|MTNA_BACCN Methylthioribose-1-phosphate isomerase OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=mtnA PE=3 SV=1 6 367 2.0E-62
sp|Q5SJE2|MTNA_THET8 Methylthioribose-1-phosphate isomerase OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=mtnA PE=3 SV=1 12 366 3.0E-62
sp|A6ULQ4|MTNA_SINMW Methylthioribose-1-phosphate isomerase OS=Sinorhizobium medicae (strain WSM419) GN=mtnA PE=3 SV=1 16 383 4.0E-62
sp|B0KTX5|MTNA_PSEPG Methylthioribose-1-phosphate isomerase OS=Pseudomonas putida (strain GB-1) GN=mtnA PE=3 SV=1 6 371 4.0E-62
sp|Q8U178|MTNA_PYRFU Putative methylthioribose-1-phosphate isomerase OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=PF1349 PE=3 SV=1 6 366 5.0E-62
sp|Q88M09|MTNA_PSEPK Methylthioribose-1-phosphate isomerase OS=Pseudomonas putida (strain KT2440) GN=mtnA PE=3 SV=1 6 373 8.0E-62
sp|Q3AWF5|MTNA_SYNS9 Methylthioribose-1-phosphate isomerase OS=Synechococcus sp. (strain CC9902) GN=mtnA PE=3 SV=1 1 367 1.0E-61
sp|A9FD66|MTNA_SORC5 Methylthioribose-1-phosphate isomerase OS=Sorangium cellulosum (strain So ce56) GN=mtnA PE=3 SV=2 14 364 2.0E-61
sp|A6LE92|MTNA_PARD8 Methylthioribose-1-phosphate isomerase OS=Parabacteroides distasonis (strain ATCC 8503 / DSM 20701 / NCTC 11152) GN=mtnA PE=3 SV=2 14 369 3.0E-61
sp|Q7UF90|MTNA_RHOBA Methylthioribose-1-phosphate isomerase OS=Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1) GN=mtnA PE=3 SV=1 1 371 3.0E-61
sp|O67879|MTNA_AQUAE Methylthioribose-1-phosphate isomerase OS=Aquifex aeolicus (strain VF5) GN=mtnA PE=3 SV=1 9 367 4.0E-61
sp|A1JP09|MTNA_YERE8 Methylthioribose-1-phosphate isomerase OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=mtnA PE=3 SV=1 6 369 1.0E-60
sp|A5W7G2|MTNA_PSEP1 Methylthioribose-1-phosphate isomerase OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=mtnA PE=3 SV=1 6 371 6.0E-60
sp|B8ES44|MTNA_METSB Methylthioribose-1-phosphate isomerase OS=Methylocella silvestris (strain BL2 / DSM 15510 / NCIMB 13906) GN=mtnA PE=3 SV=1 16 367 8.0E-60
sp|Q9UZ16|MTNA_PYRAB Putative methylthioribose-1-phosphate isomerase OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=aIF-2BI PE=3 SV=1 6 366 1.0E-59
sp|Q47AR7|MTNA_DECAR Methylthioribose-1-phosphate isomerase OS=Dechloromonas aromatica (strain RCB) GN=mtnA PE=3 SV=1 11 376 1.0E-59
sp|C6DCZ1|MTNA_PECCP Methylthioribose-1-phosphate isomerase OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=mtnA PE=3 SV=1 6 366 1.0E-59
sp|A6X8E9|MTNA_OCHA4 Methylthioribose-1-phosphate isomerase OS=Ochrobactrum anthropi (strain ATCC 49188 / DSM 6882 / NCTC 12168) GN=mtnA PE=3 SV=1 16 383 1.0E-59
sp|B5XZW2|MTNA_KLEP3 Methylthioribose-1-phosphate isomerase OS=Klebsiella pneumoniae (strain 342) GN=mtnA PE=3 SV=1 6 366 2.0E-59
sp|Q7U4V1|MTNA_SYNPX Methylthioribose-1-phosphate isomerase OS=Synechococcus sp. (strain WH8102) GN=mtnA PE=3 SV=2 1 367 2.0E-59
sp|O29877|MTNA_ARCFU Putative methylthioribose-1-phosphate isomerase OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=AF_0370 PE=1 SV=1 14 366 3.0E-59
sp|A6T656|MTNA_KLEP7 Methylthioribose-1-phosphate isomerase OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=mtnA PE=3 SV=1 6 366 5.0E-59
sp|Q92TI2|MTNA_RHIME Methylthioribose-1-phosphate isomerase OS=Rhizobium meliloti (strain 1021) GN=mtnA PE=3 SV=1 16 384 5.0E-59
sp|B4UIU8|MTNA_ANASK Methylthioribose-1-phosphate isomerase OS=Anaeromyxobacter sp. (strain K) GN=mtnA PE=3 SV=1 3 367 1.0E-58
sp|A7MKX3|MTNA_CROS8 Methylthioribose-1-phosphate isomerase OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=mtnA PE=3 SV=1 13 374 1.0E-58
sp|Q2IH96|MTNA_ANADE Methylthioribose-1-phosphate isomerase OS=Anaeromyxobacter dehalogenans (strain 2CP-C) GN=mtnA PE=3 SV=1 2 366 2.0E-58
sp|O27900|MTNA_METTH Putative methylthioribose-1-phosphate isomerase OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=MTH_1872 PE=3 SV=1 4 367 3.0E-58
sp|B8IEX1|MTNA_METNO Methylthioribose-1-phosphate isomerase OS=Methylobacterium nodulans (strain ORS2060 / LMG 21967) GN=mtnA PE=3 SV=1 14 387 7.0E-58
sp|B1JIK3|MTNA_YERPY Methylthioribose-1-phosphate isomerase OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=mtnA PE=3 SV=1 6 383 7.0E-58
sp|A4TPM9|MTNA_YERPP Methylthioribose-1-phosphate isomerase OS=Yersinia pestis (strain Pestoides F) GN=mtnA PE=3 SV=1 6 383 7.0E-58
sp|A9R2Z5|MTNA_YERPG Methylthioribose-1-phosphate isomerase OS=Yersinia pestis bv. Antiqua (strain Angola) GN=mtnA PE=3 SV=1 6 383 7.0E-58
sp|A7FLL1|MTNA_YERP3 Methylthioribose-1-phosphate isomerase OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=mtnA PE=3 SV=1 6 383 7.0E-58
sp|Q66E16|MTNA_YERPS Methylthioribose-1-phosphate isomerase OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=mtnA PE=3 SV=1 6 383 8.0E-58
sp|B2K633|MTNA_YERPB Methylthioribose-1-phosphate isomerase OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=mtnA PE=3 SV=1 6 383 8.0E-58
sp|Q2NFJ6|MTNA_METST Putative methylthioribose-1-phosphate isomerase OS=Methanosphaera stadtmanae (strain ATCC 43021 / DSM 3091 / JCM 11832 / MCB-3) GN=Msp_1023 PE=3 SV=1 4 365 1.0E-57
sp|B7KZ66|MTNA_METC4 Methylthioribose-1-phosphate isomerase OS=Methylobacterium extorquens (strain CM4 / NCIMB 13688) GN=mtnA PE=3 SV=1 14 387 4.0E-57
sp|A0LIZ1|MTNA_SYNFM Methylthioribose-1-phosphate isomerase OS=Syntrophobacter fumaroxidans (strain DSM 10017 / MPOB) GN=mtnA PE=3 SV=1 4 368 6.0E-57
sp|Q3AMB7|MTNA_SYNSC Methylthioribose-1-phosphate isomerase OS=Synechococcus sp. (strain CC9605) GN=mtnA PE=3 SV=1 1 367 2.0E-56
sp|A5FUV7|MTNA_ACICJ Methylthioribose-1-phosphate isomerase OS=Acidiphilium cryptum (strain JF-5) GN=mtnA PE=3 SV=1 11 365 7.0E-56
sp|Q4JB92|MTNA_SULAC Putative methylthioribose-1-phosphate isomerase OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=Saci_0539 PE=3 SV=1 9 366 8.0E-56
sp|Q8KBH1|MTNA_CHLTE Methylthioribose-1-phosphate isomerase OS=Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) GN=mtnA PE=3 SV=1 4 366 1.0E-55
sp|Q9YE84|MTNA_AERPE Putative methylthioribose-1-phosphate isomerase OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) GN=APE_0686 PE=3 SV=1 9 367 2.0E-55
sp|Q5YQZ6|MTNAB_NOCFA Probable bifunctional methylthioribose-1-phosphate isomerase/methylthioribulose-1-phosphate dehydratase OS=Nocardia farcinica (strain IFM 10152) GN=mtnAB PE=3 SV=1 1 366 5.0E-55
sp|B1ZL76|MTNA_METPB Methylthioribose-1-phosphate isomerase OS=Methylobacterium populi (strain ATCC BAA-705 / NCIMB 13946 / BJ001) GN=mtnA PE=3 SV=1 16 387 1.0E-53
sp|Q5FQK0|MTNA_GLUOX Methylthioribose-1-phosphate isomerase OS=Gluconobacter oxydans (strain 621H) GN=mtnA PE=3 SV=1 16 386 3.0E-53
sp|B8FLU0|MTNA_DESAA Methylthioribose-1-phosphate isomerase OS=Desulfatibacillum alkenivorans (strain AK-01) GN=mtnA PE=3 SV=1 16 372 2.0E-52
sp|A8ZYA5|MTNA_DESOH Methylthioribose-1-phosphate isomerase OS=Desulfococcus oleovorans (strain DSM 6200 / Hxd3) GN=mtnA PE=3 SV=1 10 384 3.0E-52
sp|C1A6J9|MTNA_GEMAT Methylthioribose-1-phosphate isomerase OS=Gemmatimonas aurantiaca (strain T-27 / DSM 14586 / JCM 11422 / NBRC 100505) GN=mtnA PE=3 SV=1 14 379 4.0E-51
sp|Q2VZP8|MTNA_MAGSA Methylthioribose-1-phosphate isomerase OS=Magnetospirillum magneticum (strain AMB-1 / ATCC 700264) GN=mtnA PE=3 SV=1 16 383 4.0E-51
sp|B9KQ55|MTNA_RHOSK Methylthioribose-1-phosphate isomerase OS=Rhodobacter sphaeroides (strain KD131 / KCTC 12085) GN=mtnA PE=3 SV=1 2 365 7.0E-51
sp|B7NGT8|MTNA_ECOLU Methylthioribose-1-phosphate isomerase OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=mtnA PE=3 SV=1 16 365 3.0E-50
sp|B7MMH6|MTNA_ECO45 Methylthioribose-1-phosphate isomerase OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=mtnA PE=3 SV=1 16 365 3.0E-50
sp|B6IUC1|MTNA_RHOCS Methylthioribose-1-phosphate isomerase OS=Rhodospirillum centenum (strain ATCC 51521 / SW) GN=mtnA PE=3 SV=1 16 385 8.0E-48
sp|Q30P36|MTNA_SULDN Methylthioribose-1-phosphate isomerase OS=Sulfurimonas denitrificans (strain ATCC 33889 / DSM 1251) GN=mtnA PE=3 SV=1 14 365 5.0E-44
sp|Q8TUJ1|MTNA_METAC Putative methylthioribose-1-phosphate isomerase OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=MA_0076 PE=3 SV=1 14 366 3.0E-43
sp|Q57586|R15PI_METJA Ribose 1,5-bisphosphate isomerase OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ0122 PE=3 SV=1 35 374 1.0E-36
sp|Q9V281|R15PI_PYRAB Ribose 1,5-bisphosphate isomerase OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=PYRAB01930 PE=3 SV=1 39 376 1.0E-34
sp|Q5JFM9|R15PI_THEKO Ribose 1,5-bisphosphate isomerase OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=TK0185 PE=1 SV=1 39 376 2.0E-34
sp|Q8U4G6|R15PI_PYRFU Ribose 1,5-bisphosphate isomerase OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=PF0122 PE=3 SV=2 39 376 1.0E-31
sp|O57947|R15PI_PYRHO Ribose 1,5-bisphosphate isomerase OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=PH0208 PE=3 SV=1 39 376 2.0E-30
sp|O28242|R15PI_ARCFU Ribose 1,5-bisphosphate isomerase OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=AF_2037 PE=3 SV=1 36 366 4.0E-29
sp|D4GV73|R15PI_HALVD Ribose 1,5-bisphosphate isomerase OS=Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2) GN=HVO_0966 PE=1 SV=1 91 364 2.0E-25
sp|Q9UI10|EI2BD_HUMAN Translation initiation factor eIF-2B subunit delta OS=Homo sapiens GN=EIF2B4 PE=1 SV=2 48 366 3.0E-12
sp|Q9USP0|EI2BA_SCHPO Translation initiation factor eIF-2B subunit alpha OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tif221 PE=3 SV=1 200 367 2.0E-11
sp|Q61749|EI2BD_MOUSE Translation initiation factor eIF-2B subunit delta OS=Mus musculus GN=Eif2b4 PE=1 SV=2 48 366 5.0E-10
sp|O58185|EI2BL_PYRHO Putative translation initiation factor eIF-2B subunit 2-like OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=PH0440 PE=1 SV=1 167 366 6.0E-10
sp|Q54I81|EI2BA_DICDI Translation initiation factor eIF-2B subunit alpha OS=Dictyostelium discoideum GN=eif2b1 PE=3 SV=1 70 366 6.0E-10
sp|Q63186|EI2BD_RAT Translation initiation factor eIF-2B subunit delta OS=Rattus norvegicus GN=Eif2b4 PE=2 SV=1 48 366 9.0E-10
sp|P23140|YPE3_RHORU Uncharacterized protein in petC 3'region (Fragment) OS=Rhodospirillum rubrum PE=3 SV=1 2 178 4.0E-09
sp|P41111|EI2BD_RABIT Translation initiation factor eIF-2B subunit delta OS=Oryctolagus cuniculus GN=EIF2B4 PE=2 SV=2 48 366 8.0E-09
sp|Q3T058|EI2BD_BOVIN Translation initiation factor eIF-2B subunit delta OS=Bos taurus GN=EIF2B4 PE=2 SV=1 48 366 4.0E-08
sp|Q9UYB6|EI2BL_PYRAB Putative translation initiation factor eIF-2B subunit 2-like OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=PYRAB15920 PE=3 SV=1 167 366 6.0E-08
sp|Q5RAR0|EI2BA_PONAB Translation initiation factor eIF-2B subunit alpha OS=Pongo abelii GN=EIF2B1 PE=2 SV=2 200 366 8.0E-08
sp|Q14232|EI2BA_HUMAN Translation initiation factor eIF-2B subunit alpha OS=Homo sapiens GN=EIF2B1 PE=1 SV=1 200 366 8.0E-08
sp|Q4R4V8|EI2BA_MACFA Translation initiation factor eIF-2B subunit alpha OS=Macaca fascicularis GN=EIF2B1 PE=2 SV=1 200 366 3.0E-07
sp|Q54FM3|EI2BD_DICDI Translation initiation factor eIF-2B subunit delta OS=Dictyostelium discoideum GN=eif2b4 PE=3 SV=1 85 366 5.0E-07
sp|Q64270|EI2BA_RAT Translation initiation factor eIF-2B subunit alpha OS=Rattus norvegicus GN=Eif2b1 PE=2 SV=1 200 366 1.0E-06
sp|Q99LC8|EI2BA_MOUSE Translation initiation factor eIF-2B subunit alpha OS=Mus musculus GN=Eif2b1 PE=1 SV=1 200 366 1.0E-06
sp|Q99LD9|EI2BB_MOUSE Translation initiation factor eIF-2B subunit beta OS=Mus musculus GN=Eif2b2 PE=1 SV=1 199 364 5.0E-06
sp|P14741|EI2BA_YEAST Translation initiation factor eIF-2B subunit alpha OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GCN3 PE=1 SV=1 202 347 7.0E-06
sp|Q0IIF2|EI2BA_BOVIN Translation initiation factor eIF-2B subunit alpha OS=Bos taurus GN=EIF2B1 PE=2 SV=1 200 289 8.0E-06
sp|P34604|EI2BA_CAEEL Probable translation initiation factor eIF-2B subunit alpha OS=Caenorhabditis elegans GN=ZK1098.4 PE=1 SV=1 165 314 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0044237 cellular metabolic process Yes
GO:0008152 metabolic process No
GO:0008150 biological_process No
GO:0009987 cellular process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|5876
MSPLEAVKYSRGKLLVLDQLRLPHELHYDAVASRQDAFDSIASMRVRGAPAIAIVASLGLAVELDSSPPRSSSAA
DCVAHIDSALDYVQGSRPTAVDLTNAVLRLKTCVRQAAAGERASSKSVVEAFIQEAEAIFERDLQTNLSIGQYGA
SWLGGHAGGCGGDKISILTHCNTGSLATSGHGTALGIVRTLHSQRLLGHVFCTETRPYNQGSRLTAFELVHEGIP
ATLITDSMAAALLRTRASLCNMAAVVVGADRVVRNGDTANKIGTYQLAVLARHHGIKFVVAAPTTSIDLETLTGD
GIEIEERKPQELSQVTGAVIGPDGSVDTSTKVRVATADQRIGVWNPAFDVTPAALIDAIVTERGVIEKGPDGSFD
LGNFVPERQAAAGSHATA*
Coding >OphauB2|5876
ATGTCGCCGCTCGAGGCCGTCAAGTACTCGCGAGGAAAGCTGCTAGTGCTAGACCAGCTCCGCCTCCCTCACGAG
TTGCACTACGATGCCGTCGCCTCGCGCCAAGATGCCTTTGATAGCATTGCATCCATGCGGGTGCGCGGCGCCCCA
GCCATTGCCATTGTTGCCAGCCTTGGCCTGGCCGTGGAGCTGGACTCGAGTCCGCCTCGCAGCTCGTCGGCCGCA
GATTGTGTCGCGCACATTGACTCTGCCCTCGACTATGTGCAAGGGAGCCGCCCGACGGCTGTCGACTTGACCAAT
GCGGTGCTGCGGCTCAAGACGTGTGTGCGGCAAGCAGCGGCGGGCGAGAGGGCCAGTAGCAAGAGTGTAGTGGAA
GCCTTTATACAAGAGGCCGAGGCCATTTTCGAGAGGGACTTGCAGACAAACCTGTCGATTGGGCAATACGGCGCG
TCGTGGCTTGGTGGGCATGCCGGTGGGTGTGGAGGAGACAAGATTTCCATCCTGACACATTGTAATACGGGCTCG
CTGGCCACGTCGGGCCATGGCACTGCACTGGGTATTGTGCGCACGCTACATAGCCAGCGCCTGCTTGGCCACGTC
TTTTGCACCGAGACACGCCCCTATAACCAGGGCAGCCGCCTAACCGCCTTTGAGCTCGTCCACGAGGGGATCCCC
GCCACGCTCATCACCGACTCCATGGCGGCGGCGCTCTTGCGCACTCGCGCATCCTTGTGCAACATGGCGGCTGTC
GTGGTAGGCGCTGACCGCGTGGTGCGCAACGGAGACACGGCAAACAAGATTGGCACCTATCAGCTTGCAGTGCTC
GCTCGCCACCACGGCATCAAGTTTGTCGTTGCCGCGCCAACAACGAGCATTGATCTAGAGACTCTGACTGGCGAC
GGCATCGAGATTGAGGAGCGCAAGCCGCAGGAGCTCTCGCAAGTCACTGGCGCCGTCATTGGGCCAGACGGGAGC
GTCGACACAAGCACAAAGGTGCGTGTGGCTACGGCAGACCAGAGAATAGGCGTCTGGAACCCGGCTTTTGATGTT
ACGCCCGCAGCCCTCATTGACGCCATTGTGACGGAGCGCGGAGTCATTGAAAAGGGGCCAGACGGCAGCTTTGAC
TTGGGCAACTTTGTGCCAGAGCGACAAGCAGCCGCCGGCTCCCATGCCACGGCCTGA
Transcript >OphauB2|5876
ATGTCGCCGCTCGAGGCCGTCAAGTACTCGCGAGGAAAGCTGCTAGTGCTAGACCAGCTCCGCCTCCCTCACGAG
TTGCACTACGATGCCGTCGCCTCGCGCCAAGATGCCTTTGATAGCATTGCATCCATGCGGGTGCGCGGCGCCCCA
GCCATTGCCATTGTTGCCAGCCTTGGCCTGGCCGTGGAGCTGGACTCGAGTCCGCCTCGCAGCTCGTCGGCCGCA
GATTGTGTCGCGCACATTGACTCTGCCCTCGACTATGTGCAAGGGAGCCGCCCGACGGCTGTCGACTTGACCAAT
GCGGTGCTGCGGCTCAAGACGTGTGTGCGGCAAGCAGCGGCGGGCGAGAGGGCCAGTAGCAAGAGTGTAGTGGAA
GCCTTTATACAAGAGGCCGAGGCCATTTTCGAGAGGGACTTGCAGACAAACCTGTCGATTGGGCAATACGGCGCG
TCGTGGCTTGGTGGGCATGCCGGTGGGTGTGGAGGAGACAAGATTTCCATCCTGACACATTGTAATACGGGCTCG
CTGGCCACGTCGGGCCATGGCACTGCACTGGGTATTGTGCGCACGCTACATAGCCAGCGCCTGCTTGGCCACGTC
TTTTGCACCGAGACACGCCCCTATAACCAGGGCAGCCGCCTAACCGCCTTTGAGCTCGTCCACGAGGGGATCCCC
GCCACGCTCATCACCGACTCCATGGCGGCGGCGCTCTTGCGCACTCGCGCATCCTTGTGCAACATGGCGGCTGTC
GTGGTAGGCGCTGACCGCGTGGTGCGCAACGGAGACACGGCAAACAAGATTGGCACCTATCAGCTTGCAGTGCTC
GCTCGCCACCACGGCATCAAGTTTGTCGTTGCCGCGCCAACAACGAGCATTGATCTAGAGACTCTGACTGGCGAC
GGCATCGAGATTGAGGAGCGCAAGCCGCAGGAGCTCTCGCAAGTCACTGGCGCCGTCATTGGGCCAGACGGGAGC
GTCGACACAAGCACAAAGGTGCGTGTGGCTACGGCAGACCAGAGAATAGGCGTCTGGAACCCGGCTTTTGATGTT
ACGCCCGCAGCCCTCATTGACGCCATTGTGACGGAGCGCGGAGTCATTGAAAAGGGGCCAGACGGCAGCTTTGAC
TTGGGCAACTTTGTGCCAGAGCGACAAGCAGCCGCCGGCTCCCATGCCACGGCCTGA
Gene >OphauB2|5876
ATGTCGCCGCTCGAGGCCGTCAAGTACTCGCGAGGAAAGCTGCTAGTGCTAGACCAGCTCCGCCTCCCTCACGAG
TTGCACTACGATGCCGTCGCCTCGCGCCAAGATGCCTTTGATAGCATTGCATCCATGCGGGTGCGCGGCGCCCCA
GCCATTGCCATTGTTGCCAGCCTTGGCCTGGCCGTGGAGCTGGACTCGAGTCCGCCTCGCAGCTCGTCGGCCGCA
GATTGTGTCGCGCACATTGACTCTGCCCTCGACTATGTGCAAGGGAGCCGCCCGACGGCTGTCGACTTGACCAAT
GCGGTGCTGCGGCTCAAGACGTGTGTGCGGCAAGCAGCGGCGGGCGAGAGGGCCAGTAGCAAGAGTGTAGTGGAA
GCCTTTATACAAGAGGCCGAGGCCATTTTCGAGAGGGACTTGCAGACAAACCTGTCGATTGGGCAATACGGCGCG
TCGTGGCTTGGTGGGCATGCCGGTGGGTGTGGAGGAGACAAGATTTCCATCCTGACACATTGTAATACGGGCTCG
CTGGCCACGTCGGGCCATGGCACTGCACTGGGTATTGTGCGCACGCTACATAGCCAGCGCCTGCTTGGCCACGTC
TTTTGCACCGAGACACGCCCCTATAACCAGGGCAGCCGCCTAACCGCCTTTGAGCTCGTCCACGAGGGGATCCCC
GCCACGCTCATCACCGACTCCATGGCGGCGGCGCTCTTGCGCACTCGCGCATCCTTGTGCAACATGGCGGCTGTC
GTGGTAGGCGCTGACCGCGTGGTGCGCAACGGAGACACGGCAAACAAGATTGGCACCTATCAGCTTGCAGTGCTC
GCTCGCCACCACGGCATCAAGTTTGTCGTTGCCGCGCCAACAACGAGCATTGATCTAGAGACTCTGACTGGCGAC
GGCATCGAGATTGAGGAGCGCAAGCCGCAGGAGCTCTCGCAAGTCACTGGCGCCGTCATTGGGCCAGACGGGAGC
GTCGACACAAGCACAAAGGTGCGTGTGGCTACGGCAGACCAGAGAATAGGCGTCTGGAACCCGGCTTTTGATGTT
ACGCCCGCAGCCCTCATTGACGCCATTGTGACGGAGCGCGGAGTCATTGAAAAGGGGCCAGACGGCAGCTTTGAC
TTGGGCAACTTTGTGCCAGAGCGACAAGCAGCCGCCGGCTCCCATGCCACGGCCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail