Protein ID | OphauB2|5876 |
Gene name | |
Location | Contig_5:59179..60361 |
Strand | - |
Gene length (bp) | 1182 |
Transcript length (bp) | 1182 |
Coding sequence length (bp) | 1182 |
Protein length (aa) | 394 |
PFAM Domain ID | Short name | Long name | E-value | Start | End |
---|---|---|---|---|---|
PF01008 | IF-2B | Initiation factor 2 subunit family | 7.2E-75 | 46 | 367 |
Swissprot ID | Swissprot Description | Start | End | E-value |
---|---|---|---|---|
sp|C7Z638|MTNA_NECH7 | Methylthioribose-1-phosphate isomerase OS=Nectria haematococca (strain 77-13-4 / ATCC MYA-4622 / FGSC 9596 / MPVI) GN=MRI1 PE=3 SV=1 | 1 | 385 | 0.0E+00 |
sp|C9SB02|MTNA_VERA1 | Methylthioribose-1-phosphate isomerase OS=Verticillium alfalfae (strain VaMs.102 / ATCC MYA-4576 / FGSC 10136) GN=MRI1 PE=3 SV=1 | 1 | 385 | 0.0E+00 |
sp|Q2GM68|MTNA_CHAGB | Methylthioribose-1-phosphate isomerase OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=MRI1 PE=3 SV=1 | 1 | 383 | 3.0E-179 |
sp|P0CI29|MTNA_SORMK | Methylthioribose-1-phosphate isomerase OS=Sordaria macrospora (strain ATCC MYA-333 / DSM 997 / K(L3346) / K-hell) GN=MRI1 PE=3 SV=1 | 1 | 383 | 5.0E-173 |
sp|Q7S4G7|MTNA_NEUCR | Methylthioribose-1-phosphate isomerase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=mri-1 PE=3 SV=1 | 1 | 383 | 2.0E-172 |
Swissprot ID | Swissprot Description | Start | End | E-value |
---|---|---|---|---|
sp|C7Z638|MTNA_NECH7 | Methylthioribose-1-phosphate isomerase OS=Nectria haematococca (strain 77-13-4 / ATCC MYA-4622 / FGSC 9596 / MPVI) GN=MRI1 PE=3 SV=1 | 1 | 385 | 0.0E+00 |
sp|C9SB02|MTNA_VERA1 | Methylthioribose-1-phosphate isomerase OS=Verticillium alfalfae (strain VaMs.102 / ATCC MYA-4576 / FGSC 10136) GN=MRI1 PE=3 SV=1 | 1 | 385 | 0.0E+00 |
sp|Q2GM68|MTNA_CHAGB | Methylthioribose-1-phosphate isomerase OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=MRI1 PE=3 SV=1 | 1 | 383 | 3.0E-179 |
sp|P0CI29|MTNA_SORMK | Methylthioribose-1-phosphate isomerase OS=Sordaria macrospora (strain ATCC MYA-333 / DSM 997 / K(L3346) / K-hell) GN=MRI1 PE=3 SV=1 | 1 | 383 | 5.0E-173 |
sp|Q7S4G7|MTNA_NEUCR | Methylthioribose-1-phosphate isomerase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=mri-1 PE=3 SV=1 | 1 | 383 | 2.0E-172 |
sp|B2AML6|MTNA_PODAN | Methylthioribose-1-phosphate isomerase OS=Podospora anserina (strain S / ATCC MYA-4624 / DSM 980 / FGSC 10383) GN=MRI1 PE=3 SV=2 | 1 | 386 | 5.0E-171 |
sp|A7EGZ3|MTNA_SCLS1 | Methylthioribose-1-phosphate isomerase OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=mri1 PE=3 SV=1 | 1 | 385 | 1.0E-149 |
sp|A6RHT9|MTNA_BOTFB | Methylthioribose-1-phosphate isomerase OS=Botryotinia fuckeliana (strain B05.10) GN=mri1 PE=3 SV=1 | 1 | 385 | 2.0E-149 |
sp|C1G9Q3|MTNA_PARBD | Methylthioribose-1-phosphate isomerase OS=Paracoccidioides brasiliensis (strain Pb18) GN=MRI1 PE=3 SV=1 | 3 | 376 | 2.0E-132 |
sp|B8M7D2|MTNA_TALSN | Methylthioribose-1-phosphate isomerase OS=Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006) GN=mri1 PE=3 SV=1 | 4 | 382 | 1.0E-131 |
sp|B6QRG1|MTNA_TALMQ | Methylthioribose-1-phosphate isomerase OS=Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333) GN=mri1 PE=3 SV=1 | 4 | 382 | 7.0E-129 |
sp|C0S1C8|MTNA_PARBP | Methylthioribose-1-phosphate isomerase OS=Paracoccidioides brasiliensis (strain Pb03) GN=MRI1 PE=3 SV=1 | 3 | 376 | 2.0E-128 |
sp|B2VZQ8|MTNA_PYRTR | Methylthioribose-1-phosphate isomerase OS=Pyrenophora tritici-repentis (strain Pt-1C-BFP) GN=mri1 PE=3 SV=1 | 4 | 376 | 3.0E-128 |
sp|Q5B590|MTNA_EMENI | Methylthioribose-1-phosphate isomerase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=mri1 PE=3 SV=1 | 4 | 376 | 1.0E-126 |
sp|C5PBM5|MTNA_COCP7 | Methylthioribose-1-phosphate isomerase OS=Coccidioides posadasii (strain C735) GN=MRI1 PE=3 SV=1 | 2 | 379 | 2.0E-125 |
sp|C5FY68|MTNA_ARTOC | Methylthioribose-1-phosphate isomerase OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=MRI1 PE=3 SV=1 | 4 | 376 | 9.0E-125 |
sp|C0P108|MTNA_AJECG | Methylthioribose-1-phosphate isomerase OS=Ajellomyces capsulatus (strain G186AR / H82 / ATCC MYA-2454 / RMSCC 2432) GN=MRI1 PE=3 SV=1 | 4 | 376 | 2.0E-124 |
sp|A6R364|MTNA_AJECN | Methylthioribose-1-phosphate isomerase OS=Ajellomyces capsulatus (strain NAm1 / WU24) GN=MRI1 PE=3 SV=1 | 4 | 376 | 8.0E-124 |
sp|B6H5R4|MTNA_PENRW | Methylthioribose-1-phosphate isomerase OS=Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255) GN=mri1 PE=3 SV=1 | 4 | 379 | 2.0E-123 |
sp|C4JWQ7|MTNA_UNCRE | Methylthioribose-1-phosphate isomerase OS=Uncinocarpus reesii (strain UAMH 1704) GN=MRI1 PE=3 SV=1 | 2 | 379 | 2.0E-122 |
sp|A1CY38|MTNA_NEOFI | Methylthioribose-1-phosphate isomerase OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=mri1 PE=3 SV=1 | 2 | 386 | 3.0E-122 |
sp|Q2UIM3|MTNA_ASPOR | Methylthioribose-1-phosphate isomerase OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=mri1 PE=3 SV=1 | 4 | 376 | 3.0E-120 |
sp|Q4WNI1|MTNA_ASPFU | Methylthioribose-1-phosphate isomerase OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=mri1 PE=3 SV=1 | 2 | 386 | 9.0E-120 |
sp|B0Y5C3|MTNA_ASPFC | Methylthioribose-1-phosphate isomerase OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=mri1 PE=3 SV=1 | 2 | 386 | 9.0E-120 |
sp|A1CGN9|MTNA_ASPCL | Methylthioribose-1-phosphate isomerase OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=mri1 PE=3 SV=1 | 4 | 385 | 4.0E-119 |
sp|C5JGS0|MTNA_AJEDS | Methylthioribose-1-phosphate isomerase OS=Ajellomyces dermatitidis (strain SLH14081) GN=MRI1 PE=3 SV=1 | 4 | 376 | 2.0E-118 |
sp|C5GGE5|MTNA_AJEDR | Methylthioribose-1-phosphate isomerase OS=Ajellomyces dermatitidis (strain ER-3 / ATCC MYA-2586) GN=MRI1 PE=3 SV=1 | 4 | 376 | 2.0E-118 |
sp|Q6CGS4|MTNA_YARLI | Methylthioribose-1-phosphate isomerase OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=MRI1 PE=3 SV=1 | 4 | 379 | 5.0E-118 |
sp|Q0VFN1|MTNA_XENTR | Methylthioribose-1-phosphate isomerase OS=Xenopus tropicalis GN=mri1 PE=2 SV=1 | 4 | 367 | 4.0E-116 |
sp|Q4FZP2|MTNA_XENLA | Methylthioribose-1-phosphate isomerase OS=Xenopus laevis GN=mri1 PE=2 SV=1 | 4 | 367 | 6.0E-116 |
sp|A7RF00|MTNA_NEMVE | Methylthioribose-1-phosphate isomerase OS=Nematostella vectensis GN=v1g237765 PE=3 SV=1 | 4 | 364 | 9.0E-115 |
sp|A9UQ62|MTNA_MONBE | Methylthioribose-1-phosphate isomerase OS=Monosiga brevicollis GN=34861 PE=3 SV=1 | 1 | 379 | 4.0E-114 |
sp|Q0CFY3|MTNA_ASPTN | Methylthioribose-1-phosphate isomerase OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=mri1 PE=3 SV=1 | 4 | 376 | 2.0E-112 |
sp|Q9CQT1|MTNA_MOUSE | Methylthioribose-1-phosphate isomerase OS=Mus musculus GN=Mri1 PE=1 SV=1 | 4 | 366 | 8.0E-111 |
sp|B4NG41|MTNA_DROWI | Methylthioribose-1-phosphate isomerase OS=Drosophila willistoni GN=GK22419 PE=3 SV=1 | 4 | 367 | 1.0E-110 |
sp|Q948X8|MTNA_TOBAC | Methylthioribose-1-phosphate isomerase OS=Nicotiana tabacum GN=CIG2 PE=2 SV=1 | 4 | 380 | 1.0E-110 |
sp|Q9BV20|MTNA_HUMAN | Methylthioribose-1-phosphate isomerase OS=Homo sapiens GN=MRI1 PE=1 SV=1 | 4 | 366 | 9.0E-110 |
sp|Q5HZE4|MTNA_RAT | Methylthioribose-1-phosphate isomerase OS=Rattus norvegicus GN=Mri1 PE=1 SV=1 | 4 | 366 | 1.0E-109 |
sp|B9HCR2|MTNA_POPTR | Methylthioribose-1-phosphate isomerase OS=Populus trichocarpa GN=POPTRDRAFT_832064 PE=3 SV=2 | 4 | 380 | 2.0E-108 |
sp|B6TZD1|MTNA_MAIZE | Methylthioribose-1-phosphate isomerase OS=Zea mays GN=IDI2 PE=2 SV=1 | 4 | 380 | 3.0E-108 |
sp|Q9ZUG4|MTNA_ARATH | Methylthioribose-1-phosphate isomerase OS=Arabidopsis thaliana GN=At2g05830 PE=1 SV=2 | 4 | 379 | 6.0E-108 |
sp|Q2NL31|MTNA_BOVIN | Methylthioribose-1-phosphate isomerase OS=Bos taurus GN=MRI1 PE=2 SV=1 | 4 | 366 | 4.0E-106 |
sp|B4K8A4|MTNA_DROMO | Methylthioribose-1-phosphate isomerase OS=Drosophila mojavensis GN=GI10562 PE=3 SV=1 | 4 | 367 | 7.0E-106 |
sp|B3M098|MTNA_DROAN | Methylthioribose-1-phosphate isomerase OS=Drosophila ananassae GN=GF17194 PE=3 SV=1 | 4 | 367 | 2.0E-105 |
sp|B3P538|MTNA_DROER | Methylthioribose-1-phosphate isomerase OS=Drosophila erecta GN=GG11866 PE=3 SV=1 | 4 | 367 | 3.0E-105 |
sp|Q0ZB81|MTNA_BOMMO | Methylthioribose-1-phosphate isomerase OS=Bombyx mori PE=2 SV=1 | 4 | 371 | 6.0E-105 |
sp|Q9AYT7|MTNA_HORVU | Methylthioribose-1-phosphate isomerase OS=Hordeum vulgare GN=IDI2 PE=2 SV=1 | 2 | 380 | 9.0E-105 |
sp|B9RR88|MTNA_RICCO | Methylthioribose-1-phosphate isomerase OS=Ricinus communis GN=RCOM_0711420 PE=2 SV=1 | 4 | 380 | 1.0E-104 |
sp|A2ZCP0|MTNA_ORYSI | Methylthioribose-1-phosphate isomerase OS=Oryza sativa subsp. indica GN=OsI_35550 PE=2 SV=1 | 1 | 380 | 2.0E-104 |
sp|O60185|MTNA_SCHPO | Methylthioribose-1-phosphate isomerase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mri1 PE=3 SV=1 | 4 | 376 | 4.0E-104 |
sp|B4PNE2|MTNA_DROYA | Methylthioribose-1-phosphate isomerase OS=Drosophila yakuba GN=GE23315 PE=3 SV=1 | 4 | 367 | 6.0E-104 |
sp|Q9V9X4|MTNA_DROME | Methylthioribose-1-phosphate isomerase OS=Drosophila melanogaster GN=CG11334 PE=2 SV=1 | 4 | 367 | 6.0E-104 |
sp|Q29BB3|MTNA_DROPS | Methylthioribose-1-phosphate isomerase OS=Drosophila pseudoobscura pseudoobscura GN=GA10928 PE=3 SV=1 | 4 | 367 | 7.0E-104 |
sp|Q0ITU1|MTNA_ORYSJ | Methylthioribose-1-phosphate isomerase OS=Oryza sativa subsp. japonica GN=IDI2 PE=2 SV=1 | 1 | 380 | 8.0E-104 |
sp|B4I029|MTNA_DROSE | Methylthioribose-1-phosphate isomerase OS=Drosophila sechellia GN=GM12085 PE=3 SV=1 | 4 | 367 | 8.0E-104 |
sp|B4GYU1|MTNA_DROPE | Methylthioribose-1-phosphate isomerase OS=Drosophila persimilis GN=GL27236 PE=3 SV=1 | 4 | 367 | 9.0E-104 |
sp|B4QSM8|MTNA_DROSI | Methylthioribose-1-phosphate isomerase OS=Drosophila simulans GN=GD16414 PE=3 SV=1 | 4 | 367 | 9.0E-104 |
sp|Q16I17|MTNA_AEDAE | Methylthioribose-1-phosphate isomerase OS=Aedes aegypti GN=AAEL013828 PE=3 SV=1 | 4 | 367 | 1.0E-103 |
sp|A9JRE2|MTNA_DANRE | Methylthioribose-1-phosphate isomerase OS=Danio rerio GN=mri1 PE=2 SV=1 | 4 | 366 | 2.0E-103 |
sp|D7TCD0|MTNA_VITVI | Methylthioribose-1-phosphate isomerase OS=Vitis vinifera GN=VIT_11s0016g00830 PE=2 SV=2 | 4 | 380 | 4.0E-103 |
sp|B4LWZ8|MTNA_DROVI | Methylthioribose-1-phosphate isomerase OS=Drosophila virilis GN=GJ22917 PE=3 SV=1 | 4 | 367 | 9.0E-103 |
sp|B4JRX2|MTNA_DROGR | Methylthioribose-1-phosphate isomerase OS=Drosophila grimshawi GN=GH21593 PE=3 SV=1 | 4 | 367 | 6.0E-102 |
sp|Q7PKS9|MTNA_ANOGA | Methylthioribose-1-phosphate isomerase OS=Anopheles gambiae GN=AGAP001589 PE=3 SV=1 | 4 | 367 | 6.0E-101 |
sp|D2VAA9|MTNA_NAEGR | Methylthioribose-1-phosphate isomerase OS=Naegleria gruberi GN=NAEGRDRAFT_32363 PE=3 SV=1 | 4 | 366 | 1.0E-99 |
sp|B3RLE6|MTNA_TRIAD | Methylthioribose-1-phosphate isomerase OS=Trichoplax adhaerens GN=TRIADDRAFT_19292 PE=3 SV=1 | 4 | 366 | 3.0E-99 |
sp|A4HQ10|MTNA_LEIBR | Methylthioribose-1-phosphate isomerase OS=Leishmania braziliensis GN=LbrM35_V2.5180 PE=3 SV=1 | 4 | 383 | 2.0E-97 |
sp|A3LN21|MTNA_PICST | Methylthioribose-1-phosphate isomerase OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=MRI1 PE=3 SV=2 | 4 | 376 | 4.0E-97 |
sp|C7GXT0|MTNA_YEAS2 | Methylthioribose-1-phosphate isomerase OS=Saccharomyces cerevisiae (strain JAY291) GN=MRI1 PE=3 SV=1 | 4 | 376 | 9.0E-97 |
sp|B8C6V3|MTNA_THAPS | Methylthioribose-1-phosphate isomerase OS=Thalassiosira pseudonana GN=THAPSDRAFT_35896 PE=3 SV=1 | 10 | 380 | 1.0E-96 |
sp|A7TSA5|MTNA_VANPO | Methylthioribose-1-phosphate isomerase OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=MRI1 PE=3 SV=1 | 4 | 376 | 1.0E-96 |
sp|Q06489|MTNA_YEAST | Methylthioribose-1-phosphate isomerase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MRI1 PE=1 SV=1 | 4 | 376 | 4.0E-96 |
sp|C8ZJE0|MTNA_YEAS8 | Methylthioribose-1-phosphate isomerase OS=Saccharomyces cerevisiae (strain Lalvin EC1118 / Prise de mousse) GN=MRI1 PE=3 SV=1 | 4 | 376 | 4.0E-96 |
sp|A6ZWZ9|MTNA_YEAS7 | Methylthioribose-1-phosphate isomerase OS=Saccharomyces cerevisiae (strain YJM789) GN=MRI1 PE=3 SV=1 | 4 | 376 | 4.0E-96 |
sp|B5VTQ8|MTNA_YEAS6 | Methylthioribose-1-phosphate isomerase OS=Saccharomyces cerevisiae (strain AWRI1631) GN=MRI1 PE=3 SV=1 | 4 | 376 | 4.0E-96 |
sp|B3LK82|MTNA_YEAS1 | Methylthioribose-1-phosphate isomerase OS=Saccharomyces cerevisiae (strain RM11-1a) GN=MRI1 PE=3 SV=1 | 4 | 376 | 4.0E-96 |
sp|A4ICE5|MTNA_LEIIN | Methylthioribose-1-phosphate isomerase OS=Leishmania infantum GN=LinJ36.0740 PE=3 SV=1 | 4 | 382 | 3.0E-95 |
sp|C5M614|MTNA_CANTT | Methylthioribose-1-phosphate isomerase OS=Candida tropicalis (strain ATCC MYA-3404 / T1) GN=MRI1 PE=3 SV=1 | 4 | 376 | 9.0E-95 |
sp|Q6BZH5|MTNA_DEBHA | Methylthioribose-1-phosphate isomerase OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=MRI1 PE=3 SV=2 | 4 | 376 | 2.0E-94 |
sp|B9WAG5|MTNA_CANDC | Methylthioribose-1-phosphate isomerase OS=Candida dubliniensis (strain CD36 / ATCC MYA-646 / CBS 7987 / NCPF 3949 / NRRL Y-17841) GN=MRI1 PE=3 SV=1 | 4 | 376 | 5.0E-94 |
sp|C4YC37|MTNA_CLAL4 | Methylthioribose-1-phosphate isomerase OS=Clavispora lusitaniae (strain ATCC 42720) GN=MRI1 PE=3 SV=1 | 4 | 376 | 6.0E-94 |
sp|C5DHL1|MTNA_LACTC | Methylthioribose-1-phosphate isomerase OS=Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284) GN=MRI1 PE=3 SV=1 | 4 | 379 | 2.0E-93 |
sp|Q4Q0R9|MTNA_LEIMA | Methylthioribose-1-phosphate isomerase OS=Leishmania major GN=LmjF36.4930 PE=1 SV=2 | 4 | 382 | 2.0E-93 |
sp|Q5AD59|MTNA_CANAL | Methylthioribose-1-phosphate isomerase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=MRI1 PE=3 SV=1 | 4 | 376 | 5.0E-93 |
sp|C4YJ78|MTNA_CANAW | Methylthioribose-1-phosphate isomerase OS=Candida albicans (strain WO-1) GN=MRI1 PE=3 SV=1 | 4 | 376 | 4.0E-92 |
sp|C5DU12|MTNA_ZYGRC | Methylthioribose-1-phosphate isomerase OS=Zygosaccharomyces rouxii (strain ATCC 2623 / CBS 732 / NBRC 1130 / NCYC 568 / NRRL Y-229) GN=MRI1 PE=3 SV=1 | 4 | 376 | 3.0E-91 |
sp|A5DNT0|MTNA_PICGU | Methylthioribose-1-phosphate isomerase OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=MRI1 PE=3 SV=2 | 1 | 376 | 1.0E-90 |
sp|Q6CQP3|MTNA_KLULA | Methylthioribose-1-phosphate isomerase OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=MRI1 PE=3 SV=1 | 4 | 376 | 8.0E-90 |
sp|A4S068|MTNA_OSTLU | Methylthioribose-1-phosphate isomerase OS=Ostreococcus lucimarinus (strain CCE9901) GN=OSTLU_35743 PE=3 SV=1 | 1 | 389 | 2.0E-89 |
sp|A5DUX4|MTNA_LODEL | Methylthioribose-1-phosphate isomerase OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=MRI1 PE=3 SV=1 | 4 | 376 | 2.0E-89 |
sp|C4QYS6|MTNA_PICPG | Methylthioribose-1-phosphate isomerase OS=Komagataella pastoris (strain GS115 / ATCC 20864) GN=MRI1 PE=3 SV=1 | 4 | 376 | 3.0E-89 |
sp|B8PBR2|MTNA_POSPM | Methylthioribose-1-phosphate isomerase OS=Postia placenta (strain ATCC 44394 / Madison 698-R) GN=MRI1 PE=3 SV=1 | 1 | 380 | 2.0E-88 |
sp|B8GRR4|MTNA_THISH | Methylthioribose-1-phosphate isomerase OS=Thioalkalivibrio sulfidiphilus (strain HL-EbGR7) GN=mtnA PE=3 SV=1 | 4 | 371 | 1.0E-86 |
sp|B6K4Q2|MTNA_SCHJY | Methylthioribose-1-phosphate isomerase OS=Schizosaccharomyces japonicus (strain yFS275 / FY16936) GN=mri1 PE=3 SV=1 | 4 | 372 | 2.0E-85 |
sp|A4XKS3|MTNA_CALS8 | Methylthioribose-1-phosphate isomerase OS=Caldicellulosiruptor saccharolyticus (strain ATCC 43494 / DSM 8903 / Tp8T 6331) GN=mtnA PE=3 SV=1 | 4 | 366 | 3.0E-85 |
sp|Q75EI1|MTNA_ASHGO | Methylthioribose-1-phosphate isomerase OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=MRI1 PE=3 SV=1 | 4 | 376 | 4.0E-84 |
sp|B0D0U4|MTNA_LACBS | Methylthioribose-1-phosphate isomerase OS=Laccaria bicolor (strain S238N-H82 / ATCC MYA-4686) GN=MRI1 PE=3 SV=1 | 4 | 376 | 6.0E-84 |
sp|Q87A92|MTNA_XYLFT | Methylthioribose-1-phosphate isomerase OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=mtnA PE=3 SV=1 | 14 | 373 | 2.0E-83 |
sp|B2I9S0|MTNA_XYLF2 | Methylthioribose-1-phosphate isomerase OS=Xylella fastidiosa (strain M23) GN=mtnA PE=3 SV=1 | 14 | 373 | 2.0E-83 |
sp|Q3BV11|MTNA_XANC5 | Methylthioribose-1-phosphate isomerase OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) GN=mtnA PE=3 SV=1 | 9 | 371 | 5.0E-83 |
sp|Q8PM04|MTNA_XANAC | Methylthioribose-1-phosphate isomerase OS=Xanthomonas axonopodis pv. citri (strain 306) GN=mtnA PE=3 SV=1 | 9 | 371 | 7.0E-83 |
sp|B0U5G3|MTNA_XYLFM | Methylthioribose-1-phosphate isomerase OS=Xylella fastidiosa (strain M12) GN=mtnA PE=3 SV=1 | 14 | 373 | 1.0E-82 |
sp|Q9PAG5|MTNA_XYLFA | Methylthioribose-1-phosphate isomerase OS=Xylella fastidiosa (strain 9a5c) GN=mtnA PE=3 SV=1 | 14 | 373 | 2.0E-82 |
sp|Q0VPK6|MTNA_ALCBS | Methylthioribose-1-phosphate isomerase OS=Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2) GN=mtnA PE=3 SV=1 | 6 | 371 | 5.0E-82 |
sp|D0A8W2|MTNA_TRYB9 | Methylthioribose-1-phosphate isomerase OS=Trypanosoma brucei gambiense (strain MHOM/CI/86/DAL972) GN=TbgDal_XI12320 PE=3 SV=1 | 4 | 380 | 5.0E-82 |
sp|Q383H9|MTNA_TRYB2 | Methylthioribose-1-phosphate isomerase OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) GN=Tb11.01.2780 PE=3 SV=1 | 4 | 380 | 6.0E-82 |
sp|A8XDI8|MTNA_CAEBR | Methylthioribose-1-phosphate isomerase OS=Caenorhabditis briggsae GN=CBG11572 PE=3 SV=1 | 4 | 364 | 1.0E-81 |
sp|Q5H060|MTNA_XANOR | Methylthioribose-1-phosphate isomerase OS=Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85) GN=mtnA PE=3 SV=2 | 9 | 371 | 1.0E-81 |
sp|B2SIW1|MTNA_XANOP | Methylthioribose-1-phosphate isomerase OS=Xanthomonas oryzae pv. oryzae (strain PXO99A) GN=mtnA PE=3 SV=1 | 9 | 371 | 1.0E-81 |
sp|Q2P337|MTNA_XANOM | Methylthioribose-1-phosphate isomerase OS=Xanthomonas oryzae pv. oryzae (strain MAFF 311018) GN=mtnA PE=3 SV=1 | 9 | 371 | 1.0E-81 |
sp|Q9HZ65|MTNA_PSEAE | Methylthioribose-1-phosphate isomerase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=mtnA PE=3 SV=1 | 4 | 371 | 2.0E-81 |
sp|Q02PX5|MTNA_PSEAB | Methylthioribose-1-phosphate isomerase OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=mtnA PE=3 SV=1 | 4 | 371 | 2.0E-81 |
sp|B7V9J7|MTNA_PSEA8 | Methylthioribose-1-phosphate isomerase OS=Pseudomonas aeruginosa (strain LESB58) GN=mtnA PE=3 SV=1 | 4 | 371 | 2.0E-81 |
sp|Q48FM6|MTNA_PSE14 | Methylthioribose-1-phosphate isomerase OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=mtnA PE=3 SV=1 | 4 | 371 | 5.0E-81 |
sp|Q4ZQ92|MTNA_PSEU2 | Methylthioribose-1-phosphate isomerase OS=Pseudomonas syringae pv. syringae (strain B728a) GN=mtnA PE=3 SV=2 | 4 | 371 | 1.0E-80 |
sp|Q8PAB2|MTNA_XANCP | Methylthioribose-1-phosphate isomerase OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=mtnA PE=3 SV=1 | 9 | 371 | 1.0E-80 |
sp|B0RUX9|MTNA_XANCB | Methylthioribose-1-phosphate isomerase OS=Xanthomonas campestris pv. campestris (strain B100) GN=mtnA PE=3 SV=2 | 9 | 371 | 1.0E-80 |
sp|Q4UTB3|MTNA_XANC8 | Methylthioribose-1-phosphate isomerase OS=Xanthomonas campestris pv. campestris (strain 8004) GN=mtnA PE=3 SV=1 | 9 | 371 | 1.0E-80 |
sp|Q93169|MTNA_CAEEL | Methylthioribose-1-phosphate isomerase OS=Caenorhabditis elegans GN=C01G10.9 PE=3 SV=1 | 4 | 382 | 2.0E-80 |
sp|A4VLZ8|MTNA_PSEU5 | Methylthioribose-1-phosphate isomerase OS=Pseudomonas stutzeri (strain A1501) GN=mtnA PE=3 SV=2 | 4 | 368 | 2.0E-80 |
sp|Q4D6B2|MTNA2_TRYCC | Methylthioribose-1-phosphate isomerase 2 OS=Trypanosoma cruzi (strain CL Brener) GN=Tc00.1047053508269.30 PE=3 SV=1 | 4 | 374 | 3.0E-80 |
sp|Q6FVY2|MTNA_CANGA | Methylthioribose-1-phosphate isomerase OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=MRI1 PE=3 SV=1 | 1 | 376 | 3.0E-80 |
sp|Q606P2|MTNA_METCA | Methylthioribose-1-phosphate isomerase OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) GN=mtnA PE=3 SV=1 | 1 | 371 | 3.0E-80 |
sp|Q4CY36|MTNA1_TRYCC | Methylthioribose-1-phosphate isomerase 1 OS=Trypanosoma cruzi (strain CL Brener) GN=Tc00.1047053503971.40 PE=3 SV=1 | 4 | 374 | 4.0E-80 |
sp|Q885T7|MTNA_PSESM | Methylthioribose-1-phosphate isomerase OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=mtnA PE=3 SV=1 | 4 | 371 | 7.0E-80 |
sp|P0CN41|MTNA_CRYNB | Methylthioribose-1-phosphate isomerase OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=MRI1 PE=3 SV=1 | 12 | 368 | 3.0E-79 |
sp|P0CN40|MTNA_CRYNJ | Methylthioribose-1-phosphate isomerase OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=MRI1 PE=3 SV=1 | 12 | 368 | 4.0E-79 |
sp|A3DD27|MTNA_CLOTH | Methylthioribose-1-phosphate isomerase OS=Clostridium thermocellum (strain ATCC 27405 / DSM 1237 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) GN=mtnA PE=3 SV=1 | 1 | 366 | 6.0E-79 |
sp|A6V2Q6|MTNA_PSEA7 | Methylthioribose-1-phosphate isomerase OS=Pseudomonas aeruginosa (strain PA7) GN=mtnA PE=3 SV=1 | 4 | 371 | 6.0E-79 |
sp|Q3K8T8|MTNA_PSEPF | Methylthioribose-1-phosphate isomerase OS=Pseudomonas fluorescens (strain Pf0-1) GN=mtnA PE=3 SV=1 | 4 | 371 | 2.0E-78 |
sp|B9LBK4|MTNA_CHLSY | Methylthioribose-1-phosphate isomerase OS=Chloroflexus aurantiacus (strain ATCC 29364 / DSM 637 / Y-400-fl) GN=mtnA PE=3 SV=1 | 4 | 366 | 3.0E-78 |
sp|A9WGQ8|MTNA_CHLAA | Methylthioribose-1-phosphate isomerase OS=Chloroflexus aurantiacus (strain ATCC 29366 / DSM 635 / J-10-fl) GN=mtnA PE=3 SV=1 | 4 | 366 | 3.0E-78 |
sp|Q2SE63|MTNA_HAHCH | Methylthioribose-1-phosphate isomerase OS=Hahella chejuensis (strain KCTC 2396) GN=mtnA PE=3 SV=1 | 2 | 366 | 3.0E-78 |
sp|B2J5P6|MTNA_NOSP7 | Methylthioribose-1-phosphate isomerase OS=Nostoc punctiforme (strain ATCC 29133 / PCC 73102) GN=mtnA PE=3 SV=1 | 7 | 380 | 4.0E-78 |
sp|B1WQH2|MTNA_CYAA5 | Methylthioribose-1-phosphate isomerase OS=Cyanothece sp. (strain ATCC 51142) GN=mtnA PE=3 SV=2 | 1 | 366 | 6.0E-78 |
sp|C1DRQ7|MTNA_AZOVD | Methylthioribose-1-phosphate isomerase OS=Azotobacter vinelandii (strain DJ / ATCC BAA-1303) GN=mtnA PE=3 SV=1 | 4 | 368 | 2.0E-77 |
sp|A6LJM7|MTNA_THEM4 | Methylthioribose-1-phosphate isomerase OS=Thermosipho melanesiensis (strain DSM 12029 / CIP 104789 / BI429) GN=mtnA PE=3 SV=1 | 7 | 366 | 4.0E-76 |
sp|B1I2P1|MTNA_DESAP | Methylthioribose-1-phosphate isomerase OS=Desulforudis audaxviator (strain MP104C) GN=mtnA PE=3 SV=1 | 3 | 373 | 5.0E-76 |
sp|A4J678|MTNA_DESRM | Methylthioribose-1-phosphate isomerase OS=Desulfotomaculum reducens (strain MI-1) GN=mtnA PE=3 SV=1 | 4 | 366 | 9.0E-76 |
sp|B7IFW5|MTNA_THEAB | Methylthioribose-1-phosphate isomerase OS=Thermosipho africanus (strain TCF52B) GN=mtnA PE=3 SV=1 | 7 | 366 | 1.0E-75 |
sp|Q39ZK3|MTNA_GEOMG | Methylthioribose-1-phosphate isomerase OS=Geobacter metallireducens (strain GS-15 / ATCC 53774 / DSM 7210) GN=mtnA PE=3 SV=1 | 4 | 366 | 2.0E-75 |
sp|A7Z3X0|MTNA_BACMF | Methylthioribose-1-phosphate isomerase OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=mtnA PE=3 SV=1 | 6 | 366 | 2.0E-75 |
sp|B8FRM1|MTNA_DESHD | Methylthioribose-1-phosphate isomerase OS=Desulfitobacterium hafniense (strain DCB-2 / DSM 10664) GN=mtnA PE=3 SV=1 | 4 | 366 | 6.0E-75 |
sp|C5D7U5|MTNA_GEOSW | Methylthioribose-1-phosphate isomerase OS=Geobacillus sp. (strain WCH70) GN=mtnA PE=3 SV=1 | 6 | 366 | 8.0E-75 |
sp|Q8YR82|MTNA_NOSS1 | Methylthioribose-1-phosphate isomerase OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=mtnA PE=3 SV=1 | 7 | 364 | 8.0E-75 |
sp|Q746Y8|MTNA_GEOSL | Methylthioribose-1-phosphate isomerase OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) GN=mtnA PE=3 SV=1 | 4 | 366 | 2.0E-74 |
sp|Q053E2|MTNA_LEPBL | Methylthioribose-1-phosphate isomerase OS=Leptospira borgpetersenii serovar Hardjo-bovis (strain L550) GN=mtnA PE=3 SV=1 | 2 | 366 | 2.0E-74 |
sp|Q04RD6|MTNA_LEPBJ | Methylthioribose-1-phosphate isomerase OS=Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) GN=mtnA PE=3 SV=1 | 2 | 366 | 2.0E-74 |
sp|A5G9J7|MTNA_GEOUR | Methylthioribose-1-phosphate isomerase OS=Geobacter uraniireducens (strain Rf4) GN=mtnA PE=3 SV=1 | 4 | 366 | 3.0E-74 |
sp|A1ALC1|MTNA_PELPD | Methylthioribose-1-phosphate isomerase OS=Pelobacter propionicus (strain DSM 2379) GN=mtnA PE=3 SV=1 | 4 | 366 | 3.0E-74 |
sp|Q24UA0|MTNA_DESHY | Methylthioribose-1-phosphate isomerase OS=Desulfitobacterium hafniense (strain Y51) GN=mtnA PE=3 SV=1 | 4 | 366 | 4.0E-74 |
sp|B2FKI7|MTNA_STRMK | Methylthioribose-1-phosphate isomerase OS=Stenotrophomonas maltophilia (strain K279a) GN=mtnA PE=3 SV=1 | 4 | 366 | 4.0E-74 |
sp|A5D1G8|MTNA_PELTS | Methylthioribose-1-phosphate isomerase OS=Pelotomaculum thermopropionicum (strain DSM 13744 / JCM 10971 / SI) GN=mtnA PE=3 SV=1 | 12 | 374 | 4.0E-74 |
sp|A8YD90|MTNA_MICAE | Methylthioribose-1-phosphate isomerase OS=Microcystis aeruginosa GN=mtnA PE=3 SV=1 | 7 | 366 | 4.0E-74 |
sp|B4SP84|MTNA_STRM5 | Methylthioribose-1-phosphate isomerase OS=Stenotrophomonas maltophilia (strain R551-3) GN=mtnA PE=3 SV=1 | 4 | 366 | 5.0E-74 |
sp|B9LZ20|MTNA_GEODF | Methylthioribose-1-phosphate isomerase OS=Geobacter daltonii (strain DSM 22248 / JCM 15807 / FRC-32) GN=mtnA PE=3 SV=1 | 4 | 366 | 6.0E-74 |
sp|C0QUC0|MTNA_PERMH | Methylthioribose-1-phosphate isomerase OS=Persephonella marina (strain DSM 14350 / EX-H1) GN=mtnA PE=3 SV=1 | 13 | 366 | 7.0E-74 |
sp|A1U3J9|MTNA_MARHV | Methylthioribose-1-phosphate isomerase OS=Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8) GN=mtnA PE=3 SV=1 | 6 | 368 | 7.0E-74 |
sp|B0JPT8|MTNA_MICAN | Methylthioribose-1-phosphate isomerase OS=Microcystis aeruginosa (strain NIES-843) GN=mtnA PE=3 SV=1 | 7 | 366 | 8.0E-74 |
sp|Q3M785|MTNA_ANAVT | Methylthioribose-1-phosphate isomerase OS=Anabaena variabilis (strain ATCC 29413 / PCC 7937) GN=mtnA PE=3 SV=1 | 7 | 364 | 1.0E-73 |
sp|O31662|MTNA_BACSU | Methylthioribose-1-phosphate isomerase OS=Bacillus subtilis (strain 168) GN=mtnA PE=1 SV=1 | 6 | 366 | 2.0E-73 |
sp|A8F3A3|MTNA1_PSELT | Methylthioribose-1-phosphate isomerase 1 OS=Pseudothermotoga lettingae (strain ATCC BAA-301 / DSM 14385 / NBRC 107922 / TMO) GN=mtnA1 PE=3 SV=1 | 7 | 366 | 5.0E-73 |
sp|B0K2V6|MTNA_THEPX | Methylthioribose-1-phosphate isomerase OS=Thermoanaerobacter sp. (strain X514) GN=mtnA PE=3 SV=1 | 1 | 367 | 8.0E-73 |
sp|B0K8S2|MTNA_THEP3 | Methylthioribose-1-phosphate isomerase OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) GN=mtnA PE=3 SV=1 | 1 | 367 | 8.0E-73 |
sp|Q3ABU6|MTNA_CARHZ | Methylthioribose-1-phosphate isomerase OS=Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901) GN=mtnA PE=3 SV=1 | 4 | 366 | 1.0E-72 |
sp|Q65KK2|MTNA_BACLD | Methylthioribose-1-phosphate isomerase OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=mtnA PE=3 SV=1 | 6 | 366 | 2.0E-72 |
sp|B2A5S2|MTNA_NATTJ | Methylthioribose-1-phosphate isomerase OS=Natranaerobius thermophilus (strain ATCC BAA-1301 / DSM 18059 / JW/NM-WN-LF) GN=mtnA PE=3 SV=1 | 1 | 372 | 3.0E-72 |
sp|Q3ZZT1|MTNA_DEHMC | Methylthioribose-1-phosphate isomerase OS=Dehalococcoides mccartyi (strain CBDB1) GN=mtnA PE=3 SV=1 | 4 | 369 | 3.0E-72 |
sp|A5FRU8|MTNA_DEHMB | Methylthioribose-1-phosphate isomerase OS=Dehalococcoides mccartyi (strain ATCC BAA-2100 / JCM 16839 / KCTC 5957 / BAV1) GN=mtnA PE=3 SV=1 | 4 | 369 | 4.0E-72 |
sp|Q8R9L7|MTNA_CALS4 | Methylthioribose-1-phosphate isomerase OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=mtnA PE=3 SV=1 | 1 | 366 | 6.0E-72 |
sp|P74497|MTNA_SYNY3 | Methylthioribose-1-phosphate isomerase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=mtnA PE=3 SV=1 | 7 | 376 | 9.0E-72 |
sp|Q21S04|MTNA_RHOFT | Methylthioribose-1-phosphate isomerase OS=Rhodoferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118) GN=mtnA PE=3 SV=1 | 4 | 392 | 1.0E-71 |
sp|B2V8N9|MTNA_SULSY | Methylthioribose-1-phosphate isomerase OS=Sulfurihydrogenibium sp. (strain YO3AOP1) GN=mtnA PE=3 SV=1 | 14 | 368 | 2.0E-71 |
sp|Q5N076|MTNA_SYNP6 | Methylthioribose-1-phosphate isomerase OS=Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1) GN=mtnA PE=3 SV=1 | 1 | 366 | 3.0E-71 |
sp|Q31LP7|MTNA_SYNE7 | Methylthioribose-1-phosphate isomerase OS=Synechococcus elongatus (strain PCC 7942) GN=mtnA PE=3 SV=1 | 1 | 366 | 3.0E-71 |
sp|Q3Z937|MTNA_DEHM1 | Methylthioribose-1-phosphate isomerase OS=Dehalococcoides mccartyi (strain ATCC BAA-2266 / KCTC 15142 / 195) GN=mtnA PE=3 SV=1 | 4 | 368 | 4.0E-71 |
sp|B1IJF0|MTNA_CLOBK | Methylthioribose-1-phosphate isomerase OS=Clostridium botulinum (strain Okra / Type B1) GN=mtnA PE=3 SV=1 | 1 | 366 | 7.0E-71 |
sp|A7HIG6|MTNA_ANADF | Methylthioribose-1-phosphate isomerase OS=Anaeromyxobacter sp. (strain Fw109-5) GN=mtnA PE=3 SV=1 | 2 | 368 | 7.0E-71 |
sp|B1KZY3|MTNA_CLOBM | Methylthioribose-1-phosphate isomerase OS=Clostridium botulinum (strain Loch Maree / Type A3) GN=mtnA PE=3 SV=1 | 1 | 366 | 7.0E-71 |
sp|A4XTE5|MTNA_PSEMY | Methylthioribose-1-phosphate isomerase OS=Pseudomonas mendocina (strain ymp) GN=mtnA PE=3 SV=1 | 4 | 373 | 7.0E-71 |
sp|B1YIY4|MTNA_EXIS2 | Methylthioribose-1-phosphate isomerase OS=Exiguobacterium sibiricum (strain DSM 17290 / JCM 13490 / 255-15) GN=mtnA PE=3 SV=1 | 4 | 371 | 7.0E-71 |
sp|Q8DK09|MTNA_THEEB | Methylthioribose-1-phosphate isomerase OS=Thermosynechococcus elongatus (strain BP-1) GN=mtnA PE=3 SV=1 | 7 | 366 | 9.0E-71 |
sp|A7NFR2|MTNA_ROSCS | Methylthioribose-1-phosphate isomerase OS=Roseiflexus castenholzii (strain DSM 13941 / HLO8) GN=mtnA PE=3 SV=1 | 2 | 366 | 9.0E-71 |
sp|Q7NP62|MTNA_GLOVI | Methylthioribose-1-phosphate isomerase OS=Gloeobacter violaceus (strain PCC 7421) GN=mtnA PE=3 SV=1 | 2 | 369 | 1.0E-70 |
sp|A5UQK6|MTNA_ROSS1 | Methylthioribose-1-phosphate isomerase OS=Roseiflexus sp. (strain RS-1) GN=mtnA PE=3 SV=1 | 2 | 366 | 3.0E-70 |
sp|Q1ISH2|MTNA_KORVE | Methylthioribose-1-phosphate isomerase OS=Koribacter versatilis (strain Ellin345) GN=mtnA PE=3 SV=1 | 2 | 374 | 3.0E-70 |
sp|Q4K8M6|MTNA_PSEF5 | Methylthioribose-1-phosphate isomerase OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=mtnA PE=3 SV=1 | 4 | 371 | 3.0E-70 |
sp|A5I1A6|MTNA_CLOBH | Methylthioribose-1-phosphate isomerase OS=Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A) GN=mtnA PE=3 SV=1 | 1 | 366 | 4.0E-70 |
sp|A7FTE6|MTNA_CLOB1 | Methylthioribose-1-phosphate isomerase OS=Clostridium botulinum (strain ATCC 19397 / Type A) GN=mtnA PE=3 SV=1 | 1 | 366 | 4.0E-70 |
sp|Q9X013|MTNA_THEMA | Methylthioribose-1-phosphate isomerase OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=mtnA PE=1 SV=1 | 5 | 366 | 5.0E-70 |
sp|Q028S4|MTNA_SOLUE | Methylthioribose-1-phosphate isomerase OS=Solibacter usitatus (strain Ellin6076) GN=mtnA PE=3 SV=1 | 4 | 365 | 5.0E-70 |
sp|Q0AYV4|MTNA_SYNWW | Methylthioribose-1-phosphate isomerase OS=Syntrophomonas wolfei subsp. wolfei (strain DSM 2245B / Goettingen) GN=mtnA PE=3 SV=1 | 9 | 373 | 6.0E-70 |
sp|B1LC23|MTNA_THESQ | Methylthioribose-1-phosphate isomerase OS=Thermotoga sp. (strain RQ2) GN=mtnA PE=3 SV=1 | 5 | 366 | 7.0E-70 |
sp|A5IIM2|MTNA_THEP1 | Methylthioribose-1-phosphate isomerase OS=Thermotoga petrophila (strain RKU-1 / ATCC BAA-488 / DSM 13995) GN=mtnA PE=3 SV=1 | 5 | 366 | 7.0E-70 |
sp|C6E6Z4|MTNA_GEOSM | Methylthioribose-1-phosphate isomerase OS=Geobacter sp. (strain M21) GN=mtnA PE=3 SV=1 | 4 | 366 | 8.0E-70 |
sp|A8FCG5|MTNA_BACP2 | Methylthioribose-1-phosphate isomerase OS=Bacillus pumilus (strain SAFR-032) GN=mtnA PE=3 SV=1 | 6 | 366 | 9.0E-70 |
sp|B9KA57|MTNA_THENN | Methylthioribose-1-phosphate isomerase OS=Thermotoga neapolitana (strain ATCC 49049 / DSM 4359 / NS-E) GN=mtnA PE=3 SV=1 | 5 | 367 | 2.0E-69 |
sp|Q2LXN1|MTNA_SYNAS | Methylthioribose-1-phosphate isomerase OS=Syntrophus aciditrophicus (strain SB) GN=mtnA PE=3 SV=1 | 7 | 375 | 2.0E-69 |
sp|A9BHC5|MTNA2_PETMO | Methylthioribose-1-phosphate isomerase 2 OS=Petrotoga mobilis (strain DSM 10674 / SJ95) GN=mtnA2 PE=3 SV=1 | 7 | 366 | 3.0E-69 |
sp|B3E3M5|MTNA_GEOLS | Methylthioribose-1-phosphate isomerase OS=Geobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ) GN=mtnA PE=3 SV=1 | 4 | 365 | 3.0E-69 |
sp|A8F7V1|MTNA2_PSELT | Methylthioribose-1-phosphate isomerase 2 OS=Pseudothermotoga lettingae (strain ATCC BAA-301 / DSM 14385 / NBRC 107922 / TMO) GN=mtnA2 PE=3 SV=1 | 1 | 366 | 3.0E-69 |
sp|A7HN79|MTNA_FERNB | Methylthioribose-1-phosphate isomerase OS=Fervidobacterium nodosum (strain ATCC 35602 / DSM 5306 / Rt17-B1) GN=mtnA PE=3 SV=1 | 7 | 366 | 3.0E-69 |
sp|B1XJK0|MTNA_SYNP2 | Methylthioribose-1-phosphate isomerase OS=Synechococcus sp. (strain ATCC 27264 / PCC 7002 / PR-6) GN=mtnA PE=3 SV=2 | 4 | 371 | 8.0E-69 |
sp|C1FKZ3|MTNA_CLOBJ | Methylthioribose-1-phosphate isomerase OS=Clostridium botulinum (strain Kyoto / Type A2) GN=mtnA PE=3 SV=1 | 1 | 366 | 9.0E-69 |
sp|B5ED21|MTNA_GEOBB | Methylthioribose-1-phosphate isomerase OS=Geobacter bemidjiensis (strain Bem / ATCC BAA-1014 / DSM 16622) GN=mtnA PE=3 SV=1 | 4 | 366 | 1.0E-68 |
sp|A4ILL1|MTNA_GEOTN | Methylthioribose-1-phosphate isomerase OS=Geobacillus thermodenitrificans (strain NG80-2) GN=mtnA PE=3 SV=1 | 6 | 366 | 1.0E-68 |
sp|A0L909|MTNA_MAGMM | Methylthioribose-1-phosphate isomerase OS=Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1) GN=mtnA PE=3 SV=1 | 16 | 371 | 2.0E-68 |
sp|Q72T46|MTNA_LEPIC | Methylthioribose-1-phosphate isomerase OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130) GN=mtnA PE=3 SV=1 | 2 | 366 | 4.0E-68 |
sp|B0C8J2|MTNA_ACAM1 | Methylthioribose-1-phosphate isomerase OS=Acaryochloris marina (strain MBIC 11017) GN=mtnA PE=3 SV=1 | 2 | 369 | 4.0E-68 |
sp|Q8F2A8|MTNA_LEPIN | Methylthioribose-1-phosphate isomerase OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601) GN=mtnA PE=3 SV=1 | 2 | 366 | 4.0E-68 |
sp|Q1IDA4|MTNA_PSEE4 | Methylthioribose-1-phosphate isomerase OS=Pseudomonas entomophila (strain L48) GN=mtnA PE=3 SV=1 | 7 | 373 | 6.0E-68 |
sp|Q731R7|MTNA_BACC1 | Methylthioribose-1-phosphate isomerase OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=mtnA PE=3 SV=1 | 6 | 366 | 6.0E-68 |
sp|B5YGA0|MTNA_THEYD | Methylthioribose-1-phosphate isomerase OS=Thermodesulfovibrio yellowstonii (strain ATCC 51303 / DSM 11347 / YP87) GN=mtnA PE=3 SV=1 | 1 | 367 | 6.0E-68 |
sp|A7GCV8|MTNA_CLOBL | Methylthioribose-1-phosphate isomerase OS=Clostridium botulinum (strain Langeland / NCTC 10281 / Type F) GN=mtnA PE=3 SV=1 | 1 | 366 | 6.0E-68 |
sp|Q113K5|MTNA_TRIEI | Methylthioribose-1-phosphate isomerase OS=Trichodesmium erythraeum (strain IMS101) GN=mtnA PE=3 SV=1 | 7 | 380 | 8.0E-68 |
sp|Q2RKL8|MTNA_MOOTA | Methylthioribose-1-phosphate isomerase OS=Moorella thermoacetica (strain ATCC 39073) GN=mtnA PE=3 SV=1 | 2 | 366 | 9.0E-68 |
sp|C3KTV5|MTNA_CLOB6 | Methylthioribose-1-phosphate isomerase OS=Clostridium botulinum (strain 657 / Type Ba4) GN=mtnA PE=3 SV=1 | 1 | 366 | 1.0E-67 |
sp|Q81MJ6|MTNA2_BACAN | Methylthioribose-1-phosphate isomerase 2 OS=Bacillus anthracis GN=mtnA2 PE=3 SV=1 | 6 | 366 | 2.0E-67 |
sp|Q0AA70|MTNA_ALKEH | Methylthioribose-1-phosphate isomerase OS=Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1) GN=mtnA PE=3 SV=1 | 4 | 366 | 4.0E-67 |
sp|Q6HED3|MTNA2_BACHK | Methylthioribose-1-phosphate isomerase 2 OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=mtnA2 PE=3 SV=1 | 6 | 366 | 4.0E-67 |
sp|Q3J8U5|MTNA_NITOC | Methylthioribose-1-phosphate isomerase OS=Nitrosococcus oceani (strain ATCC 19707 / NCIMB 11848) GN=mtnA PE=3 SV=1 | 4 | 368 | 4.0E-67 |
sp|A9VFD5|MTNA2_BACWK | Methylthioribose-1-phosphate isomerase 2 OS=Bacillus weihenstephanensis (strain KBAB4) GN=mtnA2 PE=3 SV=1 | 6 | 366 | 5.0E-67 |
sp|A0RI38|MTNA2_BACAH | Methylthioribose-1-phosphate isomerase 2 OS=Bacillus thuringiensis (strain Al Hakam) GN=mtnA2 PE=3 SV=1 | 6 | 366 | 6.0E-67 |
sp|Q635P7|MTNA2_BACCZ | Methylthioribose-1-phosphate isomerase 2 OS=Bacillus cereus (strain ZK / E33L) GN=mtnA2 PE=3 SV=1 | 6 | 366 | 1.0E-66 |
sp|Q317L9|MTNA_DESAG | Methylthioribose-1-phosphate isomerase OS=Desulfovibrio alaskensis (strain G20) GN=mtnA PE=3 SV=1 | 7 | 366 | 1.0E-66 |
sp|A9VRK3|MTNA1_BACWK | Methylthioribose-1-phosphate isomerase 1 OS=Bacillus weihenstephanensis (strain KBAB4) GN=mtnA1 PE=3 SV=2 | 7 | 366 | 2.0E-66 |
sp|B0TH58|MTNA_HELMI | Methylthioribose-1-phosphate isomerase OS=Heliobacterium modesticaldum (strain ATCC 51547 / Ice1) GN=mtnA PE=3 SV=1 | 4 | 366 | 2.0E-66 |
sp|Q819F2|MTNA2_BACCR | Methylthioribose-1-phosphate isomerase 2 OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=mtnA2 PE=3 SV=1 | 6 | 366 | 2.0E-66 |
sp|Q67MP0|MTNA_SYMTH | Methylthioribose-1-phosphate isomerase OS=Symbiobacterium thermophilum (strain T / IAM 14863) GN=mtnA PE=3 SV=1 | 14 | 365 | 6.0E-66 |
sp|Q3A2J8|MTNA_PELCD | Methylthioribose-1-phosphate isomerase OS=Pelobacter carbinolicus (strain DSM 2380 / Gra Bd 1) GN=mtnA PE=3 SV=1 | 4 | 366 | 1.0E-65 |
sp|A9AYL1|MTNA_HERA2 | Methylthioribose-1-phosphate isomerase OS=Herpetosiphon aurantiacus (strain ATCC 23779 / DSM 785) GN=mtnA PE=3 SV=2 | 16 | 365 | 3.0E-65 |
sp|A1WUJ7|MTNA_HALHL | Methylthioribose-1-phosphate isomerase OS=Halorhodospira halophila (strain DSM 244 / SL1) GN=mtnA PE=3 SV=1 | 4 | 371 | 5.0E-65 |
sp|C6C0F7|MTNA_DESAD | Methylthioribose-1-phosphate isomerase OS=Desulfovibrio salexigens (strain ATCC 14822 / DSM 2638 / NCIB 8403 / VKM B-1763) GN=mtnA PE=3 SV=1 | 5 | 366 | 9.0E-65 |
sp|A9KIE9|MTNA_CLOPH | Methylthioribose-1-phosphate isomerase OS=Clostridium phytofermentans (strain ATCC 700394 / DSM 18823 / ISDg) GN=mtnA PE=3 SV=1 | 14 | 370 | 1.0E-64 |
sp|B0SNY3|MTNA_LEPBP | Methylthioribose-1-phosphate isomerase OS=Leptospira biflexa serovar Patoc (strain Patoc 1 / ATCC 23582 / Paris) GN=mtnA PE=3 SV=1 | 7 | 383 | 1.0E-64 |
sp|B0SFD6|MTNA_LEPBA | Methylthioribose-1-phosphate isomerase OS=Leptospira biflexa serovar Patoc (strain Patoc 1 / Ames) GN=mtnA PE=3 SV=1 | 7 | 383 | 1.0E-64 |
sp|B8J4S7|MTNA_DESDA | Methylthioribose-1-phosphate isomerase OS=Desulfovibrio desulfuricans (strain ATCC 27774 / DSM 6949) GN=mtnA PE=3 SV=1 | 13 | 366 | 1.0E-64 |
sp|A1VHH2|MTNA_DESVV | Methylthioribose-1-phosphate isomerase OS=Desulfovibrio vulgaris subsp. vulgaris (strain DP4) GN=mtnA PE=3 SV=1 | 14 | 366 | 3.0E-64 |
sp|Q72FX9|MTNA_DESVH | Methylthioribose-1-phosphate isomerase OS=Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / NCIMB 8303) GN=mtnA PE=3 SV=1 | 14 | 366 | 3.0E-64 |
sp|A8GAB1|MTNA_SERP5 | Methylthioribose-1-phosphate isomerase OS=Serratia proteamaculans (strain 568) GN=mtnA PE=3 SV=1 | 6 | 366 | 5.0E-64 |
sp|B8DQQ9|MTNA_DESVM | Methylthioribose-1-phosphate isomerase OS=Desulfovibrio vulgaris (strain Miyazaki F / DSM 19637) GN=mtnA PE=3 SV=1 | 14 | 366 | 8.0E-64 |
sp|B1J5G5|MTNA_PSEPW | Methylthioribose-1-phosphate isomerase OS=Pseudomonas putida (strain W619) GN=mtnA PE=3 SV=1 | 7 | 371 | 9.0E-64 |
sp|Q57896|MTNA_METJA | Putative methylthioribose-1-phosphate isomerase OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ0454 PE=3 SV=1 | 10 | 376 | 9.0E-64 |
sp|Q5L1E6|MTNA_GEOKA | Methylthioribose-1-phosphate isomerase OS=Geobacillus kaustophilus (strain HTA426) GN=mtnA PE=3 SV=1 | 6 | 366 | 2.0E-63 |
sp|Q63GN3|MTNA1_BACCZ | Methylthioribose-1-phosphate isomerase 1 OS=Bacillus cereus (strain ZK / E33L) GN=mtnA1 PE=3 SV=2 | 7 | 370 | 2.0E-63 |
sp|Q81ZC2|MTNA1_BACAN | Methylthioribose-1-phosphate isomerase 1 OS=Bacillus anthracis GN=mtnA1 PE=3 SV=1 | 7 | 370 | 2.0E-63 |
sp|A0R946|MTNA1_BACAH | Methylthioribose-1-phosphate isomerase 1 OS=Bacillus thuringiensis (strain Al Hakam) GN=mtnA1 PE=3 SV=2 | 7 | 370 | 2.0E-63 |
sp|O58433|MTNA_PYRHO | Putative methylthioribose-1-phosphate isomerase OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=PH0702 PE=3 SV=1 | 7 | 366 | 3.0E-63 |
sp|Q6HP54|MTNA1_BACHK | Methylthioribose-1-phosphate isomerase 1 OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=mtnA1 PE=3 SV=2 | 7 | 370 | 4.0E-63 |
sp|Q72JR1|MTNA_THET2 | Methylthioribose-1-phosphate isomerase OS=Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) GN=mtnA PE=3 SV=1 | 12 | 366 | 4.0E-63 |
sp|A9BJF6|MTNA1_PETMO | Methylthioribose-1-phosphate isomerase 1 OS=Petrotoga mobilis (strain DSM 10674 / SJ95) GN=mtnA1 PE=3 SV=2 | 11 | 366 | 6.0E-63 |
sp|Q81IK7|MTNA1_BACCR | Methylthioribose-1-phosphate isomerase 1 OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=mtnA1 PE=3 SV=2 | 7 | 370 | 1.0E-62 |
sp|A8ANI3|MTNA_CITK8 | Methylthioribose-1-phosphate isomerase OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=mtnA PE=3 SV=1 | 6 | 366 | 1.0E-62 |
sp|A4W7Z1|MTNA_ENT38 | Methylthioribose-1-phosphate isomerase OS=Enterobacter sp. (strain 638) GN=mtnA PE=3 SV=1 | 6 | 366 | 2.0E-62 |
sp|A7GS56|MTNA_BACCN | Methylthioribose-1-phosphate isomerase OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=mtnA PE=3 SV=1 | 6 | 367 | 2.0E-62 |
sp|Q5SJE2|MTNA_THET8 | Methylthioribose-1-phosphate isomerase OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=mtnA PE=3 SV=1 | 12 | 366 | 3.0E-62 |
sp|A6ULQ4|MTNA_SINMW | Methylthioribose-1-phosphate isomerase OS=Sinorhizobium medicae (strain WSM419) GN=mtnA PE=3 SV=1 | 16 | 383 | 4.0E-62 |
sp|B0KTX5|MTNA_PSEPG | Methylthioribose-1-phosphate isomerase OS=Pseudomonas putida (strain GB-1) GN=mtnA PE=3 SV=1 | 6 | 371 | 4.0E-62 |
sp|Q8U178|MTNA_PYRFU | Putative methylthioribose-1-phosphate isomerase OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=PF1349 PE=3 SV=1 | 6 | 366 | 5.0E-62 |
sp|Q88M09|MTNA_PSEPK | Methylthioribose-1-phosphate isomerase OS=Pseudomonas putida (strain KT2440) GN=mtnA PE=3 SV=1 | 6 | 373 | 8.0E-62 |
sp|Q3AWF5|MTNA_SYNS9 | Methylthioribose-1-phosphate isomerase OS=Synechococcus sp. (strain CC9902) GN=mtnA PE=3 SV=1 | 1 | 367 | 1.0E-61 |
sp|A9FD66|MTNA_SORC5 | Methylthioribose-1-phosphate isomerase OS=Sorangium cellulosum (strain So ce56) GN=mtnA PE=3 SV=2 | 14 | 364 | 2.0E-61 |
sp|A6LE92|MTNA_PARD8 | Methylthioribose-1-phosphate isomerase OS=Parabacteroides distasonis (strain ATCC 8503 / DSM 20701 / NCTC 11152) GN=mtnA PE=3 SV=2 | 14 | 369 | 3.0E-61 |
sp|Q7UF90|MTNA_RHOBA | Methylthioribose-1-phosphate isomerase OS=Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1) GN=mtnA PE=3 SV=1 | 1 | 371 | 3.0E-61 |
sp|O67879|MTNA_AQUAE | Methylthioribose-1-phosphate isomerase OS=Aquifex aeolicus (strain VF5) GN=mtnA PE=3 SV=1 | 9 | 367 | 4.0E-61 |
sp|A1JP09|MTNA_YERE8 | Methylthioribose-1-phosphate isomerase OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=mtnA PE=3 SV=1 | 6 | 369 | 1.0E-60 |
sp|A5W7G2|MTNA_PSEP1 | Methylthioribose-1-phosphate isomerase OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=mtnA PE=3 SV=1 | 6 | 371 | 6.0E-60 |
sp|B8ES44|MTNA_METSB | Methylthioribose-1-phosphate isomerase OS=Methylocella silvestris (strain BL2 / DSM 15510 / NCIMB 13906) GN=mtnA PE=3 SV=1 | 16 | 367 | 8.0E-60 |
sp|Q9UZ16|MTNA_PYRAB | Putative methylthioribose-1-phosphate isomerase OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=aIF-2BI PE=3 SV=1 | 6 | 366 | 1.0E-59 |
sp|Q47AR7|MTNA_DECAR | Methylthioribose-1-phosphate isomerase OS=Dechloromonas aromatica (strain RCB) GN=mtnA PE=3 SV=1 | 11 | 376 | 1.0E-59 |
sp|C6DCZ1|MTNA_PECCP | Methylthioribose-1-phosphate isomerase OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=mtnA PE=3 SV=1 | 6 | 366 | 1.0E-59 |
sp|A6X8E9|MTNA_OCHA4 | Methylthioribose-1-phosphate isomerase OS=Ochrobactrum anthropi (strain ATCC 49188 / DSM 6882 / NCTC 12168) GN=mtnA PE=3 SV=1 | 16 | 383 | 1.0E-59 |
sp|B5XZW2|MTNA_KLEP3 | Methylthioribose-1-phosphate isomerase OS=Klebsiella pneumoniae (strain 342) GN=mtnA PE=3 SV=1 | 6 | 366 | 2.0E-59 |
sp|Q7U4V1|MTNA_SYNPX | Methylthioribose-1-phosphate isomerase OS=Synechococcus sp. (strain WH8102) GN=mtnA PE=3 SV=2 | 1 | 367 | 2.0E-59 |
sp|O29877|MTNA_ARCFU | Putative methylthioribose-1-phosphate isomerase OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=AF_0370 PE=1 SV=1 | 14 | 366 | 3.0E-59 |
sp|A6T656|MTNA_KLEP7 | Methylthioribose-1-phosphate isomerase OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=mtnA PE=3 SV=1 | 6 | 366 | 5.0E-59 |
sp|Q92TI2|MTNA_RHIME | Methylthioribose-1-phosphate isomerase OS=Rhizobium meliloti (strain 1021) GN=mtnA PE=3 SV=1 | 16 | 384 | 5.0E-59 |
sp|B4UIU8|MTNA_ANASK | Methylthioribose-1-phosphate isomerase OS=Anaeromyxobacter sp. (strain K) GN=mtnA PE=3 SV=1 | 3 | 367 | 1.0E-58 |
sp|A7MKX3|MTNA_CROS8 | Methylthioribose-1-phosphate isomerase OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=mtnA PE=3 SV=1 | 13 | 374 | 1.0E-58 |
sp|Q2IH96|MTNA_ANADE | Methylthioribose-1-phosphate isomerase OS=Anaeromyxobacter dehalogenans (strain 2CP-C) GN=mtnA PE=3 SV=1 | 2 | 366 | 2.0E-58 |
sp|O27900|MTNA_METTH | Putative methylthioribose-1-phosphate isomerase OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=MTH_1872 PE=3 SV=1 | 4 | 367 | 3.0E-58 |
sp|B8IEX1|MTNA_METNO | Methylthioribose-1-phosphate isomerase OS=Methylobacterium nodulans (strain ORS2060 / LMG 21967) GN=mtnA PE=3 SV=1 | 14 | 387 | 7.0E-58 |
sp|B1JIK3|MTNA_YERPY | Methylthioribose-1-phosphate isomerase OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=mtnA PE=3 SV=1 | 6 | 383 | 7.0E-58 |
sp|A4TPM9|MTNA_YERPP | Methylthioribose-1-phosphate isomerase OS=Yersinia pestis (strain Pestoides F) GN=mtnA PE=3 SV=1 | 6 | 383 | 7.0E-58 |
sp|A9R2Z5|MTNA_YERPG | Methylthioribose-1-phosphate isomerase OS=Yersinia pestis bv. Antiqua (strain Angola) GN=mtnA PE=3 SV=1 | 6 | 383 | 7.0E-58 |
sp|A7FLL1|MTNA_YERP3 | Methylthioribose-1-phosphate isomerase OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=mtnA PE=3 SV=1 | 6 | 383 | 7.0E-58 |
sp|Q66E16|MTNA_YERPS | Methylthioribose-1-phosphate isomerase OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=mtnA PE=3 SV=1 | 6 | 383 | 8.0E-58 |
sp|B2K633|MTNA_YERPB | Methylthioribose-1-phosphate isomerase OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=mtnA PE=3 SV=1 | 6 | 383 | 8.0E-58 |
sp|Q2NFJ6|MTNA_METST | Putative methylthioribose-1-phosphate isomerase OS=Methanosphaera stadtmanae (strain ATCC 43021 / DSM 3091 / JCM 11832 / MCB-3) GN=Msp_1023 PE=3 SV=1 | 4 | 365 | 1.0E-57 |
sp|B7KZ66|MTNA_METC4 | Methylthioribose-1-phosphate isomerase OS=Methylobacterium extorquens (strain CM4 / NCIMB 13688) GN=mtnA PE=3 SV=1 | 14 | 387 | 4.0E-57 |
sp|A0LIZ1|MTNA_SYNFM | Methylthioribose-1-phosphate isomerase OS=Syntrophobacter fumaroxidans (strain DSM 10017 / MPOB) GN=mtnA PE=3 SV=1 | 4 | 368 | 6.0E-57 |
sp|Q3AMB7|MTNA_SYNSC | Methylthioribose-1-phosphate isomerase OS=Synechococcus sp. (strain CC9605) GN=mtnA PE=3 SV=1 | 1 | 367 | 2.0E-56 |
sp|A5FUV7|MTNA_ACICJ | Methylthioribose-1-phosphate isomerase OS=Acidiphilium cryptum (strain JF-5) GN=mtnA PE=3 SV=1 | 11 | 365 | 7.0E-56 |
sp|Q4JB92|MTNA_SULAC | Putative methylthioribose-1-phosphate isomerase OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=Saci_0539 PE=3 SV=1 | 9 | 366 | 8.0E-56 |
sp|Q8KBH1|MTNA_CHLTE | Methylthioribose-1-phosphate isomerase OS=Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) GN=mtnA PE=3 SV=1 | 4 | 366 | 1.0E-55 |
sp|Q9YE84|MTNA_AERPE | Putative methylthioribose-1-phosphate isomerase OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) GN=APE_0686 PE=3 SV=1 | 9 | 367 | 2.0E-55 |
sp|Q5YQZ6|MTNAB_NOCFA | Probable bifunctional methylthioribose-1-phosphate isomerase/methylthioribulose-1-phosphate dehydratase OS=Nocardia farcinica (strain IFM 10152) GN=mtnAB PE=3 SV=1 | 1 | 366 | 5.0E-55 |
sp|B1ZL76|MTNA_METPB | Methylthioribose-1-phosphate isomerase OS=Methylobacterium populi (strain ATCC BAA-705 / NCIMB 13946 / BJ001) GN=mtnA PE=3 SV=1 | 16 | 387 | 1.0E-53 |
sp|Q5FQK0|MTNA_GLUOX | Methylthioribose-1-phosphate isomerase OS=Gluconobacter oxydans (strain 621H) GN=mtnA PE=3 SV=1 | 16 | 386 | 3.0E-53 |
sp|B8FLU0|MTNA_DESAA | Methylthioribose-1-phosphate isomerase OS=Desulfatibacillum alkenivorans (strain AK-01) GN=mtnA PE=3 SV=1 | 16 | 372 | 2.0E-52 |
sp|A8ZYA5|MTNA_DESOH | Methylthioribose-1-phosphate isomerase OS=Desulfococcus oleovorans (strain DSM 6200 / Hxd3) GN=mtnA PE=3 SV=1 | 10 | 384 | 3.0E-52 |
sp|C1A6J9|MTNA_GEMAT | Methylthioribose-1-phosphate isomerase OS=Gemmatimonas aurantiaca (strain T-27 / DSM 14586 / JCM 11422 / NBRC 100505) GN=mtnA PE=3 SV=1 | 14 | 379 | 4.0E-51 |
sp|Q2VZP8|MTNA_MAGSA | Methylthioribose-1-phosphate isomerase OS=Magnetospirillum magneticum (strain AMB-1 / ATCC 700264) GN=mtnA PE=3 SV=1 | 16 | 383 | 4.0E-51 |
sp|B9KQ55|MTNA_RHOSK | Methylthioribose-1-phosphate isomerase OS=Rhodobacter sphaeroides (strain KD131 / KCTC 12085) GN=mtnA PE=3 SV=1 | 2 | 365 | 7.0E-51 |
sp|B7NGT8|MTNA_ECOLU | Methylthioribose-1-phosphate isomerase OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=mtnA PE=3 SV=1 | 16 | 365 | 3.0E-50 |
sp|B7MMH6|MTNA_ECO45 | Methylthioribose-1-phosphate isomerase OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=mtnA PE=3 SV=1 | 16 | 365 | 3.0E-50 |
sp|B6IUC1|MTNA_RHOCS | Methylthioribose-1-phosphate isomerase OS=Rhodospirillum centenum (strain ATCC 51521 / SW) GN=mtnA PE=3 SV=1 | 16 | 385 | 8.0E-48 |
sp|Q30P36|MTNA_SULDN | Methylthioribose-1-phosphate isomerase OS=Sulfurimonas denitrificans (strain ATCC 33889 / DSM 1251) GN=mtnA PE=3 SV=1 | 14 | 365 | 5.0E-44 |
sp|Q8TUJ1|MTNA_METAC | Putative methylthioribose-1-phosphate isomerase OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=MA_0076 PE=3 SV=1 | 14 | 366 | 3.0E-43 |
sp|Q57586|R15PI_METJA | Ribose 1,5-bisphosphate isomerase OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ0122 PE=3 SV=1 | 35 | 374 | 1.0E-36 |
sp|Q9V281|R15PI_PYRAB | Ribose 1,5-bisphosphate isomerase OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=PYRAB01930 PE=3 SV=1 | 39 | 376 | 1.0E-34 |
sp|Q5JFM9|R15PI_THEKO | Ribose 1,5-bisphosphate isomerase OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=TK0185 PE=1 SV=1 | 39 | 376 | 2.0E-34 |
sp|Q8U4G6|R15PI_PYRFU | Ribose 1,5-bisphosphate isomerase OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=PF0122 PE=3 SV=2 | 39 | 376 | 1.0E-31 |
sp|O57947|R15PI_PYRHO | Ribose 1,5-bisphosphate isomerase OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=PH0208 PE=3 SV=1 | 39 | 376 | 2.0E-30 |
sp|O28242|R15PI_ARCFU | Ribose 1,5-bisphosphate isomerase OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=AF_2037 PE=3 SV=1 | 36 | 366 | 4.0E-29 |
sp|D4GV73|R15PI_HALVD | Ribose 1,5-bisphosphate isomerase OS=Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2) GN=HVO_0966 PE=1 SV=1 | 91 | 364 | 2.0E-25 |
sp|Q9UI10|EI2BD_HUMAN | Translation initiation factor eIF-2B subunit delta OS=Homo sapiens GN=EIF2B4 PE=1 SV=2 | 48 | 366 | 3.0E-12 |
sp|Q9USP0|EI2BA_SCHPO | Translation initiation factor eIF-2B subunit alpha OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tif221 PE=3 SV=1 | 200 | 367 | 2.0E-11 |
sp|Q61749|EI2BD_MOUSE | Translation initiation factor eIF-2B subunit delta OS=Mus musculus GN=Eif2b4 PE=1 SV=2 | 48 | 366 | 5.0E-10 |
sp|O58185|EI2BL_PYRHO | Putative translation initiation factor eIF-2B subunit 2-like OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=PH0440 PE=1 SV=1 | 167 | 366 | 6.0E-10 |
sp|Q54I81|EI2BA_DICDI | Translation initiation factor eIF-2B subunit alpha OS=Dictyostelium discoideum GN=eif2b1 PE=3 SV=1 | 70 | 366 | 6.0E-10 |
sp|Q63186|EI2BD_RAT | Translation initiation factor eIF-2B subunit delta OS=Rattus norvegicus GN=Eif2b4 PE=2 SV=1 | 48 | 366 | 9.0E-10 |
sp|P23140|YPE3_RHORU | Uncharacterized protein in petC 3'region (Fragment) OS=Rhodospirillum rubrum PE=3 SV=1 | 2 | 178 | 4.0E-09 |
sp|P41111|EI2BD_RABIT | Translation initiation factor eIF-2B subunit delta OS=Oryctolagus cuniculus GN=EIF2B4 PE=2 SV=2 | 48 | 366 | 8.0E-09 |
sp|Q3T058|EI2BD_BOVIN | Translation initiation factor eIF-2B subunit delta OS=Bos taurus GN=EIF2B4 PE=2 SV=1 | 48 | 366 | 4.0E-08 |
sp|Q9UYB6|EI2BL_PYRAB | Putative translation initiation factor eIF-2B subunit 2-like OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=PYRAB15920 PE=3 SV=1 | 167 | 366 | 6.0E-08 |
sp|Q5RAR0|EI2BA_PONAB | Translation initiation factor eIF-2B subunit alpha OS=Pongo abelii GN=EIF2B1 PE=2 SV=2 | 200 | 366 | 8.0E-08 |
sp|Q14232|EI2BA_HUMAN | Translation initiation factor eIF-2B subunit alpha OS=Homo sapiens GN=EIF2B1 PE=1 SV=1 | 200 | 366 | 8.0E-08 |
sp|Q4R4V8|EI2BA_MACFA | Translation initiation factor eIF-2B subunit alpha OS=Macaca fascicularis GN=EIF2B1 PE=2 SV=1 | 200 | 366 | 3.0E-07 |
sp|Q54FM3|EI2BD_DICDI | Translation initiation factor eIF-2B subunit delta OS=Dictyostelium discoideum GN=eif2b4 PE=3 SV=1 | 85 | 366 | 5.0E-07 |
sp|Q64270|EI2BA_RAT | Translation initiation factor eIF-2B subunit alpha OS=Rattus norvegicus GN=Eif2b1 PE=2 SV=1 | 200 | 366 | 1.0E-06 |
sp|Q99LC8|EI2BA_MOUSE | Translation initiation factor eIF-2B subunit alpha OS=Mus musculus GN=Eif2b1 PE=1 SV=1 | 200 | 366 | 1.0E-06 |
sp|Q99LD9|EI2BB_MOUSE | Translation initiation factor eIF-2B subunit beta OS=Mus musculus GN=Eif2b2 PE=1 SV=1 | 199 | 364 | 5.0E-06 |
sp|P14741|EI2BA_YEAST | Translation initiation factor eIF-2B subunit alpha OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GCN3 PE=1 SV=1 | 202 | 347 | 7.0E-06 |
sp|Q0IIF2|EI2BA_BOVIN | Translation initiation factor eIF-2B subunit alpha OS=Bos taurus GN=EIF2B1 PE=2 SV=1 | 200 | 289 | 8.0E-06 |
sp|P34604|EI2BA_CAEEL | Probable translation initiation factor eIF-2B subunit alpha OS=Caenorhabditis elegans GN=ZK1098.4 PE=1 SV=1 | 165 | 314 | 9.0E-06 |
GO Term | Description | Terminal node |
---|---|---|
GO:0044237 | cellular metabolic process | Yes |
GO:0008152 | metabolic process | No |
GO:0008150 | biological_process | No |
GO:0009987 | cellular process | No |
SignalP signal predicted | Location (based on Ymax) |
D score (significance: > 0.45) |
---|---|---|
No | 1 - 12 | 0.45 |
Type of sequence | Sequence |
---|---|
Locus | Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded. |
Protein | >OphauB2|5876 MSPLEAVKYSRGKLLVLDQLRLPHELHYDAVASRQDAFDSIASMRVRGAPAIAIVASLGLAVELDSSPPRSSSAA DCVAHIDSALDYVQGSRPTAVDLTNAVLRLKTCVRQAAAGERASSKSVVEAFIQEAEAIFERDLQTNLSIGQYGA SWLGGHAGGCGGDKISILTHCNTGSLATSGHGTALGIVRTLHSQRLLGHVFCTETRPYNQGSRLTAFELVHEGIP ATLITDSMAAALLRTRASLCNMAAVVVGADRVVRNGDTANKIGTYQLAVLARHHGIKFVVAAPTTSIDLETLTGD GIEIEERKPQELSQVTGAVIGPDGSVDTSTKVRVATADQRIGVWNPAFDVTPAALIDAIVTERGVIEKGPDGSFD LGNFVPERQAAAGSHATA* |
Coding | >OphauB2|5876 ATGTCGCCGCTCGAGGCCGTCAAGTACTCGCGAGGAAAGCTGCTAGTGCTAGACCAGCTCCGCCTCCCTCACGAG TTGCACTACGATGCCGTCGCCTCGCGCCAAGATGCCTTTGATAGCATTGCATCCATGCGGGTGCGCGGCGCCCCA GCCATTGCCATTGTTGCCAGCCTTGGCCTGGCCGTGGAGCTGGACTCGAGTCCGCCTCGCAGCTCGTCGGCCGCA GATTGTGTCGCGCACATTGACTCTGCCCTCGACTATGTGCAAGGGAGCCGCCCGACGGCTGTCGACTTGACCAAT GCGGTGCTGCGGCTCAAGACGTGTGTGCGGCAAGCAGCGGCGGGCGAGAGGGCCAGTAGCAAGAGTGTAGTGGAA GCCTTTATACAAGAGGCCGAGGCCATTTTCGAGAGGGACTTGCAGACAAACCTGTCGATTGGGCAATACGGCGCG TCGTGGCTTGGTGGGCATGCCGGTGGGTGTGGAGGAGACAAGATTTCCATCCTGACACATTGTAATACGGGCTCG CTGGCCACGTCGGGCCATGGCACTGCACTGGGTATTGTGCGCACGCTACATAGCCAGCGCCTGCTTGGCCACGTC TTTTGCACCGAGACACGCCCCTATAACCAGGGCAGCCGCCTAACCGCCTTTGAGCTCGTCCACGAGGGGATCCCC GCCACGCTCATCACCGACTCCATGGCGGCGGCGCTCTTGCGCACTCGCGCATCCTTGTGCAACATGGCGGCTGTC GTGGTAGGCGCTGACCGCGTGGTGCGCAACGGAGACACGGCAAACAAGATTGGCACCTATCAGCTTGCAGTGCTC GCTCGCCACCACGGCATCAAGTTTGTCGTTGCCGCGCCAACAACGAGCATTGATCTAGAGACTCTGACTGGCGAC GGCATCGAGATTGAGGAGCGCAAGCCGCAGGAGCTCTCGCAAGTCACTGGCGCCGTCATTGGGCCAGACGGGAGC GTCGACACAAGCACAAAGGTGCGTGTGGCTACGGCAGACCAGAGAATAGGCGTCTGGAACCCGGCTTTTGATGTT ACGCCCGCAGCCCTCATTGACGCCATTGTGACGGAGCGCGGAGTCATTGAAAAGGGGCCAGACGGCAGCTTTGAC TTGGGCAACTTTGTGCCAGAGCGACAAGCAGCCGCCGGCTCCCATGCCACGGCCTGA |
Transcript | >OphauB2|5876 ATGTCGCCGCTCGAGGCCGTCAAGTACTCGCGAGGAAAGCTGCTAGTGCTAGACCAGCTCCGCCTCCCTCACGAG TTGCACTACGATGCCGTCGCCTCGCGCCAAGATGCCTTTGATAGCATTGCATCCATGCGGGTGCGCGGCGCCCCA GCCATTGCCATTGTTGCCAGCCTTGGCCTGGCCGTGGAGCTGGACTCGAGTCCGCCTCGCAGCTCGTCGGCCGCA GATTGTGTCGCGCACATTGACTCTGCCCTCGACTATGTGCAAGGGAGCCGCCCGACGGCTGTCGACTTGACCAAT GCGGTGCTGCGGCTCAAGACGTGTGTGCGGCAAGCAGCGGCGGGCGAGAGGGCCAGTAGCAAGAGTGTAGTGGAA GCCTTTATACAAGAGGCCGAGGCCATTTTCGAGAGGGACTTGCAGACAAACCTGTCGATTGGGCAATACGGCGCG TCGTGGCTTGGTGGGCATGCCGGTGGGTGTGGAGGAGACAAGATTTCCATCCTGACACATTGTAATACGGGCTCG CTGGCCACGTCGGGCCATGGCACTGCACTGGGTATTGTGCGCACGCTACATAGCCAGCGCCTGCTTGGCCACGTC TTTTGCACCGAGACACGCCCCTATAACCAGGGCAGCCGCCTAACCGCCTTTGAGCTCGTCCACGAGGGGATCCCC GCCACGCTCATCACCGACTCCATGGCGGCGGCGCTCTTGCGCACTCGCGCATCCTTGTGCAACATGGCGGCTGTC GTGGTAGGCGCTGACCGCGTGGTGCGCAACGGAGACACGGCAAACAAGATTGGCACCTATCAGCTTGCAGTGCTC GCTCGCCACCACGGCATCAAGTTTGTCGTTGCCGCGCCAACAACGAGCATTGATCTAGAGACTCTGACTGGCGAC GGCATCGAGATTGAGGAGCGCAAGCCGCAGGAGCTCTCGCAAGTCACTGGCGCCGTCATTGGGCCAGACGGGAGC GTCGACACAAGCACAAAGGTGCGTGTGGCTACGGCAGACCAGAGAATAGGCGTCTGGAACCCGGCTTTTGATGTT ACGCCCGCAGCCCTCATTGACGCCATTGTGACGGAGCGCGGAGTCATTGAAAAGGGGCCAGACGGCAGCTTTGAC TTGGGCAACTTTGTGCCAGAGCGACAAGCAGCCGCCGGCTCCCATGCCACGGCCTGA |
Gene | >OphauB2|5876 ATGTCGCCGCTCGAGGCCGTCAAGTACTCGCGAGGAAAGCTGCTAGTGCTAGACCAGCTCCGCCTCCCTCACGAG TTGCACTACGATGCCGTCGCCTCGCGCCAAGATGCCTTTGATAGCATTGCATCCATGCGGGTGCGCGGCGCCCCA GCCATTGCCATTGTTGCCAGCCTTGGCCTGGCCGTGGAGCTGGACTCGAGTCCGCCTCGCAGCTCGTCGGCCGCA GATTGTGTCGCGCACATTGACTCTGCCCTCGACTATGTGCAAGGGAGCCGCCCGACGGCTGTCGACTTGACCAAT GCGGTGCTGCGGCTCAAGACGTGTGTGCGGCAAGCAGCGGCGGGCGAGAGGGCCAGTAGCAAGAGTGTAGTGGAA GCCTTTATACAAGAGGCCGAGGCCATTTTCGAGAGGGACTTGCAGACAAACCTGTCGATTGGGCAATACGGCGCG TCGTGGCTTGGTGGGCATGCCGGTGGGTGTGGAGGAGACAAGATTTCCATCCTGACACATTGTAATACGGGCTCG CTGGCCACGTCGGGCCATGGCACTGCACTGGGTATTGTGCGCACGCTACATAGCCAGCGCCTGCTTGGCCACGTC TTTTGCACCGAGACACGCCCCTATAACCAGGGCAGCCGCCTAACCGCCTTTGAGCTCGTCCACGAGGGGATCCCC GCCACGCTCATCACCGACTCCATGGCGGCGGCGCTCTTGCGCACTCGCGCATCCTTGTGCAACATGGCGGCTGTC GTGGTAGGCGCTGACCGCGTGGTGCGCAACGGAGACACGGCAAACAAGATTGGCACCTATCAGCTTGCAGTGCTC GCTCGCCACCACGGCATCAAGTTTGTCGTTGCCGCGCCAACAACGAGCATTGATCTAGAGACTCTGACTGGCGAC GGCATCGAGATTGAGGAGCGCAAGCCGCAGGAGCTCTCGCAAGTCACTGGCGCCGTCATTGGGCCAGACGGGAGC GTCGACACAAGCACAAAGGTGCGTGTGGCTACGGCAGACCAGAGAATAGGCGTCTGGAACCCGGCTTTTGATGTT ACGCCCGCAGCCCTCATTGACGCCATTGTGACGGAGCGCGGAGTCATTGAAAAGGGGCCAGACGGCAGCTTTGAC TTGGGCAACTTTGTGCCAGAGCGACAAGCAGCCGCCGGCTCCCATGCCACGGCCTGA |