Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|5870
Gene name
LocationContig_5:39851..45385
Strand+
Gene length (bp)5534
Transcript length (bp)5391
Coding sequence length (bp)5391
Protein length (aa) 1797

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00176 SNF2-rel_dom SNF2-related domain 6.8E-71 945 1225
PF00271 Helicase_C Helicase conserved C-terminal domain 3.4E-18 1488 1600
PF04851 ResIII Type III restriction enzyme, res subunit 1.4E-08 926 1086
PF07529 HSA HSA domain 2.7E-05 425 487

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q4IAK7|SWR1_GIBZE Helicase SWR1 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=SWR1 PE=3 SV=1 93 1779 0.0E+00
sp|Q7S133|SWR1_NEUCR Helicase swr-1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=crf1-1 PE=3 SV=1 131 1796 0.0E+00
sp|Q5ARK3|SWR1_EMENI Helicase swr1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=swr1 PE=3 SV=2 147 1796 0.0E+00
sp|Q4WAS9|SWR1_ASPFU Helicase swr1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=swr1 PE=3 SV=1 881 1781 0.0E+00
sp|Q759G7|SWR1_ASHGO Helicase SWR1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=SWR1 PE=3 SV=2 913 1724 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q4IAK7|SWR1_GIBZE Helicase SWR1 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=SWR1 PE=3 SV=1 93 1779 0.0E+00
sp|Q7S133|SWR1_NEUCR Helicase swr-1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=crf1-1 PE=3 SV=1 131 1796 0.0E+00
sp|Q5ARK3|SWR1_EMENI Helicase swr1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=swr1 PE=3 SV=2 147 1796 0.0E+00
sp|Q4WAS9|SWR1_ASPFU Helicase swr1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=swr1 PE=3 SV=1 881 1781 0.0E+00
sp|Q759G7|SWR1_ASHGO Helicase SWR1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=SWR1 PE=3 SV=2 913 1724 0.0E+00
sp|O13682|SWR1_SCHPO Helicase swr1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=swr1 PE=3 SV=1 895 1770 0.0E+00
sp|Q6CJ38|SWR1_KLULA Helicase SWR1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=SWR1 PE=3 SV=1 883 1767 0.0E+00
sp|Q59U81|SWR1_CANAL Helicase SWR1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SWR1 PE=3 SV=1 889 1767 0.0E+00
sp|Q05471|SWR1_YEAST Helicase SWR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SWR1 PE=1 SV=1 913 1721 0.0E+00
sp|Q6CA87|SWR1_YARLI Helicase SWR1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=SWR1 PE=3 SV=1 911 1654 0.0E+00
sp|Q6FK48|SWR1_CANGA Helicase SWR1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=SWR1 PE=3 SV=1 907 1767 0.0E+00
sp|Q6BKC2|SWR1_DEBHA Helicase SWR1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=SWR1 PE=3 SV=2 914 1767 0.0E+00
sp|Q4P328|SWR1_USTMA Helicase SWR1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=SWR1 PE=3 SV=1 915 1738 0.0E+00
sp|P0CO18|SWR1_CRYNJ Helicase SWR1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=SWR1 PE=3 SV=1 920 1770 0.0E+00
sp|P0CO19|SWR1_CRYNB Helicase SWR1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=SWR1 PE=3 SV=1 920 1770 0.0E+00
sp|Q7X9V2|PIE1_ARATH Protein PHOTOPERIOD-INDEPENDENT EARLY FLOWERING 1 OS=Arabidopsis thaliana GN=PIE1 PE=1 SV=1 916 1722 0.0E+00
sp|Q6ZRS2|SRCAP_HUMAN Helicase SRCAP OS=Homo sapiens GN=SRCAP PE=1 SV=3 877 1234 7.0E-136
sp|Q5BAZ5|INO80_EMENI Putative DNA helicase ino80 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=ino80 PE=3 SV=1 893 1660 2.0E-134
sp|Q9NDJ2|DOM_DROME Helicase domino OS=Drosophila melanogaster GN=dom PE=1 SV=2 917 1236 3.0E-132
sp|A1C9W6|INO80_ASPCL Putative DNA helicase ino80 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=ino80 PE=3 SV=1 911 1646 4.0E-132
sp|Q4IL82|INO80_GIBZE Putative DNA helicase INO80 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=INO80 PE=3 SV=1 918 1647 7.0E-131
sp|Q6FV37|INO80_CANGA Putative DNA helicase INO80 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=INO80 PE=3 SV=1 918 1636 4.0E-124
sp|Q9NEL2|SSL1_CAEEL Helicase ssl-1 OS=Caenorhabditis elegans GN=ssl-1 PE=2 SV=4 916 1238 7.0E-122
sp|C0H4W3|HEPF1_PLAF7 Probable ATP-dependent helicase PF08_0048 OS=Plasmodium falciparum (isolate 3D7) GN=PF08_0048 PE=3 SV=1 915 1240 1.0E-111
sp|Q9NDJ2|DOM_DROME Helicase domino OS=Drosophila melanogaster GN=dom PE=1 SV=2 1396 1784 1.0E-88
sp|Q6ZRS2|SRCAP_HUMAN Helicase SRCAP OS=Homo sapiens GN=SRCAP PE=1 SV=3 1323 1795 1.0E-87
sp|Q96L91|EP400_HUMAN E1A-binding protein p400 OS=Homo sapiens GN=EP400 PE=1 SV=4 896 1297 9.0E-83
sp|Q4PGL2|INO80_USTMA Putative DNA helicase INO80 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=INO80 PE=3 SV=1 911 1225 1.0E-81
sp|Q6BGY8|INO80_DEBHA Putative DNA helicase INO80 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=INO80 PE=3 SV=2 920 1234 3.0E-80
sp|Q0CA78|INO80_ASPTN Putative DNA helicase ino80 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=ino80 PE=3 SV=1 895 1234 5.0E-80
sp|A4R227|INO80_MAGO7 Putative DNA helicase INO80 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=INO80 PE=3 SV=1 918 1225 1.0E-79
sp|Q8CHI8|EP400_MOUSE E1A-binding protein p400 OS=Mus musculus GN=Ep400 PE=1 SV=3 896 1234 1.0E-79
sp|A2R9H9|INO80_ASPNC Putative DNA helicase ino80 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=ino80 PE=3 SV=1 911 1225 3.0E-79
sp|Q2UTQ9|INO80_ASPOR Putative DNA helicase ino80 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=ino80 PE=3 SV=1 911 1225 3.0E-79
sp|Q872I5|INO80_NEUCR Putative DNA helicase ino80 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=crf2-1 PE=3 SV=3 918 1225 4.0E-79
sp|Q1DUF9|INO80_COCIM Putative DNA helicase INO80 OS=Coccidioides immitis (strain RS) GN=INO80 PE=3 SV=1 895 1272 4.0E-79
sp|Q4WTV7|INO80_ASPFU Putative DNA helicase ino80 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=ino80 PE=3 SV=1 911 1225 4.0E-79
sp|A1CZE5|INO80_NEOFI Putative DNA helicase ino80 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=ino80 PE=3 SV=1 911 1225 5.0E-79
sp|A7TJI3|INO80_VANPO Putative DNA helicase INO80 OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=INO80 PE=3 SV=1 918 1234 9.0E-79
sp|Q6CNY4|INO80_KLULA Putative DNA helicase INO80 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=INO80 PE=3 SV=1 920 1272 3.0E-78
sp|Q6ZPV2|INO80_MOUSE DNA helicase INO80 OS=Mus musculus GN=Ino80 PE=1 SV=2 920 1225 6.0E-78
sp|Q9ULG1|INO80_HUMAN DNA helicase INO80 OS=Homo sapiens GN=INO80 PE=1 SV=2 920 1225 1.0E-77
sp|A7EQA8|INO80_SCLS1 Putative DNA helicase INO80 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=INO80 PE=3 SV=1 918 1225 1.0E-77
sp|Q59KI4|INO80_CANAL Putative DNA helicase INO80 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=INO80 PE=3 SV=1 920 1272 4.0E-77
sp|Q9NEL2|SSL1_CAEEL Helicase ssl-1 OS=Caenorhabditis elegans GN=ssl-1 PE=2 SV=4 1469 1772 7.0E-77
sp|Q9VDY1|INO80_DROME Putative DNA helicase Ino80 OS=Drosophila melanogaster GN=Ino80 PE=1 SV=2 920 1237 7.0E-77
sp|P53115|INO80_YEAST Putative DNA helicase INO80 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=INO80 PE=1 SV=1 918 1234 7.0E-77
sp|A6ZU34|INO80_YEAS7 Putative DNA helicase INO80 OS=Saccharomyces cerevisiae (strain YJM789) GN=INO80 PE=3 SV=1 918 1234 7.0E-77
sp|Q8RXS6|INO80_ARATH DNA helicase INO80 OS=Arabidopsis thaliana GN=INO80 PE=2 SV=2 917 1225 1.0E-76
sp|Q0UG82|INO80_PHANO Putative DNA helicase INO80 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=INO80 PE=3 SV=2 920 1225 2.0E-76
sp|P0CO16|INO80_CRYNJ Putative DNA helicase INO80 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=INO80 PE=3 SV=1 920 1234 2.0E-76
sp|P0CO17|INO80_CRYNB Putative DNA helicase INO80 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=INO80 PE=3 SV=1 920 1234 2.0E-76
sp|O14148|INO80_SCHPO Putative DNA helicase ino80 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ino80 PE=1 SV=4 911 1225 2.0E-75
sp|Q74Z27|INO80_ASHGO Putative DNA helicase INO80 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=INO80 PE=3 SV=2 918 1272 3.0E-75
sp|A5E0W5|INO80_LODEL Putative DNA helicase ino80 OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=INO80 PE=3 SV=1 918 1225 1.0E-74
sp|Q7G8Y3|ISW2_ORYSJ Probable chromatin-remodeling complex ATPase chain OS=Oryza sativa subsp. japonica GN=Os01g0367900 PE=2 SV=2 920 1225 5.0E-73
sp|Q6PGB8|SMCA1_MOUSE Probable global transcription activator SNF2L1 OS=Mus musculus GN=Smarca1 PE=1 SV=1 925 1225 9.0E-73
sp|Q8RWY3|ISW2_ARATH ISWI chromatin-remodeling complex ATPase CHR11 OS=Arabidopsis thaliana GN=CHR11 PE=1 SV=4 920 1225 2.0E-72
sp|P28370|SMCA1_HUMAN Probable global transcription activator SNF2L1 OS=Homo sapiens GN=SMARCA1 PE=1 SV=2 925 1225 2.0E-72
sp|F4JY24|CHR17_ARATH ISWI chromatin-remodeling complex ATPase CHR17 OS=Arabidopsis thaliana GN=CHR17 PE=1 SV=1 920 1225 3.0E-72
sp|Q91ZW3|SMCA5_MOUSE SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A member 5 OS=Mus musculus GN=Smarca5 PE=1 SV=1 925 1225 4.0E-72
sp|O60264|SMCA5_HUMAN SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A member 5 OS=Homo sapiens GN=SMARCA5 PE=1 SV=1 925 1225 6.0E-72
sp|O94421|SNF22_SCHPO SWI/SNF chromatin-remodeling complex subunit snf22 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=snf22 PE=1 SV=2 921 1251 1.0E-71
sp|F4J9M5|CHR12_ARATH Probable ATP-dependent DNA helicase CHR12 OS=Arabidopsis thaliana GN=CHR12 PE=2 SV=1 917 1226 2.0E-71
sp|P25439|BRM_DROME ATP-dependent helicase brm OS=Drosophila melanogaster GN=brm PE=1 SV=2 921 1225 2.0E-71
sp|Q24368|ISWI_DROME Chromatin-remodeling complex ATPase chain Iswi OS=Drosophila melanogaster GN=Iswi PE=1 SV=1 921 1225 3.0E-71
sp|Q9UTN6|SNF21_SCHPO Chromatin structure-remodeling complex subunit snf21 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=snf21 PE=1 SV=1 917 1251 2.0E-70
sp|A7Z019|SMCA4_BOVIN Transcription activator BRG1 OS=Bos taurus GN=SMARCA4 PE=2 SV=1 921 1225 2.0E-70
sp|P51532|SMCA4_HUMAN Transcription activator BRG1 OS=Homo sapiens GN=SMARCA4 PE=1 SV=2 921 1225 2.0E-70
sp|Q3TKT4|SMCA4_MOUSE Transcription activator BRG1 OS=Mus musculus GN=Smarca4 PE=1 SV=1 921 1225 3.0E-70
sp|Q8K1P7|SMCA4_RAT Transcription activator BRG1 OS=Rattus norvegicus GN=Smarca4 PE=1 SV=1 921 1225 4.0E-70
sp|Q6DIC0|SMCA2_MOUSE Probable global transcription activator SNF2L2 OS=Mus musculus GN=Smarca2 PE=1 SV=1 921 1225 7.0E-70
sp|P51531|SMCA2_HUMAN Probable global transcription activator SNF2L2 OS=Homo sapiens GN=SMARCA2 PE=1 SV=2 921 1225 1.0E-69
sp|P22082|SNF2_YEAST Transcription regulatory protein SNF2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SNF2 PE=1 SV=1 921 1225 3.0E-69
sp|F4K128|CHR23_ARATH Probable ATP-dependent DNA helicase CHR23 OS=Arabidopsis thaliana GN=CHR23 PE=2 SV=1 917 1251 6.0E-69
sp|P32597|STH1_YEAST Nuclear protein STH1/NPS1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=STH1 PE=1 SV=1 921 1251 2.0E-65
sp|E7F1C4|SMRDB_DANRE SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A containing DEAD/H box 1B OS=Danio rerio GN=smarcad1b PE=3 SV=1 906 1224 6.0E-65
sp|P41877|ISW1_CAEEL Chromatin-remodeling complex ATPase chain isw-1 OS=Caenorhabditis elegans GN=isw-1 PE=1 SV=2 920 1225 3.0E-64
sp|Q5FWR0|SMRCD_XENTR SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A containing DEAD/H box 1 OS=Xenopus tropicalis GN=smarcad1 PE=2 SV=1 926 1237 4.0E-64
sp|Q08773|ISW2_YEAST ISWI chromatin-remodeling complex ATPase ISW2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ISW2 PE=1 SV=1 921 1225 5.0E-64
sp|F4IV99|CHR5_ARATH Protein CHROMATIN REMODELING 5 OS=Arabidopsis thaliana GN=CHR5 PE=3 SV=1 897 1225 3.0E-63
sp|D3Z9Z9|SMRCD_RAT SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A containing DEAD/H box 1 OS=Rattus norvegicus GN=Smarcad1 PE=1 SV=1 926 1224 2.0E-62
sp|Q04692|SMRCD_MOUSE SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A containing DEAD/H box 1 OS=Mus musculus GN=Smarcad1 PE=1 SV=2 926 1224 2.0E-62
sp|F4IHS2|SYD_ARATH Chromatin structure-remodeling complex protein SYD OS=Arabidopsis thaliana GN=SYD PE=1 SV=1 922 1224 3.0E-62
sp|P38144|ISW1_YEAST ISWI chromatin-remodeling complex ATPase ISW1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ISW1 PE=1 SV=2 918 1225 7.0E-62
sp|Q5A310|ISW2_CANAL ISWI chromatin-remodeling complex ATPase ISW2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=ISW2 PE=2 SV=1 917 1225 8.0E-62
sp|Q9H4L7|SMRCD_HUMAN SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A containing DEAD/H box 1 OS=Homo sapiens GN=SMARCAD1 PE=1 SV=2 926 1224 8.0E-62
sp|E1B7X9|SMRCD_BOVIN SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A containing DEAD/H box 1 OS=Bos taurus GN=SMARCAD1 PE=3 SV=2 917 1224 1.0E-61
sp|B0R061|SMRDA_DANRE SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A containing DEAD/H box 1A OS=Danio rerio GN=smarcad1a PE=3 SV=1 902 1224 1.0E-60
sp|O14647|CHD2_HUMAN Chromodomain-helicase-DNA-binding protein 2 OS=Homo sapiens GN=CHD2 PE=1 SV=2 910 1221 2.0E-59
sp|P32657|CHD1_YEAST Chromo domain-containing protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CHD1 PE=1 SV=1 895 1262 3.0E-59
sp|E9PZM4|CHD2_MOUSE Chromodomain-helicase-DNA-binding protein 2 OS=Mus musculus GN=Chd2 PE=1 SV=1 910 1221 6.0E-59
sp|Q9XFH4|DDM1_ARATH ATP-dependent DNA helicase DDM1 OS=Arabidopsis thaliana GN=DDM1 PE=1 SV=1 920 1225 5.0E-58
sp|Q12873|CHD3_HUMAN Chromodomain-helicase-DNA-binding protein 3 OS=Homo sapiens GN=CHD3 PE=1 SV=3 892 1225 1.0E-57
sp|Q6EVK6|BRM_ARATH ATP-dependent helicase BRM OS=Arabidopsis thaliana GN=BRM PE=1 SV=1 921 1234 2.0E-57
sp|Q9NRZ9|HELLS_HUMAN Lymphoid-specific helicase OS=Homo sapiens GN=HELLS PE=1 SV=1 925 1251 3.0E-57
sp|Q9US25|HRP1_SCHPO Chromodomain helicase hrp1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=hrp1 PE=1 SV=1 921 1225 1.0E-56
sp|A2A8L1|CHD5_MOUSE Chromodomain-helicase-DNA-binding protein 5 OS=Mus musculus GN=Chd5 PE=1 SV=1 925 1231 1.0E-56
sp|Q7KU24|CHD1_DROME Chromodomain-helicase-DNA-binding protein 1 OS=Drosophila melanogaster GN=Chd1 PE=1 SV=1 916 1225 2.0E-56
sp|Q8TDI0|CHD5_HUMAN Chromodomain-helicase-DNA-binding protein 5 OS=Homo sapiens GN=CHD5 PE=1 SV=1 925 1231 2.0E-56
sp|D3ZD32|CHD5_RAT Chromodomain-helicase-DNA-binding protein 5 OS=Rattus norvegicus GN=Chd5 PE=1 SV=1 925 1225 2.0E-56
sp|A9X4T1|CHD1_BOMMO Chromodomain-helicase-DNA-binding protein 1 OS=Bombyx mori GN=CHD1 PE=1 SV=1 927 1254 5.0E-56
sp|Q9VL72|SMRCD_DROME SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A containing DEAD/H box 1 homolog OS=Drosophila melanogaster GN=Etl1 PE=1 SV=1 888 1224 7.0E-56
sp|B6ZLK2|CHD1_CHICK Chromodomain-helicase-DNA-binding protein 1 OS=Gallus gallus GN=CHD1 PE=1 SV=1 910 1225 2.0E-55
sp|Q60848|HELLS_MOUSE Lymphocyte-specific helicase OS=Mus musculus GN=Hells PE=1 SV=2 925 1194 2.0E-55
sp|Q9S775|PKL_ARATH CHD3-type chromatin-remodeling factor PICKLE OS=Arabidopsis thaliana GN=PKL PE=1 SV=1 920 1225 3.0E-55
sp|P43610|IRC5_YEAST Uncharacterized ATP-dependent helicase IRC5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=IRC5 PE=1 SV=2 920 1200 4.0E-55
sp|Q7ZU90|CHD1L_DANRE Chromodomain-helicase-DNA-binding protein 1-like OS=Danio rerio GN=chd1l PE=2 SV=1 927 1225 6.0E-55
sp|O14646|CHD1_HUMAN Chromodomain-helicase-DNA-binding protein 1 OS=Homo sapiens GN=CHD1 PE=1 SV=2 910 1225 9.0E-55
sp|P40201|CHD1_MOUSE Chromodomain-helicase-DNA-binding protein 1 OS=Mus musculus GN=Chd1 PE=1 SV=3 910 1225 2.0E-54
sp|Q22516|CHD3_CAEEL Chromodomain-helicase-DNA-binding protein 3 homolog OS=Caenorhabditis elegans GN=chd-3 PE=2 SV=2 873 1226 2.0E-54
sp|G5EDG2|SMRCD_CAEEL SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A containing DEAD/H box 1 homolog OS=Caenorhabditis elegans GN=M03C11.8 PE=3 SV=1 918 1224 5.0E-54
sp|O14139|HRP3_SCHPO Chromodomain helicase hrp3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=hrp3 PE=1 SV=1 921 1225 2.0E-53
sp|G5EBZ4|LE418_CAEEL Protein let-418 OS=Caenorhabditis elegans GN=let-418 PE=1 SV=1 925 1226 3.0E-53
sp|Q6PDQ2|CHD4_MOUSE Chromodomain-helicase-DNA-binding protein 4 OS=Mus musculus GN=Chd4 PE=1 SV=1 925 1225 3.0E-53
sp|Q14839|CHD4_HUMAN Chromodomain-helicase-DNA-binding protein 4 OS=Homo sapiens GN=CHD4 PE=1 SV=2 925 1225 4.0E-53
sp|C0H4W3|HEPF1_PLAF7 Probable ATP-dependent helicase PF08_0048 OS=Plasmodium falciparum (isolate 3D7) GN=PF08_0048 PE=3 SV=1 1354 1713 5.0E-53
sp|P31380|FUN30_YEAST ATP-dependent helicase FUN30 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FUN30 PE=1 SV=1 926 1225 3.0E-52
sp|O74842|FFT2_SCHPO ATP-dependent helicase fft2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=fft2 PE=1 SV=1 927 1225 3.0E-51
sp|O97159|CHDM_DROME Chromodomain-helicase-DNA-binding protein Mi-2 homolog OS=Drosophila melanogaster GN=Mi-2 PE=1 SV=2 920 1225 4.0E-51
sp|O42861|FFT3_SCHPO ATP-dependent helicase fft3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=fft3 PE=1 SV=1 927 1225 4.0E-51
sp|F4JTF6|CHR7_ARATH CHD3-type chromatin-remodeling factor CHR7 OS=Arabidopsis thaliana GN=CHR7 PE=2 SV=1 920 1227 3.0E-50
sp|Q86WJ1|CHD1L_HUMAN Chromodomain-helicase-DNA-binding protein 1-like OS=Homo sapiens GN=CHD1L PE=1 SV=2 927 1225 5.0E-50
sp|Q03468|ERCC6_HUMAN DNA excision repair protein ERCC-6 OS=Homo sapiens GN=ERCC6 PE=1 SV=1 918 1229 1.0E-49
sp|P87114|FFT1_SCHPO ATP-dependent helicase fft1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=fft1 PE=3 SV=1 926 1225 3.0E-49
sp|A2R9H9|INO80_ASPNC Putative DNA helicase ino80 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=ino80 PE=3 SV=1 1449 1646 4.0E-49
sp|Q9CXF7|CHD1L_MOUSE Chromodomain-helicase-DNA-binding protein 1-like OS=Mus musculus GN=Chd1l PE=1 SV=1 927 1225 5.0E-49
sp|Q4WTV7|INO80_ASPFU Putative DNA helicase ino80 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=ino80 PE=3 SV=1 1448 1638 1.0E-48
sp|A1CZE5|INO80_NEOFI Putative DNA helicase ino80 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=ino80 PE=3 SV=1 1448 1638 1.0E-48
sp|Q9ULG1|INO80_HUMAN DNA helicase INO80 OS=Homo sapiens GN=INO80 PE=1 SV=2 1406 1660 2.0E-48
sp|A3KFM7|CHD6_MOUSE Chromodomain-helicase-DNA-binding protein 6 OS=Mus musculus GN=Chd6 PE=1 SV=1 927 1279 2.0E-48
sp|D3ZA12|CHD6_RAT Chromodomain-helicase-DNA-binding protein 6 OS=Rattus norvegicus GN=Chd6 PE=1 SV=2 927 1279 2.0E-48
sp|Q0CA78|INO80_ASPTN Putative DNA helicase ino80 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=ino80 PE=3 SV=1 1448 1646 5.0E-48
sp|P32333|MOT1_YEAST TATA-binding protein-associated factor MOT1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MOT1 PE=1 SV=1 873 1226 8.0E-48
sp|Q9VDY1|INO80_DROME Putative DNA helicase Ino80 OS=Drosophila melanogaster GN=Ino80 PE=1 SV=2 1473 1660 9.0E-48
sp|Q2UTQ9|INO80_ASPOR Putative DNA helicase ino80 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=ino80 PE=3 SV=1 1449 1638 1.0E-47
sp|Q1DUF9|INO80_COCIM Putative DNA helicase INO80 OS=Coccidioides immitis (strain RS) GN=INO80 PE=3 SV=1 1448 1646 1.0E-47
sp|Q8TD26|CHD6_HUMAN Chromodomain-helicase-DNA-binding protein 6 OS=Homo sapiens GN=CHD6 PE=1 SV=4 927 1239 1.0E-47
sp|Q9ZUL5|CHR19_ARATH Protein CHROMATIN REMODELING 19 OS=Arabidopsis thaliana GN=ETL1 PE=1 SV=1 927 1251 1.0E-47
sp|Q6ZPV2|INO80_MOUSE DNA helicase INO80 OS=Mus musculus GN=Ino80 PE=1 SV=2 1406 1660 2.0E-47
sp|Q3B7N1|CHD1L_BOVIN Chromodomain-helicase-DNA-binding protein 1-like OS=Bos taurus GN=CHD1L PE=2 SV=1 927 1225 2.0E-47
sp|Q8CHI8|EP400_MOUSE E1A-binding protein p400 OS=Mus musculus GN=Ep400 PE=1 SV=3 1343 1654 3.0E-47
sp|Q9HCK8|CHD8_HUMAN Chromodomain-helicase-DNA-binding protein 8 OS=Homo sapiens GN=CHD8 PE=1 SV=5 924 1235 4.0E-47
sp|Q8RXS6|INO80_ARATH DNA helicase INO80 OS=Arabidopsis thaliana GN=INO80 PE=2 SV=2 1482 1659 6.0E-47
sp|A7EQA8|INO80_SCLS1 Putative DNA helicase INO80 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=INO80 PE=3 SV=1 1473 1638 1.0E-46
sp|Q09XV5|CHD8_MOUSE Chromodomain-helicase-DNA-binding protein 8 OS=Mus musculus GN=Chd8 PE=1 SV=1 924 1235 1.0E-46
sp|Q9JIX5|CHD8_RAT Chromodomain-helicase-DNA-binding protein 8 OS=Rattus norvegicus GN=Chd8 PE=1 SV=2 924 1235 1.0E-46
sp|O43065|MOT1_SCHPO Probable helicase mot1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mot1 PE=1 SV=4 873 1226 2.0E-46
sp|A4R227|INO80_MAGO7 Putative DNA helicase INO80 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=INO80 PE=3 SV=1 1473 1638 5.0E-46
sp|A2AJK6|CHD7_MOUSE Chromodomain-helicase-DNA-binding protein 7 OS=Mus musculus GN=Chd7 PE=1 SV=1 927 1225 1.0E-45
sp|Q9P2D1|CHD7_HUMAN Chromodomain-helicase-DNA-binding protein 7 OS=Homo sapiens GN=CHD7 PE=1 SV=3 927 1225 1.0E-45
sp|Q0UG82|INO80_PHANO Putative DNA helicase INO80 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=INO80 PE=3 SV=2 1468 1646 2.0E-45
sp|Q872I5|INO80_NEUCR Putative DNA helicase ino80 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=crf2-1 PE=3 SV=3 1473 1635 3.0E-45
sp|Q06A37|CHD7_CHICK Chromodomain-helicase-DNA-binding protein 7 OS=Gallus gallus GN=CHD7 PE=2 SV=1 927 1225 3.0E-45
sp|B0R0I6|CHD8_DANRE Chromodomain-helicase-DNA-binding protein 8 OS=Danio rerio GN=chd8 PE=3 SV=2 927 1225 1.0E-44
sp|O16102|CHD3_DROME Chromodomain-helicase-DNA-binding protein 3 OS=Drosophila melanogaster GN=Chd3 PE=2 SV=3 927 1225 1.0E-44
sp|Q3L8U1|CHD9_HUMAN Chromodomain-helicase-DNA-binding protein 9 OS=Homo sapiens GN=CHD9 PE=1 SV=2 927 1242 1.0E-44
sp|P0CO16|INO80_CRYNJ Putative DNA helicase INO80 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=INO80 PE=3 SV=1 1477 1635 2.0E-44
sp|P0CO17|INO80_CRYNB Putative DNA helicase INO80 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=INO80 PE=3 SV=1 1477 1635 2.0E-44
sp|Q8BYH8|CHD9_MOUSE Chromodomain-helicase-DNA-binding protein 9 OS=Mus musculus GN=Chd9 PE=1 SV=2 927 1235 2.0E-44
sp|B5DE69|CHD8_XENTR Chromodomain-helicase-DNA-binding protein 8 OS=Xenopus tropicalis GN=chd8 PE=2 SV=2 927 1235 2.0E-44
sp|F4KBP5|CHR4_ARATH Protein CHROMATIN REMODELING 4 OS=Arabidopsis thaliana GN=CHR4 PE=2 SV=1 904 1225 2.0E-44
sp|O14148|INO80_SCHPO Putative DNA helicase ino80 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ino80 PE=1 SV=4 1456 1639 3.0E-44
sp|Q4PGL2|INO80_USTMA Putative DNA helicase INO80 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=INO80 PE=3 SV=1 1474 1635 4.0E-44
sp|F4J9M5|CHR12_ARATH Probable ATP-dependent DNA helicase CHR12 OS=Arabidopsis thaliana GN=CHR12 PE=2 SV=1 1487 1642 8.0E-44
sp|Q96L91|EP400_HUMAN E1A-binding protein p400 OS=Homo sapiens GN=EP400 PE=1 SV=4 1474 1654 1.0E-43
sp|P40352|RAD26_YEAST DNA repair and recombination protein RAD26 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RAD26 PE=1 SV=1 918 1228 1.0E-43
sp|F4K128|CHR23_ARATH Probable ATP-dependent DNA helicase CHR23 OS=Arabidopsis thaliana GN=CHR23 PE=2 SV=1 1487 1642 2.0E-43
sp|Q59KI4|INO80_CANAL Putative DNA helicase INO80 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=INO80 PE=3 SV=1 1473 1635 1.0E-42
sp|Q24368|ISWI_DROME Chromatin-remodeling complex ATPase chain Iswi OS=Drosophila melanogaster GN=Iswi PE=1 SV=1 1482 1699 1.0E-42
sp|P32597|STH1_YEAST Nuclear protein STH1/NPS1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=STH1 PE=1 SV=1 1481 1640 2.0E-42
sp|A5E0W5|INO80_LODEL Putative DNA helicase ino80 OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=INO80 PE=3 SV=1 1473 1642 3.0E-42
sp|B5BT18|BTAF1_ARATH TATA-binding protein-associated factor BTAF1 OS=Arabidopsis thaliana GN=BTAF1 PE=1 SV=1 923 1226 3.0E-42
sp|P22082|SNF2_YEAST Transcription regulatory protein SNF2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SNF2 PE=1 SV=1 1486 1640 4.0E-42
sp|O14981|BTAF1_HUMAN TATA-binding protein-associated factor 172 OS=Homo sapiens GN=BTAF1 PE=1 SV=2 912 1226 4.0E-42
sp|Q9VL72|SMRCD_DROME SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A containing DEAD/H box 1 homolog OS=Drosophila melanogaster GN=Etl1 PE=1 SV=1 1460 1631 5.0E-42
sp|Q9ZV43|CHR8_ARATH Protein CHROMATIN REMODELING 8 OS=Arabidopsis thaliana GN=CHR8 PE=2 SV=1 919 1225 1.0E-41
sp|Q6BGY8|INO80_DEBHA Putative DNA helicase INO80 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=INO80 PE=3 SV=2 1473 1636 4.0E-41
sp|Q5A310|ISW2_CANAL ISWI chromatin-remodeling complex ATPase ISW2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=ISW2 PE=2 SV=1 1482 1638 1.0E-40
sp|Q9NRZ9|HELLS_HUMAN Lymphoid-specific helicase OS=Homo sapiens GN=HELLS PE=1 SV=1 1454 1640 1.0E-40
sp|Q08773|ISW2_YEAST ISWI chromatin-remodeling complex ATPase ISW2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ISW2 PE=1 SV=1 1482 1638 2.0E-40
sp|Q9ZUL5|CHR19_ARATH Protein CHROMATIN REMODELING 19 OS=Arabidopsis thaliana GN=ETL1 PE=1 SV=1 1487 1643 2.0E-40
sp|P53115|INO80_YEAST Putative DNA helicase INO80 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=INO80 PE=1 SV=1 1473 1636 3.0E-40
sp|O94421|SNF22_SCHPO SWI/SNF chromatin-remodeling complex subunit snf22 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=snf22 PE=1 SV=2 1481 1640 3.0E-40
sp|Q60848|HELLS_MOUSE Lymphocyte-specific helicase OS=Mus musculus GN=Hells PE=1 SV=2 1459 1640 3.0E-40
sp|Q9UR24|RHP26_SCHPO DNA repair protein rhp26 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rhp26 PE=3 SV=1 919 1224 3.0E-40
sp|A6ZU34|INO80_YEAS7 Putative DNA helicase INO80 OS=Saccharomyces cerevisiae (strain YJM789) GN=INO80 PE=3 SV=1 1485 1636 4.0E-40
sp|Q9UTN6|SNF21_SCHPO Chromatin structure-remodeling complex subunit snf21 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=snf21 PE=1 SV=1 1487 1640 4.0E-40
sp|Q86WJ1|CHD1L_HUMAN Chromodomain-helicase-DNA-binding protein 1-like OS=Homo sapiens GN=CHD1L PE=1 SV=2 1487 1697 4.0E-40
sp|F4IV99|CHR5_ARATH Protein CHROMATIN REMODELING 5 OS=Arabidopsis thaliana GN=CHR5 PE=3 SV=1 1478 1637 6.0E-40
sp|Q6PGB8|SMCA1_MOUSE Probable global transcription activator SNF2L1 OS=Mus musculus GN=Smarca1 PE=1 SV=1 1485 1654 8.0E-40
sp|Q9CXF7|CHD1L_MOUSE Chromodomain-helicase-DNA-binding protein 1-like OS=Mus musculus GN=Chd1l PE=1 SV=1 1487 1677 8.0E-40
sp|Q91ZW3|SMCA5_MOUSE SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A member 5 OS=Mus musculus GN=Smarca5 PE=1 SV=1 1482 1654 1.0E-39
sp|O60264|SMCA5_HUMAN SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A member 5 OS=Homo sapiens GN=SMARCA5 PE=1 SV=1 1482 1654 1.0E-39
sp|E9PZM4|CHD2_MOUSE Chromodomain-helicase-DNA-binding protein 2 OS=Mus musculus GN=Chd2 PE=1 SV=1 1487 1636 1.0E-39
sp|Q74Z27|INO80_ASHGO Putative DNA helicase INO80 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=INO80 PE=3 SV=2 1474 1660 2.0E-39
sp|O14647|CHD2_HUMAN Chromodomain-helicase-DNA-binding protein 2 OS=Homo sapiens GN=CHD2 PE=1 SV=2 1487 1636 2.0E-39
sp|Q12873|CHD3_HUMAN Chromodomain-helicase-DNA-binding protein 3 OS=Homo sapiens GN=CHD3 PE=1 SV=3 1487 1638 2.0E-39
sp|Q7KU24|CHD1_DROME Chromodomain-helicase-DNA-binding protein 1 OS=Drosophila melanogaster GN=Chd1 PE=1 SV=1 1421 1636 2.0E-39
sp|Q22516|CHD3_CAEEL Chromodomain-helicase-DNA-binding protein 3 homolog OS=Caenorhabditis elegans GN=chd-3 PE=2 SV=2 1485 1717 2.0E-39
sp|A2A8L1|CHD5_MOUSE Chromodomain-helicase-DNA-binding protein 5 OS=Mus musculus GN=Chd5 PE=1 SV=1 1487 1638 4.0E-39
sp|Q8TDI0|CHD5_HUMAN Chromodomain-helicase-DNA-binding protein 5 OS=Homo sapiens GN=CHD5 PE=1 SV=1 1487 1638 4.0E-39
sp|D3ZD32|CHD5_RAT Chromodomain-helicase-DNA-binding protein 5 OS=Rattus norvegicus GN=Chd5 PE=1 SV=1 1487 1638 4.0E-39
sp|Q9S775|PKL_ARATH CHD3-type chromatin-remodeling factor PICKLE OS=Arabidopsis thaliana GN=PKL PE=1 SV=1 1479 1676 4.0E-39
sp|Q3B7N1|CHD1L_BOVIN Chromodomain-helicase-DNA-binding protein 1-like OS=Bos taurus GN=CHD1L PE=2 SV=1 1487 1680 5.0E-39
sp|A2AJK6|CHD7_MOUSE Chromodomain-helicase-DNA-binding protein 7 OS=Mus musculus GN=Chd7 PE=1 SV=1 1486 1676 6.0E-39
sp|Q9P2D1|CHD7_HUMAN Chromodomain-helicase-DNA-binding protein 7 OS=Homo sapiens GN=CHD7 PE=1 SV=3 1486 1676 7.0E-39
sp|Q5FWR0|SMRCD_XENTR SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A containing DEAD/H box 1 OS=Xenopus tropicalis GN=smarcad1 PE=2 SV=1 1475 1631 8.0E-39
sp|Q7ZU90|CHD1L_DANRE Chromodomain-helicase-DNA-binding protein 1-like OS=Danio rerio GN=chd1l PE=2 SV=1 1487 1677 8.0E-39
sp|A7TJI3|INO80_VANPO Putative DNA helicase INO80 OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=INO80 PE=3 SV=1 1445 1636 9.0E-39
sp|Q06A37|CHD7_CHICK Chromodomain-helicase-DNA-binding protein 7 OS=Gallus gallus GN=CHD7 PE=2 SV=1 1486 1676 9.0E-39
sp|Q8TD26|CHD6_HUMAN Chromodomain-helicase-DNA-binding protein 6 OS=Homo sapiens GN=CHD6 PE=1 SV=4 1487 1676 2.0E-38
sp|B0R0I6|CHD8_DANRE Chromodomain-helicase-DNA-binding protein 8 OS=Danio rerio GN=chd8 PE=3 SV=2 1477 1722 2.0E-38
sp|F4IV45|CHR10_ARATH Probable helicase CHR10 OS=Arabidopsis thaliana GN=CHR10 PE=3 SV=1 921 1225 2.0E-38
sp|Q6CNY4|INO80_KLULA Putative DNA helicase INO80 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=INO80 PE=3 SV=1 1474 1636 3.0E-38
sp|Q9P793|MIT1_SCHPO Chromatin remodeling factor mit1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mit1 PE=1 SV=1 921 1225 5.0E-38
sp|P94593|YWQA_BACSU Uncharacterized ATP-dependent helicase YwqA OS=Bacillus subtilis (strain 168) GN=ywqA PE=3 SV=2 896 1226 6.0E-38
sp|P28370|SMCA1_HUMAN Probable global transcription activator SNF2L1 OS=Homo sapiens GN=SMARCA1 PE=1 SV=2 1485 1654 7.0E-38
sp|Q9H4L7|SMRCD_HUMAN SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A containing DEAD/H box 1 OS=Homo sapiens GN=SMARCAD1 PE=1 SV=2 1482 1639 7.0E-38
sp|O16102|CHD3_DROME Chromodomain-helicase-DNA-binding protein 3 OS=Drosophila melanogaster GN=Chd3 PE=2 SV=3 1487 1676 7.0E-38
sp|Q9HCK8|CHD8_HUMAN Chromodomain-helicase-DNA-binding protein 8 OS=Homo sapiens GN=CHD8 PE=1 SV=5 1486 1676 8.0E-38
sp|Q09XV5|CHD8_MOUSE Chromodomain-helicase-DNA-binding protein 8 OS=Mus musculus GN=Chd8 PE=1 SV=1 1486 1654 8.0E-38
sp|Q9JIX5|CHD8_RAT Chromodomain-helicase-DNA-binding protein 8 OS=Rattus norvegicus GN=Chd8 PE=1 SV=2 1486 1654 8.0E-38
sp|P41877|ISW1_CAEEL Chromatin-remodeling complex ATPase chain isw-1 OS=Caenorhabditis elegans GN=isw-1 PE=1 SV=2 1485 1641 1.0E-37
sp|P32657|CHD1_YEAST Chromo domain-containing protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CHD1 PE=1 SV=1 1480 1638 1.0E-37
sp|E1B7X9|SMRCD_BOVIN SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A containing DEAD/H box 1 OS=Bos taurus GN=SMARCAD1 PE=3 SV=2 1482 1639 2.0E-37
sp|Q9US25|HRP1_SCHPO Chromodomain helicase hrp1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=hrp1 PE=1 SV=1 1485 1638 2.0E-37
sp|A3KFM7|CHD6_MOUSE Chromodomain-helicase-DNA-binding protein 6 OS=Mus musculus GN=Chd6 PE=1 SV=1 1487 1676 2.0E-37
sp|D3ZA12|CHD6_RAT Chromodomain-helicase-DNA-binding protein 6 OS=Rattus norvegicus GN=Chd6 PE=1 SV=2 1487 1676 2.0E-37
sp|B5DE69|CHD8_XENTR Chromodomain-helicase-DNA-binding protein 8 OS=Xenopus tropicalis GN=chd8 PE=2 SV=2 1487 1636 2.0E-37
sp|A2BGR3|ERC6L_DANRE DNA excision repair protein ERCC-6-like OS=Danio rerio GN=ercc6l PE=1 SV=1 923 1231 2.0E-37
sp|D3Z9Z9|SMRCD_RAT SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A containing DEAD/H box 1 OS=Rattus norvegicus GN=Smarcad1 PE=1 SV=1 1482 1631 3.0E-37
sp|Q04692|SMRCD_MOUSE SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A containing DEAD/H box 1 OS=Mus musculus GN=Smarcad1 PE=1 SV=2 1482 1631 3.0E-37
sp|G5EDG2|SMRCD_CAEEL SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A containing DEAD/H box 1 homolog OS=Caenorhabditis elegans GN=M03C11.8 PE=3 SV=1 1469 1634 3.0E-37
sp|G5EBZ4|LE418_CAEEL Protein let-418 OS=Caenorhabditis elegans GN=let-418 PE=1 SV=1 1485 1708 5.0E-37
sp|P51532|SMCA4_HUMAN Transcription activator BRG1 OS=Homo sapiens GN=SMARCA4 PE=1 SV=2 1486 1640 7.0E-37
sp|Q9XFH4|DDM1_ARATH ATP-dependent DNA helicase DDM1 OS=Arabidopsis thaliana GN=DDM1 PE=1 SV=1 1473 1640 7.0E-37
sp|A7Z019|SMCA4_BOVIN Transcription activator BRG1 OS=Bos taurus GN=SMARCA4 PE=2 SV=1 1486 1640 8.0E-37
sp|Q3TKT4|SMCA4_MOUSE Transcription activator BRG1 OS=Mus musculus GN=Smarca4 PE=1 SV=1 1486 1640 9.0E-37
sp|E7F1C4|SMRDB_DANRE SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A containing DEAD/H box 1B OS=Danio rerio GN=smarcad1b PE=3 SV=1 1485 1639 9.0E-37
sp|Q8K1P7|SMCA4_RAT Transcription activator BRG1 OS=Rattus norvegicus GN=Smarca4 PE=1 SV=1 1486 1640 1.0E-36
sp|Q8BYH8|CHD9_MOUSE Chromodomain-helicase-DNA-binding protein 9 OS=Mus musculus GN=Chd9 PE=1 SV=2 1486 1636 2.0E-36
sp|Q3L8U1|CHD9_HUMAN Chromodomain-helicase-DNA-binding protein 9 OS=Homo sapiens GN=CHD9 PE=1 SV=2 1486 1636 3.0E-36
sp|F4I2H2|CHR9_ARATH Switch 2 OS=Arabidopsis thaliana GN=SWI2 PE=3 SV=1 898 1229 4.0E-36
sp|Q2NKX8|ERC6L_HUMAN DNA excision repair protein ERCC-6-like OS=Homo sapiens GN=ERCC6L PE=1 SV=1 923 1228 4.0E-36
sp|O14139|HRP3_SCHPO Chromodomain helicase hrp3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=hrp3 PE=1 SV=1 1482 1638 6.0E-36
sp|O97159|CHDM_DROME Chromodomain-helicase-DNA-binding protein Mi-2 homolog OS=Drosophila melanogaster GN=Mi-2 PE=1 SV=2 1487 1676 6.0E-36
sp|P43610|IRC5_YEAST Uncharacterized ATP-dependent helicase IRC5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=IRC5 PE=1 SV=2 1487 1640 9.0E-36
sp|F4JTF6|CHR7_ARATH CHD3-type chromatin-remodeling factor CHR7 OS=Arabidopsis thaliana GN=CHR7 PE=2 SV=1 1487 1676 9.0E-36
sp|Q6DIC0|SMCA2_MOUSE Probable global transcription activator SNF2L2 OS=Mus musculus GN=Smarca2 PE=1 SV=1 1487 1640 1.0E-35
sp|P51531|SMCA2_HUMAN Probable global transcription activator SNF2L2 OS=Homo sapiens GN=SMARCA2 PE=1 SV=2 1487 1640 1.0E-35
sp|O74842|FFT2_SCHPO ATP-dependent helicase fft2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=fft2 PE=1 SV=1 1485 1656 1.0E-35
sp|A6QQR4|ERC6L_BOVIN DNA excision repair protein ERCC-6-like OS=Bos taurus GN=ERCC6L PE=2 SV=1 923 1228 1.0E-35
sp|P25439|BRM_DROME ATP-dependent helicase brm OS=Drosophila melanogaster GN=brm PE=1 SV=2 1487 1640 2.0E-35
sp|F4IHS2|SYD_ARATH Chromatin structure-remodeling complex protein SYD OS=Arabidopsis thaliana GN=SYD PE=1 SV=1 1486 1640 2.0E-35
sp|Q6PDQ2|CHD4_MOUSE Chromodomain-helicase-DNA-binding protein 4 OS=Mus musculus GN=Chd4 PE=1 SV=1 1502 1638 2.0E-35
sp|Q14839|CHD4_HUMAN Chromodomain-helicase-DNA-binding protein 4 OS=Homo sapiens GN=CHD4 PE=1 SV=2 1502 1638 2.0E-35
sp|F4KBP5|CHR4_ARATH Protein CHROMATIN REMODELING 4 OS=Arabidopsis thaliana GN=CHR4 PE=2 SV=1 1487 1690 2.0E-35
sp|O12944|RAD54_CHICK DNA repair and recombination protein RAD54-like (Fragment) OS=Gallus gallus GN=RAD54L PE=2 SV=1 923 1265 3.0E-35
sp|Q7G8Y3|ISW2_ORYSJ Probable chromatin-remodeling complex ATPase chain OS=Oryza sativa subsp. japonica GN=Os01g0367900 PE=2 SV=2 1505 1685 4.0E-35
sp|Q9ZV43|CHR8_ARATH Protein CHROMATIN REMODELING 8 OS=Arabidopsis thaliana GN=CHR8 PE=2 SV=1 1487 1742 5.0E-35
sp|F4JY24|CHR17_ARATH ISWI chromatin-remodeling complex ATPase CHR17 OS=Arabidopsis thaliana GN=CHR17 PE=1 SV=1 1505 1685 7.0E-35
sp|F4IV45|CHR10_ARATH Probable helicase CHR10 OS=Arabidopsis thaliana GN=CHR10 PE=3 SV=1 1487 1635 7.0E-35
sp|B0R061|SMRDA_DANRE SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A containing DEAD/H box 1A OS=Danio rerio GN=smarcad1a PE=3 SV=1 1476 1639 1.0E-34
sp|Q03468|ERCC6_HUMAN DNA excision repair protein ERCC-6 OS=Homo sapiens GN=ERCC6 PE=1 SV=1 1487 1637 5.0E-34
sp|Q8W103|CHR24_ARATH Protein CHROMATIN REMODELING 24 OS=Arabidopsis thaliana GN=CHR24 PE=2 SV=1 919 1228 5.0E-34
sp|P87114|FFT1_SCHPO ATP-dependent helicase fft1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=fft1 PE=3 SV=1 1485 1639 6.0E-34
sp|Q8RWY3|ISW2_ARATH ISWI chromatin-remodeling complex ATPase CHR11 OS=Arabidopsis thaliana GN=CHR11 PE=1 SV=4 1505 1685 1.0E-33
sp|P38144|ISW1_YEAST ISWI chromatin-remodeling complex ATPase ISW1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ISW1 PE=1 SV=2 1503 1637 1.0E-33
sp|P70270|RAD54_MOUSE DNA repair and recombination protein RAD54-like OS=Mus musculus GN=Rad54l PE=1 SV=2 858 1265 1.0E-33
sp|Q8BHK9|ERC6L_MOUSE DNA excision repair protein ERCC-6-like OS=Mus musculus GN=Ercc6l PE=1 SV=1 923 1228 1.0E-33
sp|A9X4T1|CHD1_BOMMO Chromodomain-helicase-DNA-binding protein 1 OS=Bombyx mori GN=CHD1 PE=1 SV=1 1503 1636 3.0E-33
sp|B6ZLK2|CHD1_CHICK Chromodomain-helicase-DNA-binding protein 1 OS=Gallus gallus GN=CHD1 PE=1 SV=1 1503 1636 3.0E-33
sp|O14646|CHD1_HUMAN Chromodomain-helicase-DNA-binding protein 1 OS=Homo sapiens GN=CHD1 PE=1 SV=2 1503 1641 3.0E-33
sp|P40201|CHD1_MOUSE Chromodomain-helicase-DNA-binding protein 1 OS=Mus musculus GN=Chd1 PE=1 SV=3 1503 1641 4.0E-33
sp|Q9Y620|RA54B_HUMAN DNA repair and recombination protein RAD54B OS=Homo sapiens GN=RAD54B PE=1 SV=1 853 1227 4.0E-33
sp|Q92698|RAD54_HUMAN DNA repair and recombination protein RAD54-like OS=Homo sapiens GN=RAD54L PE=1 SV=2 858 1230 4.0E-33
sp|P47264|Y018_MYCGE Uncharacterized ATP-dependent helicase MG018 OS=Mycoplasma genitalium (strain ATCC 33530 / G-37 / NCTC 10195) GN=MG018 PE=3 SV=3 925 1219 7.0E-33
sp|P75093|Y020_MYCPN Uncharacterized ATP-dependent helicase MPN_020 OS=Mycoplasma pneumoniae (strain ATCC 29342 / M129) GN=MPN_020 PE=3 SV=1 926 1222 2.0E-32
sp|Q0PCS3|CHR25_ARATH Protein CHROMATIN REMODELING 25 OS=Arabidopsis thaliana GN=CHR25 PE=1 SV=1 914 1227 8.0E-32
sp|P31380|FUN30_YEAST ATP-dependent helicase FUN30 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FUN30 PE=1 SV=1 1487 1634 9.0E-32
sp|P40352|RAD26_YEAST DNA repair and recombination protein RAD26 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RAD26 PE=1 SV=1 1487 1635 1.0E-31
sp|Q9UR24|RHP26_SCHPO DNA repair protein rhp26 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rhp26 PE=3 SV=1 1487 1682 1.0E-31
sp|B4M9A8|RAD54_DROVI DNA repair and recombination protein RAD54-like OS=Drosophila virilis GN=okr PE=3 SV=1 914 1228 1.0E-31
sp|B4MX21|RAD54_DROWI DNA repair and recombination protein RAD54-like OS=Drosophila willistoni GN=okr PE=3 SV=1 914 1228 2.0E-31
sp|B4KHL5|RAD54_DROMO DNA repair and recombination protein RAD54-like OS=Drosophila mojavensis GN=okr PE=3 SV=1 914 1228 2.0E-31
sp|O76460|RAD54_DROME DNA repair and recombination protein RAD54-like OS=Drosophila melanogaster GN=okr PE=1 SV=1 914 1228 2.0E-31
sp|B4NXB8|RAD54_DROYA DNA repair and recombination protein RAD54-like OS=Drosophila yakuba GN=okr PE=3 SV=2 914 1228 5.0E-31
sp|Q6PFE3|RA54B_MOUSE DNA repair and recombination protein RAD54B OS=Mus musculus GN=Rad54b PE=2 SV=1 927 1257 6.0E-31
sp|A2BGR3|ERC6L_DANRE DNA excision repair protein ERCC-6-like OS=Danio rerio GN=ercc6l PE=1 SV=1 1485 1654 9.0E-31
sp|Q29KH2|RAD54_DROPS DNA repair and recombination protein RAD54-like OS=Drosophila pseudoobscura pseudoobscura GN=okr PE=3 SV=2 908 1228 9.0E-31
sp|B4GS98|RAD54_DROPE DNA repair and recombination protein RAD54-like OS=Drosophila persimilis GN=okr PE=3 SV=1 908 1228 1.0E-30
sp|P41410|RAD54_SCHPO DNA repair protein rhp54 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rhp54 PE=1 SV=2 923 1225 1.0E-30
sp|B4JCS7|RAD54_DROGR DNA repair and recombination protein RAD54-like OS=Drosophila grimshawi GN=okr PE=3 SV=1 914 1228 2.0E-30
sp|B3NAN8|RAD54_DROER DNA repair and recombination protein RAD54-like OS=Drosophila erecta GN=okr PE=3 SV=1 914 1228 2.0E-30
sp|O42861|FFT3_SCHPO ATP-dependent helicase fft3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=fft3 PE=1 SV=1 1472 1631 3.0E-30
sp|B3MMA5|RAD54_DROAN DNA repair and recombination protein RAD54-like OS=Drosophila ananassae GN=okr PE=3 SV=1 914 1225 3.0E-30
sp|F4I2H2|CHR9_ARATH Switch 2 OS=Arabidopsis thaliana GN=SWI2 PE=3 SV=1 1486 1645 8.0E-30
sp|Q9DG67|RA54B_CHICK DNA repair and recombination protein RAD54B OS=Gallus gallus GN=RAD54B PE=2 SV=1 927 1226 1.0E-29
sp|A4PBL4|RAD54_ORYSJ DNA repair and recombination protein RAD54 OS=Oryza sativa subsp. japonica GN=RAD54 PE=1 SV=1 918 1245 2.0E-29
sp|Q8BHK9|ERC6L_MOUSE DNA excision repair protein ERCC-6-like OS=Mus musculus GN=Ercc6l PE=1 SV=1 1467 1655 4.0E-29
sp|Q9JIM3|ER6L2_MOUSE DNA excision repair protein ERCC-6-like 2 OS=Mus musculus GN=Ercc6l2 PE=1 SV=3 1487 1635 2.0E-28
sp|O14981|BTAF1_HUMAN TATA-binding protein-associated factor 172 OS=Homo sapiens GN=BTAF1 PE=1 SV=2 1504 1675 3.0E-28
sp|Q5T890|ER6L2_HUMAN DNA excision repair protein ERCC-6-like 2 OS=Homo sapiens GN=ERCC6L2 PE=1 SV=2 919 1203 4.0E-28
sp|Q5T890|ER6L2_HUMAN DNA excision repair protein ERCC-6-like 2 OS=Homo sapiens GN=ERCC6L2 PE=1 SV=2 1487 1635 4.0E-28
sp|A3KMX0|ER6L2_BOVIN DNA excision repair protein ERCC-6-like 2 OS=Bos taurus GN=ERCC6L2 PE=2 SV=3 1487 1635 4.0E-28
sp|P41410|RAD54_SCHPO DNA repair protein rhp54 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rhp54 PE=1 SV=2 1487 1657 5.0E-28
sp|Q9DG67|RA54B_CHICK DNA repair and recombination protein RAD54B OS=Gallus gallus GN=RAD54B PE=2 SV=1 1483 1635 7.0E-28
sp|Q6EVK6|BRM_ARATH ATP-dependent helicase BRM OS=Arabidopsis thaliana GN=BRM PE=1 SV=1 1479 1610 3.0E-27
sp|B3NAN8|RAD54_DROER DNA repair and recombination protein RAD54-like OS=Drosophila erecta GN=okr PE=3 SV=1 1487 1663 3.0E-27
sp|B3LN76|RDH54_YEAS1 DNA repair and recombination protein RDH54 OS=Saccharomyces cerevisiae (strain RM11-1a) GN=RDH54 PE=3 SV=1 1463 1689 3.0E-27
sp|A6ZL17|RDH54_YEAS7 DNA repair and recombination protein RDH54 OS=Saccharomyces cerevisiae (strain YJM789) GN=RDH54 PE=3 SV=1 1463 1689 3.0E-27
sp|B5VE38|RDH54_YEAS6 DNA repair and recombination protein RDH54 OS=Saccharomyces cerevisiae (strain AWRI1631) GN=RDH54 PE=3 SV=1 1463 1689 3.0E-27
sp|C7GQI8|RDH54_YEAS2 DNA repair and recombination protein RDH54 OS=Saccharomyces cerevisiae (strain JAY291) GN=RDH54 PE=3 SV=1 1463 1689 3.0E-27
sp|P38086|RDH54_YEAST DNA repair and recombination protein RDH54 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RDH54 PE=1 SV=4 1463 1662 4.0E-27
sp|B4NXB8|RAD54_DROYA DNA repair and recombination protein RAD54-like OS=Drosophila yakuba GN=okr PE=3 SV=2 1487 1663 5.0E-27
sp|Q9JIM3|ER6L2_MOUSE DNA excision repair protein ERCC-6-like 2 OS=Mus musculus GN=Ercc6l2 PE=1 SV=3 919 1202 5.0E-27
sp|B3MMA5|RAD54_DROAN DNA repair and recombination protein RAD54-like OS=Drosophila ananassae GN=okr PE=3 SV=1 1487 1663 6.0E-27
sp|Q9FIY7|SM3L3_ARATH Putative SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A member 3-like 3 OS=Arabidopsis thaliana GN=At5g43530 PE=3 SV=1 948 1228 7.0E-27
sp|P32333|MOT1_YEAST TATA-binding protein-associated factor MOT1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MOT1 PE=1 SV=1 1504 1637 8.0E-27
sp|Q9P793|MIT1_SCHPO Chromatin remodeling factor mit1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mit1 PE=1 SV=1 1480 1636 1.0E-26
sp|Q8W103|CHR24_ARATH Protein CHROMATIN REMODELING 24 OS=Arabidopsis thaliana GN=CHR24 PE=2 SV=1 1488 1655 1.0E-26
sp|O76460|RAD54_DROME DNA repair and recombination protein RAD54-like OS=Drosophila melanogaster GN=okr PE=1 SV=1 1487 1663 1.0E-26
sp|Q29KH2|RAD54_DROPS DNA repair and recombination protein RAD54-like OS=Drosophila pseudoobscura pseudoobscura GN=okr PE=3 SV=2 1487 1663 1.0E-26
sp|O43065|MOT1_SCHPO Probable helicase mot1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mot1 PE=1 SV=4 1504 1754 2.0E-26
sp|Q2NKX8|ERC6L_HUMAN DNA excision repair protein ERCC-6-like OS=Homo sapiens GN=ERCC6L PE=1 SV=1 1475 1655 2.0E-26
sp|A6QQR4|ERC6L_BOVIN DNA excision repair protein ERCC-6-like OS=Bos taurus GN=ERCC6L PE=2 SV=1 1475 1655 2.0E-26
sp|Q9Y620|RA54B_HUMAN DNA repair and recombination protein RAD54B OS=Homo sapiens GN=RAD54B PE=1 SV=1 1487 1635 3.0E-26
sp|B4GS98|RAD54_DROPE DNA repair and recombination protein RAD54-like OS=Drosophila persimilis GN=okr PE=3 SV=1 1487 1663 3.0E-26
sp|Q09772|RDH54_SCHPO Meiotic recombination protein rdh54 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rdh54 PE=1 SV=3 896 1225 6.0E-26
sp|A3KMX0|ER6L2_BOVIN DNA excision repair protein ERCC-6-like 2 OS=Bos taurus GN=ERCC6L2 PE=2 SV=3 907 1202 8.0E-26
sp|B4KHL5|RAD54_DROMO DNA repair and recombination protein RAD54-like OS=Drosophila mojavensis GN=okr PE=3 SV=1 1487 1663 1.0E-25
sp|B4JCS7|RAD54_DROGR DNA repair and recombination protein RAD54-like OS=Drosophila grimshawi GN=okr PE=3 SV=1 1487 1663 2.0E-25
sp|P32863|RAD54_YEAST DNA repair and recombination protein RAD54 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RAD54 PE=1 SV=1 1487 1663 2.0E-25
sp|P70270|RAD54_MOUSE DNA repair and recombination protein RAD54-like OS=Mus musculus GN=Rad54l PE=1 SV=2 1487 1655 3.0E-25
sp|B4MX21|RAD54_DROWI DNA repair and recombination protein RAD54-like OS=Drosophila willistoni GN=okr PE=3 SV=1 1487 1663 4.0E-25
sp|Q6PFE3|RA54B_MOUSE DNA repair and recombination protein RAD54B OS=Mus musculus GN=Rad54b PE=2 SV=1 1487 1635 4.0E-25
sp|A4PBL4|RAD54_ORYSJ DNA repair and recombination protein RAD54 OS=Oryza sativa subsp. japonica GN=RAD54 PE=1 SV=1 1487 1663 5.0E-25
sp|P32863|RAD54_YEAST DNA repair and recombination protein RAD54 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RAD54 PE=1 SV=1 949 1225 5.0E-25
sp|O12944|RAD54_CHICK DNA repair and recombination protein RAD54-like (Fragment) OS=Gallus gallus GN=RAD54L PE=2 SV=1 1487 1657 2.0E-24
sp|Q9GQN5|ATRX_DROME Transcriptional regulator ATRX homolog OS=Drosophila melanogaster GN=XNP PE=1 SV=2 1503 1644 2.0E-24
sp|B5BT18|BTAF1_ARATH TATA-binding protein-associated factor BTAF1 OS=Arabidopsis thaliana GN=BTAF1 PE=1 SV=1 1499 1635 3.0E-24
sp|B4M9A8|RAD54_DROVI DNA repair and recombination protein RAD54-like OS=Drosophila virilis GN=okr PE=3 SV=1 1487 1663 3.0E-24
sp|Q92698|RAD54_HUMAN DNA repair and recombination protein RAD54-like OS=Homo sapiens GN=RAD54L PE=1 SV=2 1487 1655 4.0E-24
sp|Q0PCS3|CHR25_ARATH Protein CHROMATIN REMODELING 25 OS=Arabidopsis thaliana GN=CHR25 PE=1 SV=1 1487 1663 3.0E-23
sp|Q9FNI6|SM3L2_ARATH Putative SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A member 3-like 2 OS=Arabidopsis thaliana GN=At5g22750 PE=2 SV=1 977 1228 7.0E-23
sp|P79051|RHP16_SCHPO ATP-dependent helicase rhp16 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rhp16 PE=3 SV=2 911 1226 7.0E-23
sp|A4IHD2|ARIP4_XENTR Helicase ARIP4 OS=Xenopus tropicalis GN=rad54l2 PE=2 SV=1 1488 1755 8.0E-23
sp|P36607|RAD5_SCHPO DNA repair protein rad8 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rad8 PE=1 SV=1 948 1263 3.0E-22
sp|Q10332|YBMA_SCHPO Uncharacterized ATP-dependent helicase C582.10c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC582.10c PE=1 SV=1 927 1222 5.0E-22
sp|Q99NG0|ARIP4_MOUSE Helicase ARIP4 OS=Mus musculus GN=Rad54l2 PE=1 SV=1 1488 1635 6.0E-22
sp|Q61687|ATRX_MOUSE Transcriptional regulator ATRX OS=Mus musculus GN=Atrx PE=1 SV=3 1478 1648 9.0E-22
sp|Q9FNI6|SM3L2_ARATH Putative SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A member 3-like 2 OS=Arabidopsis thaliana GN=At5g22750 PE=2 SV=1 1488 1628 1.0E-21
sp|Q5BHD6|RAD5_EMENI DNA repair protein rad5 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=rad5 PE=3 SV=1 948 1231 1.0E-21
sp|P31244|RAD16_YEAST DNA repair protein RAD16 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RAD16 PE=1 SV=1 927 1228 1.0E-21
sp|Q09772|RDH54_SCHPO Meiotic recombination protein rdh54 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rdh54 PE=1 SV=3 1472 1635 2.0E-21
sp|Q7YQM4|ATRX_PANTR Transcriptional regulator ATRX OS=Pan troglodytes GN=ATRX PE=2 SV=1 1478 1648 2.0E-21
sp|P46100|ATRX_HUMAN Transcriptional regulator ATRX OS=Homo sapiens GN=ATRX PE=1 SV=5 1478 1648 2.0E-21
sp|Q7YQM3|ATRX_PONPY Transcriptional regulator ATRX OS=Pongo pygmaeus GN=ATRX PE=2 SV=1 1478 1648 2.0E-21
sp|Q9Y4B4|ARIP4_HUMAN Helicase ARIP4 OS=Homo sapiens GN=RAD54L2 PE=1 SV=4 1488 1635 2.0E-21
sp|B5VE38|RDH54_YEAS6 DNA repair and recombination protein RDH54 OS=Saccharomyces cerevisiae (strain AWRI1631) GN=RDH54 PE=3 SV=1 949 1233 5.0E-21
sp|F4HW51|CHR20_ARATH Protein CHROMATIN REMODELING 20 OS=Arabidopsis thaliana GN=ATRX PE=2 SV=2 1487 1635 6.0E-21
sp|P94593|YWQA_BACSU Uncharacterized ATP-dependent helicase YwqA OS=Bacillus subtilis (strain 168) GN=ywqA PE=3 SV=2 1488 1643 1.0E-20
sp|B3LN76|RDH54_YEAS1 DNA repair and recombination protein RDH54 OS=Saccharomyces cerevisiae (strain RM11-1a) GN=RDH54 PE=3 SV=1 949 1233 1.0E-20
sp|A6ZL17|RDH54_YEAS7 DNA repair and recombination protein RDH54 OS=Saccharomyces cerevisiae (strain YJM789) GN=RDH54 PE=3 SV=1 949 1233 1.0E-20
sp|P38086|RDH54_YEAST DNA repair and recombination protein RDH54 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RDH54 PE=1 SV=4 949 1233 2.0E-20
sp|Q10332|YBMA_SCHPO Uncharacterized ATP-dependent helicase C582.10c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC582.10c PE=1 SV=1 1502 1654 2.0E-20
sp|C7GQI8|RDH54_YEAS2 DNA repair and recombination protein RDH54 OS=Saccharomyces cerevisiae (strain JAY291) GN=RDH54 PE=3 SV=1 949 1233 6.0E-20
sp|Q9Y4B4|ARIP4_HUMAN Helicase ARIP4 OS=Homo sapiens GN=RAD54L2 PE=1 SV=4 949 1227 7.0E-20
sp|Q99NG0|ARIP4_MOUSE Helicase ARIP4 OS=Mus musculus GN=Rad54l2 PE=1 SV=1 949 1227 1.0E-19
sp|Q08562|ULS1_YEAST ATP-dependent helicase ULS1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ULS1 PE=1 SV=1 927 1226 1.0E-19
sp|Q5ACX1|RAD5_CANAL DNA repair protein RAD5 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=RAD5 PE=3 SV=1 948 1225 1.0E-19
sp|Q9U7E0|ATRX_CAEEL Transcriptional regulator ATRX homolog OS=Caenorhabditis elegans GN=xnp-1 PE=1 SV=1 908 1192 1.0E-19
sp|Q9UNY4|TTF2_HUMAN Transcription termination factor 2 OS=Homo sapiens GN=TTF2 PE=1 SV=2 1501 1642 1.0E-19
sp|Q9FIY7|SM3L3_ARATH Putative SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A member 3-like 3 OS=Arabidopsis thaliana GN=At5g43530 PE=3 SV=1 1487 1628 2.0E-19
sp|P34739|TTF2_DROME Transcription termination factor 2 OS=Drosophila melanogaster GN=lds PE=1 SV=2 1454 1631 3.0E-19
sp|P41447|GTA_NPVAC Probable global transactivator OS=Autographa californica nuclear polyhedrosis virus GN=GTA PE=3 SV=1 927 1224 4.0E-19
sp|P47264|Y018_MYCGE Uncharacterized ATP-dependent helicase MG018 OS=Mycoplasma genitalium (strain ATCC 33530 / G-37 / NCTC 10195) GN=MG018 PE=3 SV=3 1505 1654 5.0E-19
sp|Q6C2R8|RAD5_YARLI DNA repair protein RAD5 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=RAD5 PE=3 SV=1 946 1229 5.0E-19
sp|Q7YQM4|ATRX_PANTR Transcriptional regulator ATRX OS=Pan troglodytes GN=ATRX PE=2 SV=1 949 1191 6.0E-19
sp|P46100|ATRX_HUMAN Transcriptional regulator ATRX OS=Homo sapiens GN=ATRX PE=1 SV=5 949 1191 6.0E-19
sp|Q4WVM1|RAD5_ASPFU DNA repair protein rad5 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=rad5 PE=3 SV=2 948 1231 6.0E-19
sp|Q7YQM3|ATRX_PONPY Transcriptional regulator ATRX OS=Pongo pygmaeus GN=ATRX PE=2 SV=1 949 1191 7.0E-19
sp|P75093|Y020_MYCPN Uncharacterized ATP-dependent helicase MPN_020 OS=Mycoplasma pneumoniae (strain ATCC 29342 / M129) GN=MPN_020 PE=3 SV=1 1505 1654 9.0E-19
sp|Q61687|ATRX_MOUSE Transcriptional regulator ATRX OS=Mus musculus GN=Atrx PE=1 SV=3 949 1191 1.0E-18
sp|Q5NC05|TTF2_MOUSE Transcription termination factor 2 OS=Mus musculus GN=Ttf2 PE=1 SV=2 1502 1639 1.0E-18
sp|Q7S1P9|RAD5_NEUCR DNA repair protein rad5 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=mus-41 PE=3 SV=3 948 1244 2.0E-18
sp|P0CQ66|RAD5_CRYNJ DNA repair protein RAD5 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=RAD5 PE=3 SV=1 1505 1643 2.0E-18
sp|P0CQ67|RAD5_CRYNB DNA repair protein RAD5 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=RAD5 PE=3 SV=1 1505 1643 2.0E-18
sp|Q5NC05|TTF2_MOUSE Transcription termination factor 2 OS=Mus musculus GN=Ttf2 PE=1 SV=2 896 1194 3.0E-18
sp|Q9FF61|SM3L1_ARATH Putative SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A member 3-like 1 OS=Arabidopsis thaliana GN=At5g05130 PE=2 SV=1 1505 1630 3.0E-18
sp|Q4PGG5|RAD5_USTMA DNA repair protein RAD5 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=RAD5 PE=3 SV=1 1488 1630 3.0E-18
sp|Q6BIP2|RAD5_DEBHA DNA repair protein RAD5 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=RAD5 PE=3 SV=2 948 1224 4.0E-18
sp|O13762|YF2C_SCHPO Uncharacterized ATP-dependent helicase C17A2.12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC17A2.12 PE=3 SV=1 1505 1630 5.0E-18
sp|Q6CJM4|RAD5_KLULA DNA repair protein RAD5 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=RAD5 PE=3 SV=1 1449 1634 7.0E-18
sp|Q9GQN5|ATRX_DROME Transcriptional regulator ATRX homolog OS=Drosophila melanogaster GN=XNP PE=1 SV=2 949 1222 1.0E-17
sp|P79051|RHP16_SCHPO ATP-dependent helicase rhp16 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rhp16 PE=3 SV=2 1495 1653 1.0E-17
sp|Q6CJM4|RAD5_KLULA DNA repair protein RAD5 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=RAD5 PE=3 SV=1 948 1229 1.0E-17
sp|F4HW51|CHR20_ARATH Protein CHROMATIN REMODELING 20 OS=Arabidopsis thaliana GN=ATRX PE=2 SV=2 949 1224 2.0E-17
sp|Q0P4U8|SMAL1_XENTR SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A-like protein 1 OS=Xenopus tropicalis GN=smarcal1 PE=2 SV=1 1491 1647 2.0E-17
sp|Q6PCN7|HLTF_MOUSE Helicase-like transcription factor OS=Mus musculus GN=Hltf PE=1 SV=1 1505 1630 2.0E-17
sp|Q5ACX1|RAD5_CANAL DNA repair protein RAD5 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=RAD5 PE=3 SV=1 1460 1630 3.0E-17
sp|Q9U7E0|ATRX_CAEEL Transcriptional regulator ATRX homolog OS=Caenorhabditis elegans GN=xnp-1 PE=1 SV=1 1488 1645 4.0E-17
sp|Q7S1P9|RAD5_NEUCR DNA repair protein rad5 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=mus-41 PE=3 SV=3 1505 1630 5.0E-17
sp|Q498E7|SMAL1_XENLA SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A-like protein 1 OS=Xenopus laevis GN=smarcal1 PE=2 SV=1 1491 1647 5.0E-17
sp|Q14527|HLTF_HUMAN Helicase-like transcription factor OS=Homo sapiens GN=HLTF PE=1 SV=2 1505 1630 6.0E-17
sp|Q6FY76|RAD5_CANGA DNA repair protein RAD5 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=RAD5 PE=3 SV=1 1480 1634 6.0E-17
sp|O13762|YF2C_SCHPO Uncharacterized ATP-dependent helicase C17A2.12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC17A2.12 PE=3 SV=1 923 1239 7.0E-17
sp|Q6BIP2|RAD5_DEBHA DNA repair protein RAD5 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=RAD5 PE=3 SV=2 1450 1634 1.0E-16
sp|Q753V5|RAD5_ASHGO DNA repair protein RAD5 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=RAD5 PE=3 SV=2 948 1225 1.0E-16
sp|Q08562|ULS1_YEAST ATP-dependent helicase ULS1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ULS1 PE=1 SV=1 1489 1634 2.0E-16
sp|Q9UNY4|TTF2_HUMAN Transcription termination factor 2 OS=Homo sapiens GN=TTF2 PE=1 SV=2 896 1194 2.0E-16
sp|O60177|YG42_SCHPO Uncharacterized ATP-dependent helicase C23E6.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC23E6.02 PE=3 SV=1 920 1228 2.0E-16
sp|Q94BR5|CHR28_ARATH Helicase-like transcription factor CHR28 OS=Arabidopsis thaliana GN=CHR28 PE=1 SV=1 1502 1630 2.0E-16
sp|Q6NZP1|ZRAB3_MOUSE DNA annealing helicase and endonuclease ZRANB3 OS=Mus musculus GN=Zranb3 PE=1 SV=1 893 1170 2.0E-16
sp|A4IHD2|ARIP4_XENTR Helicase ARIP4 OS=Xenopus tropicalis GN=rad54l2 PE=2 SV=1 1052 1227 3.0E-16
sp|Q95216|HLTF_RABIT Helicase-like transcription factor OS=Oryctolagus cuniculus GN=HLTF PE=1 SV=1 980 1227 3.0E-16
sp|Q4IJ84|RAD5_GIBZE DNA repair protein RAD5 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=RAD5 PE=3 SV=1 948 1231 3.0E-16
sp|Q9LHE4|CHR27_ARATH Helicase-like transcription factor CHR27 OS=Arabidopsis thaliana GN=CHR27 PE=1 SV=1 1502 1653 3.0E-16
sp|P31244|RAD16_YEAST DNA repair protein RAD16 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RAD16 PE=1 SV=1 1488 1639 4.0E-16
sp|Q6PCN7|HLTF_MOUSE Helicase-like transcription factor OS=Mus musculus GN=Hltf PE=1 SV=1 980 1227 4.0E-16
sp|O60177|YG42_SCHPO Uncharacterized ATP-dependent helicase C23E6.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC23E6.02 PE=3 SV=1 1505 1637 4.0E-16
sp|Q9NZC9|SMAL1_HUMAN SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A-like protein 1 OS=Homo sapiens GN=SMARCAL1 PE=1 SV=1 1491 1647 4.0E-16
sp|Q14527|HLTF_HUMAN Helicase-like transcription factor OS=Homo sapiens GN=HLTF PE=1 SV=2 980 1227 5.0E-16
sp|Q4IJ84|RAD5_GIBZE DNA repair protein RAD5 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=RAD5 PE=3 SV=1 1505 1630 6.0E-16
sp|Q5FWF4|ZRAB3_HUMAN DNA annealing helicase and endonuclease ZRANB3 OS=Homo sapiens GN=ZRANB3 PE=1 SV=2 919 1170 7.0E-16
sp|P34739|TTF2_DROME Transcription termination factor 2 OS=Drosophila melanogaster GN=lds PE=1 SV=2 918 1196 8.0E-16
sp|Q753V5|RAD5_ASHGO DNA repair protein RAD5 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=RAD5 PE=3 SV=2 1488 1634 9.0E-16
sp|P36607|RAD5_SCHPO DNA repair protein rad8 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rad8 PE=1 SV=1 1492 1630 1.0E-15
sp|E1BB03|ZRAB3_BOVIN DNA annealing helicase and endonuclease ZRANB3 OS=Bos taurus GN=ZRANB3 PE=3 SV=3 919 1170 2.0E-15
sp|P54509|YQHH_BACSU Uncharacterized ATP-dependent helicase YqhH OS=Bacillus subtilis (strain 168) GN=yqhH PE=3 SV=1 1489 1637 3.0E-15
sp|B2ZFP3|SMAL1_DANRE SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A-like protein 1 OS=Danio rerio GN=smarcal1 PE=2 SV=1 1491 1615 3.0E-15
sp|Q95216|HLTF_RABIT Helicase-like transcription factor OS=Oryctolagus cuniculus GN=HLTF PE=1 SV=1 1505 1630 4.0E-15
sp|P32849|RAD5_YEAST DNA repair protein RAD5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RAD5 PE=1 SV=1 1487 1634 4.0E-15
sp|Q6FY76|RAD5_CANGA DNA repair protein RAD5 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=RAD5 PE=3 SV=1 948 1225 5.0E-15
sp|Q57X81|JBP2_TRYB2 Bifunctional helicase and thymine dioxygenase JBP2 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) GN=JBP2 PE=1 SV=1 1487 1637 8.0E-15
sp|Q9TTA5|SMAL1_BOVIN SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A-like protein 1 OS=Bos taurus GN=SMARCAL1 PE=2 SV=2 1491 1647 8.0E-15
sp|Q0P4U8|SMAL1_XENTR SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A-like protein 1 OS=Xenopus tropicalis GN=smarcal1 PE=2 SV=1 923 1170 1.0E-14
sp|B2ZFP3|SMAL1_DANRE SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A-like protein 1 OS=Danio rerio GN=smarcal1 PE=2 SV=1 923 1200 1.0E-14
sp|B4F769|SMAL1_RAT SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A-like protein 1 OS=Rattus norvegicus GN=Smarcal1 PE=2 SV=1 1491 1647 1.0E-14
sp|Q6C2R8|RAD5_YARLI DNA repair protein RAD5 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=RAD5 PE=3 SV=1 1488 1630 2.0E-14
sp|Q8BJL0|SMAL1_MOUSE SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A-like protein 1 OS=Mus musculus GN=Smarcal1 PE=1 SV=1 1491 1647 2.0E-14
sp|Q4WVM1|RAD5_ASPFU DNA repair protein rad5 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=rad5 PE=3 SV=2 1414 1627 3.0E-14
sp|P32849|RAD5_YEAST DNA repair protein RAD5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RAD5 PE=1 SV=1 948 1225 3.0E-14
sp|Q57X81|JBP2_TRYB2 Bifunctional helicase and thymine dioxygenase JBP2 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) GN=JBP2 PE=1 SV=1 919 1188 3.0E-14
sp|Q4DCH3|JBP2_TRYCC Bifunctional helicase and thymine dioxygenase JBP2 OS=Trypanosoma cruzi (strain CL Brener) GN=JBP2 PE=3 SV=1 1487 1629 5.0E-14
sp|B4F769|SMAL1_RAT SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A-like protein 1 OS=Rattus norvegicus GN=Smarcal1 PE=2 SV=1 923 1170 6.0E-14
sp|Q9TTA5|SMAL1_BOVIN SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A-like protein 1 OS=Bos taurus GN=SMARCAL1 PE=2 SV=2 923 1170 7.0E-14
sp|Q8BJL0|SMAL1_MOUSE SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A-like protein 1 OS=Mus musculus GN=Smarcal1 PE=1 SV=1 923 1170 7.0E-14
sp|Q498E7|SMAL1_XENLA SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A-like protein 1 OS=Xenopus laevis GN=smarcal1 PE=2 SV=1 923 1170 8.0E-14
sp|P41447|GTA_NPVAC Probable global transactivator OS=Autographa californica nuclear polyhedrosis virus GN=GTA PE=3 SV=1 1490 1637 1.0E-13
sp|Q8MNV7|SMAL1_CAEEL Putative SMARCAL1-like protein OS=Caenorhabditis elegans GN=C16A3.1 PE=3 SV=1 1505 1645 1.0E-13
sp|Q9FF61|SM3L1_ARATH Putative SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A member 3-like 1 OS=Arabidopsis thaliana GN=At5g05130 PE=2 SV=1 980 1240 2.0E-13
sp|F4I8S3|CLSY3_ARATH SNF2 domain-containing protein CLASSY 3 OS=Arabidopsis thaliana GN=CLSY3 PE=1 SV=1 1471 1635 2.0E-13
sp|Q9NZC9|SMAL1_HUMAN SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A-like protein 1 OS=Homo sapiens GN=SMARCAL1 PE=1 SV=1 923 1198 3.0E-13
sp|Q9VMX6|SMAL1_DROME SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A-like protein 1 OS=Drosophila melanogaster GN=Marcal1 PE=1 SV=2 1486 1640 3.0E-13
sp|O10302|GTA_NPVOP Probable global transactivator OS=Orgyia pseudotsugata multicapsid polyhedrosis virus GN=GTA PE=3 SV=1 920 1224 5.0E-13
sp|P0CQ66|RAD5_CRYNJ DNA repair protein RAD5 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=RAD5 PE=3 SV=1 980 1228 6.0E-13
sp|O10302|GTA_NPVOP Probable global transactivator OS=Orgyia pseudotsugata multicapsid polyhedrosis virus GN=GTA PE=3 SV=1 1492 1617 6.0E-13
sp|P0CQ67|RAD5_CRYNB DNA repair protein RAD5 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=RAD5 PE=3 SV=1 980 1228 7.0E-13
sp|Q6NZP1|ZRAB3_MOUSE DNA annealing helicase and endonuclease ZRANB3 OS=Mus musculus GN=Zranb3 PE=1 SV=1 1491 1618 2.0E-12
sp|E1BB03|ZRAB3_BOVIN DNA annealing helicase and endonuclease ZRANB3 OS=Bos taurus GN=ZRANB3 PE=3 SV=3 1491 1617 2.0E-12
sp|Q5FWF4|ZRAB3_HUMAN DNA annealing helicase and endonuclease ZRANB3 OS=Homo sapiens GN=ZRANB3 PE=1 SV=2 1491 1617 3.0E-12
sp|Q9LK10|CLSY4_ARATH SNF2 domain-containing protein CLASSY 4 OS=Arabidopsis thaliana GN=CLSY4 PE=1 SV=1 1479 1635 3.0E-12
sp|Q5BHD6|RAD5_EMENI DNA repair protein rad5 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=rad5 PE=3 SV=1 1502 1627 4.0E-12
sp|Q4PGG5|RAD5_USTMA DNA repair protein RAD5 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=RAD5 PE=3 SV=1 980 1226 7.0E-12
sp|Q94BR5|CHR28_ARATH Helicase-like transcription factor CHR28 OS=Arabidopsis thaliana GN=CHR28 PE=1 SV=1 1040 1225 8.0E-12
sp|F4I8S3|CLSY3_ARATH SNF2 domain-containing protein CLASSY 3 OS=Arabidopsis thaliana GN=CLSY3 PE=1 SV=1 923 1235 4.0E-11
sp|F4K493|CLSY2_ARATH SNF2 domain-containing protein CLASSY 2 OS=Arabidopsis thaliana GN=CLSY2 PE=1 SV=1 1460 1643 5.0E-11
sp|Q9M297|CLSY1_ARATH SNF2 domain-containing protein CLASSY 1 OS=Arabidopsis thaliana GN=CLSY1 PE=1 SV=1 1460 1643 6.0E-11
sp|A4HVU6|JBP2_LEIIN Bifunctional helicase and thymine dioxygenase JBP2 OS=Leishmania infantum GN=JBP2 PE=3 SV=2 1487 1637 7.0E-11
sp|Q8MNV7|SMAL1_CAEEL Putative SMARCAL1-like protein OS=Caenorhabditis elegans GN=C16A3.1 PE=3 SV=1 884 1174 2.0E-10
sp|Q4QFY1|JBP2_LEIMA Bifunctional helicase and thymine dioxygenase JBP2 OS=Leishmania major GN=JBP2 PE=3 SV=2 1487 1637 2.0E-10
sp|Q9SIW2|CHR35_ARATH Protein CHROMATIN REMODELING 35 OS=Arabidopsis thaliana GN=DRD1 PE=1 SV=1 1488 1612 3.0E-10
sp|Q9UTL9|YIV5_SCHPO Uncharacterized ATP-dependent helicase C144.05 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC144.05 PE=3 SV=1 1505 1621 4.0E-10
sp|B6EU02|JBP2_LEITA Bifunctional helicase and thymine dioxygenase JBP2 OS=Leishmania tarentolae GN=JBP2 PE=1 SV=1 1487 1637 8.0E-10
sp|Q9VMX6|SMAL1_DROME SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A-like protein 1 OS=Drosophila melanogaster GN=Marcal1 PE=1 SV=2 927 1204 1.0E-09
sp|Q9LHE4|CHR27_ARATH Helicase-like transcription factor CHR27 OS=Arabidopsis thaliana GN=CHR27 PE=1 SV=1 1049 1225 2.0E-09
sp|A4H7G5|JBP2_LEIBR Bifunctional helicase and thymine dioxygenase JBP2 OS=Leishmania braziliensis GN=JBP2 PE=3 SV=1 1487 1637 4.0E-09
sp|O55764|172L_IIV6 Putative helicase 172L OS=Invertebrate iridescent virus 6 GN=IIV6-172L PE=3 SV=1 1505 1627 4.0E-08
sp|P54509|YQHH_BACSU Uncharacterized ATP-dependent helicase YqhH OS=Bacillus subtilis (strain 168) GN=yqhH PE=3 SV=1 945 1128 2.0E-07
sp|Q149N8|SHPRH_HUMAN E3 ubiquitin-protein ligase SHPRH OS=Homo sapiens GN=SHPRH PE=1 SV=2 1488 1617 5.0E-07
sp|Q7TPQ3|SHPRH_MOUSE E3 ubiquitin-protein ligase SHPRH OS=Mus musculus GN=Shprh PE=1 SV=1 1488 1617 8.0E-07
sp|A4HVU6|JBP2_LEIIN Bifunctional helicase and thymine dioxygenase JBP2 OS=Leishmania infantum GN=JBP2 PE=3 SV=2 919 1199 2.0E-06
sp|Q9M1I1|FB304_ARATH F-box protein At3g54460 OS=Arabidopsis thaliana GN=At3g54460 PE=2 SV=1 1476 1622 2.0E-06
sp|B6EU02|JBP2_LEITA Bifunctional helicase and thymine dioxygenase JBP2 OS=Leishmania tarentolae GN=JBP2 PE=1 SV=1 919 1199 3.0E-06
sp|Q4QFY1|JBP2_LEIMA Bifunctional helicase and thymine dioxygenase JBP2 OS=Leishmania major GN=JBP2 PE=3 SV=2 919 1199 4.0E-06
sp|Q18DN4|HMU_HALWD Halomucin OS=Haloquadratum walsbyi (strain DSM 16790 / HBSQ001) GN=hmu PE=3 SV=1 550 698 6.0E-06
sp|Q4DCH3|JBP2_TRYCC Bifunctional helicase and thymine dioxygenase JBP2 OS=Trypanosoma cruzi (strain CL Brener) GN=JBP2 PE=3 SV=1 920 1188 7.0E-06
sp|Q18DN4|HMU_HALWD Halomucin OS=Haloquadratum walsbyi (strain DSM 16790 / HBSQ001) GN=hmu PE=3 SV=1 556 698 8.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016787 hydrolase activity Yes
GO:0005524 ATP binding Yes
GO:0140658 ATP-dependent chromatin remodeler activity Yes
GO:0003677 DNA binding Yes
GO:0017076 purine nucleotide binding No
GO:0140097 catalytic activity, acting on DNA No
GO:0005488 binding No
GO:0003674 molecular_function No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0000166 nucleotide binding No
GO:0043167 ion binding No
GO:0140640 catalytic activity, acting on a nucleic acid No
GO:0032553 ribonucleotide binding No
GO:0097367 carbohydrate derivative binding No
GO:0003824 catalytic activity No
GO:0043168 anion binding No
GO:0097159 organic cyclic compound binding No
GO:1901265 nucleoside phosphate binding No
GO:0032555 purine ribonucleotide binding No
GO:1901363 heterocyclic compound binding No
GO:0032559 adenyl ribonucleotide binding No
GO:0036094 small molecule binding No
GO:0140657 ATP-dependent activity No
GO:0003676 nucleic acid binding No
GO:0008094 ATP-dependent activity, acting on DNA No
GO:0030554 adenyl nucleotide binding No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup1652
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|6542
Ophiocordyceps australis map64 (Brazil) OphauB2|5870 (this protein)
Ophiocordyceps camponoti-floridani Ophcf2|05416
Ophiocordyceps camponoti-rufipedis Ophun1|1543
Ophiocordyceps kimflemingae Ophio5|4165
Ophiocordyceps subramaniannii Hirsu2|1357

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|5870
MLQQVVAACNVIRFHCPQLHRLPAKKFCRRSDISTQKPTLTAFLPPQMLASSGTRPQHLSAPPCHDARNRVARSR
ASRRDSPLITITANRALSASGVCPPSQPLKTDATSHPNGHTNGHASQRTNGHTNGSSDKGARDRINQRNDDDDND
QRPTKRRRTRGDTTPPPGLRKPKPESPPWRRIEAEGPTSFTQNGRRKSGRINNIPVEFQPRGNRRTKQPSAPCVT
SSPHNQDSSLPATSKGAKNTWNKEKQPTSKSALSGPKALKKPSPESRSSSRSLRRRSHSPPPQPTRHSARRRQTS
RLAQSPERIAAAAVSSTHHRHPPENDYKSPRIKLRVSRSGTIPLVHPDQVQKRPKIGTSFQDFWERAGCIPVEEG
GLLASEDGAPYTDEMAVRDARLILRIEEELEPGGILSQQRCSLFAPEPEEEPPRQWARQDHMVKAMANFRKLLLA
EQQRHRATAKKLAEACRDEWLRRQPKSAKEVEAEETEHWTNRYRTVVKAMTSTWENVRVEVNKRRLEQWEAEEQK
RVKAALNEAVSLSEQKLQARRGGLDSELPSDDDGFSDLSDEMSITGSDNEHLLVDLDDDVGDEMGQDDDSDNMST
SDEEDEGDTSRDLGDENLTQEQLRAKYANLPDIDLSVDEQVHDASRNNDETAGETGLDTAADTSDESVNMDDDLG
SSDIESNDENQDDGEDTSSESGEETTGLLGLLFGKAELRKMRTNASVSAHQQQESDIEMPNRDDVATASNRVNHN
GDEEEEDDDKMSLVRHPDSCDDDAQSDSNMLEDTAQPDIGAEESNKMIDDDGLTRSDDAKIYTTVLKADQVKNQD
LQMSTLSDSGPHDGGAVDQGAITDGVKQVAEKVRSTEMKPDTSTPSPARSQGSSMLGPKPLEADMLAPTDTKMAR
AETSRGSSAQPRSVHKTEIPFLLRGTLREYQHDGLDWLAGLYMNNTNGILADEMGLGKTIQTIALLAHLACFHEV
WGPHLVVVPTSVMLNWEMEFKKWCPGFKILAYYGSQEERKRKRQGWNNDDVWNVCITSYQLVLQDQQVFKRRRWH
YMILDEAHNIKNFKSQRWQTLLGFNTHSRLLLTGTPLQNNLTELWSLLFFLMPSENGVGGFADLQEFHDWFHKPE
SQILESGRDQMDEEAKAIISKLHKVLRPYLLRRLKADVEKQMPAKYEHVELCRLSKRQRELYDGFLSRSDTKETL
ASGNYMSIINCLMQLRKVCNHPDLFIDRPIMTSFRMQKSVAAGFEVTERRLRGSLLAEDGMASVNFGFLNLVPAE
HEKLDTMHAETVSRLALGESLMRLGEVQKARAQETCSELNPSTIKSTLAHVEKAARWSRFEEVQHSLYLNSLRRQ
QRPIYGCNVVNLVNMAAHRRPCRPRPKVPHKIMAWFENDSTFVKAMMPTLDERADALKTAIDKFSCVTPAVVTRD
LNPFLLGRRGIQAFTECDLELSAPVRWAPFLPKEAPIDPWQVARMRLSIQFPDKRLLQYDCGKLQVLDKLLRKLQ
SGGHRALIFTQMTKVLDVLERFLNIHGHKYLRLDGATKVEQRQIMTDRFNNDDRILCFILSTRSGGLGINLTGAD
TVIFYDQDWNPAMDKQCQDRCHRIGQTRDVHIYRLISEHTIEANILRKASQKQMLDDVVIQEGEFTTDYFNRLSV
RDVLTENVDLTSEGVAAADAALDRVLGGPESSSKEQQTVGRALEQAEDREDVAAARVAEREIQADDADFTEKASG
PATRQGTPSVKSALEANDDDETEYNAWNVRVHNIDDFMLTWMMEELKDSKLELPRDKKKSKKKKGKDTRKR*
Coding >OphauB2|5870
ATGCTACAACAAGTTGTTGCTGCTTGCAACGTGATTCGGTTCCACTGTCCTCAACTCCATCGTCTCCCGGCCAAA
AAGTTTTGCAGACGATCCGACATCAGTACTCAAAAACCAACACTGACTGCATTTTTGCCTCCGCAAATGTTGGCC
TCGTCGGGAACGCGCCCTCAGCATCTTTCGGCTCCACCCTGCCATGATGCCCGAAACCGCGTCGCCCGATCTCGT
GCCAGCCGTCGCGACTCTCCGCTCATCACAATCACCGCCAACAGAGCTCTCTCTGCCTCTGGAGTATGTCCACCA
AGCCAACCCTTGAAAACCGACGCAACGTCTCACCCCAACGGGCACACAAACGGACATGCGAGCCAGCGTACAAAC
GGACACACCAACGGATCTAGTGACAAAGGTGCAAGAGATAGGATCAATCAAAGAAACGATGATGATGACAACGAT
CAACGTCCTACGAAGCGGCGTCGGACCCGCGGAGATACGACTCCCCCACCCGGCCTCCGCAAGCCAAAGCCCGAG
TCGCCGCCTTGGAGGAGAATCGAGGCTGAAGGACCTACTTCATTTACGCAAAATGGGAGACGAAAATCAGGTCGC
ATCAACAACATTCCCGTCGAATTCCAGCCCCGCGGCAATAGGCGGACTAAGCAGCCCTCGGCCCCATGTGTTACA
AGCTCGCCGCACAACCAAGATTCGTCTTTGCCCGCCACTTCGAAAGGGGCCAAGAATACGTGGAATAAAGAAAAG
CAACCCACCTCGAAAAGTGCCCTTAGCGGCCCCAAGGCGCTCAAAAAGCCAAGTCCTGAGTCTAGATCATCATCC
CGTTCTCTACGGCGTCGCAGCCACTCTCCCCCGCCGCAACCTACGCGACATTCGGCCCGCCGACGCCAGACGTCA
CGTCTTGCACAGTCGCCTGAGCGGATAGCTGCTGCTGCTGTCTCTTCCACTCATCATCGCCACCCTCCAGAAAAT
GACTACAAATCGCCCAGGATTAAGCTGCGTGTTTCTCGATCGGGAACAATTCCTCTGGTCCACCCCGACCAAGTT
CAAAAACGGCCCAAAATTGGCACAAGCTTCCAAGATTTTTGGGAGCGTGCTGGCTGTATCCCTGTCGAAGAGGGC
GGGCTGCTAGCATCAGAAGATGGAGCACCATACACAGACGAGATGGCAGTAAGAGACGCACGCCTTATTCTGCGC
ATCGAAGAAGAATTAGAGCCTGGTGGAATCCTATCGCAGCAGCGTTGCTCCTTGTTTGCTCCGGAGCCTGAGGAA
GAGCCTCCGCGACAATGGGCGCGACAGGACCACATGGTCAAAGCCATGGCCAACTTTCGCAAACTCCTTTTGGCG
GAGCAGCAAAGACATCGGGCCACGGCCAAGAAGCTCGCAGAGGCTTGCCGGGATGAGTGGCTGCGTCGGCAGCCC
AAATCTGCTAAAGAAGTCGAGGCAGAAGAAACAGAACACTGGACTAACCGCTATCGGACTGTGGTCAAGGCCATG
ACCAGCACGTGGGAAAATGTTCGAGTCGAGGTCAATAAACGCCGTCTAGAGCAGTGGGAGGCAGAGGAACAAAAG
CGAGTCAAAGCCGCCCTCAATGAAGCCGTGAGTTTGTCTGAGCAGAAGCTGCAGGCTCGTCGTGGGGGGCTGGAC
TCGGAACTGCCATCCGACGACGACGGTTTTAGTGATCTGAGCGACGAAATGAGCATCACCGGTAGCGACAACGAG
CATCTTCTCGTGGACTTGGATGATGACGTTGGCGACGAGATGGGCCAAGATGATGACAGCGACAACATGTCGACT
TCTGACGAAGAGGATGAAGGCGACACCTCGCGAGACTTGGGTGACGAGAACCTAACTCAAGAGCAGCTACGGGCC
AAGTATGCGAACCTTCCAGATATAGATCTGTCAGTGGACGAACAAGTACATGATGCATCGAGAAACAATGACGAG
ACGGCGGGTGAGACAGGACTTGATACAGCCGCTGATACGAGTGATGAGTCGGTGAACATGGATGACGATCTTGGG
TCCAGCGATATTGAAAGCAATGACGAAAATCAAGACGATGGTGAGGATACGAGCTCCGAGTCAGGCGAGGAAACA
ACAGGACTACTCGGACTTCTTTTTGGCAAGGCGGAATTGAGGAAGATGAGGACAAATGCATCAGTCTCTGCGCAT
CAGCAGCAAGAAAGTGATATTGAAATGCCAAACAGAGATGACGTGGCCACAGCCTCTAACCGAGTAAATCACAAT
GGCGATGAGGAAGAAGAAGATGATGACAAGATGTCGCTCGTCAGACATCCCGACTCGTGTGATGACGACGCGCAG
TCAGACTCCAACATGCTCGAGGACACGGCGCAACCCGACATTGGCGCAGAAGAGTCAAACAAGATGATTGATGAT
GATGGGTTGACAAGGTCGGATGATGCCAAAATATATACGACTGTTTTAAAGGCCGACCAAGTTAAAAACCAAGAC
TTGCAAATGTCGACTCTGTCCGATTCTGGGCCTCATGATGGAGGCGCTGTGGACCAAGGCGCCATTACAGATGGC
GTCAAACAAGTTGCGGAGAAAGTCAGAAGCACCGAGATGAAGCCAGACACAAGCACGCCTAGTCCTGCGCGAAGC
CAAGGCTCATCAATGTTGGGGCCAAAGCCACTCGAAGCAGACATGTTGGCTCCCACAGACACAAAGATGGCGAGA
GCAGAGACCAGCAGAGGCTCCTCGGCCCAGCCGCGTAGCGTACACAAGACTGAAATACCATTCTTGCTTCGTGGA
ACCTTGCGTGAGTACCAACATGATGGACTGGACTGGCTAGCTGGTCTCTACATGAACAATACAAATGGCATTCTT
GCAGATGAGATGGGACTGGGCAAGACGATACAAACAATAGCGCTCCTAGCGCACCTGGCCTGCTTTCACGAGGTC
TGGGGCCCTCACTTGGTAGTCGTACCGACTAGTGTCATGCTCAACTGGGAGATGGAGTTCAAGAAGTGGTGTCCT
GGATTCAAGATTCTTGCTTACTACGGCTCGCAAGAGGAGCGGAAACGCAAGCGCCAAGGCTGGAACAATGACGAT
GTGTGGAATGTCTGCATTACGTCGTATCAGCTTGTACTCCAAGACCAACAAGTCTTCAAACGACGCCGATGGCAC
TACATGATTCTCGACGAGGCCCACAATATTAAAAACTTCAAATCGCAGCGCTGGCAAACGCTGCTGGGCTTCAAC
ACGCACTCGCGTCTCCTTTTAACAGGTACTCCGCTCCAGAACAATCTCACGGAGCTCTGGTCTCTTTTATTCTTC
TTGATGCCATCGGAAAATGGCGTGGGCGGATTTGCCGACCTCCAAGAGTTTCACGACTGGTTCCATAAGCCCGAG
TCACAGATCTTGGAGAGCGGCAGGGACCAGATGGACGAAGAAGCCAAGGCAATCATCTCCAAGCTGCACAAGGTG
TTGCGTCCGTATCTCTTGCGTCGACTCAAGGCCGATGTGGAGAAGCAAATGCCAGCCAAGTATGAGCATGTTGAG
CTTTGCAGGCTCTCGAAGCGGCAACGCGAGCTCTACGATGGCTTTCTCTCTCGGAGCGACACCAAGGAGACACTG
GCCTCGGGCAACTACATGTCCATTATTAACTGCCTTATGCAGCTTCGCAAGGTGTGCAATCATCCCGACTTGTTT
ATTGATCGCCCCATCATGACGTCGTTTCGCATGCAAAAATCGGTGGCGGCAGGCTTTGAAGTGACTGAGCGCCGG
TTGCGAGGCTCCCTGCTGGCAGAAGATGGCATGGCGTCGGTCAACTTTGGCTTCTTGAATCTCGTACCGGCCGAG
CATGAAAAACTTGACACGATGCACGCTGAGACAGTCTCGCGCTTGGCTTTGGGCGAATCCTTGATGAGGCTGGGC
GAGGTGCAGAAGGCACGGGCTCAGGAGACTTGCAGCGAGCTCAACCCGTCGACAATCAAGTCGACCCTGGCCCAT
GTTGAAAAGGCAGCTCGCTGGAGCCGGTTCGAAGAAGTGCAGCACTCGCTCTATCTCAATTCGCTTCGACGACAA
CAGCGACCGATATATGGGTGCAATGTGGTCAATCTGGTAAACATGGCAGCACACAGGCGCCCCTGCAGGCCTCGG
CCCAAAGTACCACACAAGATTATGGCTTGGTTCGAAAATGACTCGACTTTTGTCAAGGCAATGATGCCTACATTG
GATGAACGCGCCGACGCCCTCAAGACTGCAATCGACAAGTTTTCATGCGTGACGCCGGCGGTGGTTACCAGAGAC
TTGAATCCCTTTCTCCTGGGCCGCAGAGGCATCCAGGCGTTTACCGAATGCGATCTCGAGCTGTCAGCGCCAGTC
AGATGGGCACCCTTTTTGCCCAAGGAAGCACCAATTGATCCGTGGCAAGTGGCGCGTATGCGCCTGAGTATTCAG
TTTCCCGATAAGCGCCTGCTCCAGTACGATTGCGGCAAATTGCAGGTGTTGGACAAGCTGTTGCGCAAGCTGCAG
TCTGGAGGCCATCGAGCCCTCATCTTCACGCAAATGACCAAGGTTTTGGACGTTTTGGAGCGGTTTCTCAACATA
CATGGCCACAAGTATCTGCGGCTGGATGGAGCAACCAAGGTTGAGCAGCGTCAAATCATGACGGATCGCTTCAAT
AATGATGACCGCATCCTTTGCTTTATTCTCTCCACCAGATCGGGAGGTCTGGGCATCAACCTCACAGGCGCCGAC
ACTGTCATCTTTTACGATCAAGACTGGAACCCAGCCATGGACAAGCAGTGTCAGGACCGGTGCCATCGCATTGGG
CAGACTCGCGACGTGCACATATATCGACTGATTAGCGAGCACACGATTGAGGCCAATATTTTGCGCAAAGCCTCT
CAGAAGCAGATGCTCGACGACGTTGTCATTCAAGAGGGAGAGTTTACGACTGACTACTTCAACCGGCTATCGGTA
CGAGACGTCTTGACGGAAAATGTCGACTTGACGAGTGAGGGCGTAGCAGCGGCCGACGCAGCTCTTGACCGAGTG
CTTGGTGGGCCCGAGAGCAGCAGCAAAGAGCAGCAGACTGTTGGAAGAGCATTGGAGCAAGCAGAGGATCGAGAG
GATGTTGCCGCAGCGCGTGTAGCAGAGAGAGAAATCCAGGCCGACGACGCCGACTTTACAGAAAAGGCGAGCGGA
CCGGCAACCAGACAAGGCACGCCATCGGTTAAATCCGCCTTGGAAGCCAACGATGATGACGAGACAGAATACAAC
GCGTGGAATGTAAGAGTGCACAACATTGACGACTTTATGCTCACCTGGATGATGGAGGAATTGAAAGATAGTAAG
CTAGAGCTACCAAGGGACAAGAAGAAGAGCAAGAAGAAAAAGGGGAAAGACACGCGAAAGCGATGA
Transcript >OphauB2|5870
ATGCTACAACAAGTTGTTGCTGCTTGCAACGTGATTCGGTTCCACTGTCCTCAACTCCATCGTCTCCCGGCCAAA
AAGTTTTGCAGACGATCCGACATCAGTACTCAAAAACCAACACTGACTGCATTTTTGCCTCCGCAAATGTTGGCC
TCGTCGGGAACGCGCCCTCAGCATCTTTCGGCTCCACCCTGCCATGATGCCCGAAACCGCGTCGCCCGATCTCGT
GCCAGCCGTCGCGACTCTCCGCTCATCACAATCACCGCCAACAGAGCTCTCTCTGCCTCTGGAGTATGTCCACCA
AGCCAACCCTTGAAAACCGACGCAACGTCTCACCCCAACGGGCACACAAACGGACATGCGAGCCAGCGTACAAAC
GGACACACCAACGGATCTAGTGACAAAGGTGCAAGAGATAGGATCAATCAAAGAAACGATGATGATGACAACGAT
CAACGTCCTACGAAGCGGCGTCGGACCCGCGGAGATACGACTCCCCCACCCGGCCTCCGCAAGCCAAAGCCCGAG
TCGCCGCCTTGGAGGAGAATCGAGGCTGAAGGACCTACTTCATTTACGCAAAATGGGAGACGAAAATCAGGTCGC
ATCAACAACATTCCCGTCGAATTCCAGCCCCGCGGCAATAGGCGGACTAAGCAGCCCTCGGCCCCATGTGTTACA
AGCTCGCCGCACAACCAAGATTCGTCTTTGCCCGCCACTTCGAAAGGGGCCAAGAATACGTGGAATAAAGAAAAG
CAACCCACCTCGAAAAGTGCCCTTAGCGGCCCCAAGGCGCTCAAAAAGCCAAGTCCTGAGTCTAGATCATCATCC
CGTTCTCTACGGCGTCGCAGCCACTCTCCCCCGCCGCAACCTACGCGACATTCGGCCCGCCGACGCCAGACGTCA
CGTCTTGCACAGTCGCCTGAGCGGATAGCTGCTGCTGCTGTCTCTTCCACTCATCATCGCCACCCTCCAGAAAAT
GACTACAAATCGCCCAGGATTAAGCTGCGTGTTTCTCGATCGGGAACAATTCCTCTGGTCCACCCCGACCAAGTT
CAAAAACGGCCCAAAATTGGCACAAGCTTCCAAGATTTTTGGGAGCGTGCTGGCTGTATCCCTGTCGAAGAGGGC
GGGCTGCTAGCATCAGAAGATGGAGCACCATACACAGACGAGATGGCAGTAAGAGACGCACGCCTTATTCTGCGC
ATCGAAGAAGAATTAGAGCCTGGTGGAATCCTATCGCAGCAGCGTTGCTCCTTGTTTGCTCCGGAGCCTGAGGAA
GAGCCTCCGCGACAATGGGCGCGACAGGACCACATGGTCAAAGCCATGGCCAACTTTCGCAAACTCCTTTTGGCG
GAGCAGCAAAGACATCGGGCCACGGCCAAGAAGCTCGCAGAGGCTTGCCGGGATGAGTGGCTGCGTCGGCAGCCC
AAATCTGCTAAAGAAGTCGAGGCAGAAGAAACAGAACACTGGACTAACCGCTATCGGACTGTGGTCAAGGCCATG
ACCAGCACGTGGGAAAATGTTCGAGTCGAGGTCAATAAACGCCGTCTAGAGCAGTGGGAGGCAGAGGAACAAAAG
CGAGTCAAAGCCGCCCTCAATGAAGCCGTGAGTTTGTCTGAGCAGAAGCTGCAGGCTCGTCGTGGGGGGCTGGAC
TCGGAACTGCCATCCGACGACGACGGTTTTAGTGATCTGAGCGACGAAATGAGCATCACCGGTAGCGACAACGAG
CATCTTCTCGTGGACTTGGATGATGACGTTGGCGACGAGATGGGCCAAGATGATGACAGCGACAACATGTCGACT
TCTGACGAAGAGGATGAAGGCGACACCTCGCGAGACTTGGGTGACGAGAACCTAACTCAAGAGCAGCTACGGGCC
AAGTATGCGAACCTTCCAGATATAGATCTGTCAGTGGACGAACAAGTACATGATGCATCGAGAAACAATGACGAG
ACGGCGGGTGAGACAGGACTTGATACAGCCGCTGATACGAGTGATGAGTCGGTGAACATGGATGACGATCTTGGG
TCCAGCGATATTGAAAGCAATGACGAAAATCAAGACGATGGTGAGGATACGAGCTCCGAGTCAGGCGAGGAAACA
ACAGGACTACTCGGACTTCTTTTTGGCAAGGCGGAATTGAGGAAGATGAGGACAAATGCATCAGTCTCTGCGCAT
CAGCAGCAAGAAAGTGATATTGAAATGCCAAACAGAGATGACGTGGCCACAGCCTCTAACCGAGTAAATCACAAT
GGCGATGAGGAAGAAGAAGATGATGACAAGATGTCGCTCGTCAGACATCCCGACTCGTGTGATGACGACGCGCAG
TCAGACTCCAACATGCTCGAGGACACGGCGCAACCCGACATTGGCGCAGAAGAGTCAAACAAGATGATTGATGAT
GATGGGTTGACAAGGTCGGATGATGCCAAAATATATACGACTGTTTTAAAGGCCGACCAAGTTAAAAACCAAGAC
TTGCAAATGTCGACTCTGTCCGATTCTGGGCCTCATGATGGAGGCGCTGTGGACCAAGGCGCCATTACAGATGGC
GTCAAACAAGTTGCGGAGAAAGTCAGAAGCACCGAGATGAAGCCAGACACAAGCACGCCTAGTCCTGCGCGAAGC
CAAGGCTCATCAATGTTGGGGCCAAAGCCACTCGAAGCAGACATGTTGGCTCCCACAGACACAAAGATGGCGAGA
GCAGAGACCAGCAGAGGCTCCTCGGCCCAGCCGCGTAGCGTACACAAGACTGAAATACCATTCTTGCTTCGTGGA
ACCTTGCGTGAGTACCAACATGATGGACTGGACTGGCTAGCTGGTCTCTACATGAACAATACAAATGGCATTCTT
GCAGATGAGATGGGACTGGGCAAGACGATACAAACAATAGCGCTCCTAGCGCACCTGGCCTGCTTTCACGAGGTC
TGGGGCCCTCACTTGGTAGTCGTACCGACTAGTGTCATGCTCAACTGGGAGATGGAGTTCAAGAAGTGGTGTCCT
GGATTCAAGATTCTTGCTTACTACGGCTCGCAAGAGGAGCGGAAACGCAAGCGCCAAGGCTGGAACAATGACGAT
GTGTGGAATGTCTGCATTACGTCGTATCAGCTTGTACTCCAAGACCAACAAGTCTTCAAACGACGCCGATGGCAC
TACATGATTCTCGACGAGGCCCACAATATTAAAAACTTCAAATCGCAGCGCTGGCAAACGCTGCTGGGCTTCAAC
ACGCACTCGCGTCTCCTTTTAACAGGTACTCCGCTCCAGAACAATCTCACGGAGCTCTGGTCTCTTTTATTCTTC
TTGATGCCATCGGAAAATGGCGTGGGCGGATTTGCCGACCTCCAAGAGTTTCACGACTGGTTCCATAAGCCCGAG
TCACAGATCTTGGAGAGCGGCAGGGACCAGATGGACGAAGAAGCCAAGGCAATCATCTCCAAGCTGCACAAGGTG
TTGCGTCCGTATCTCTTGCGTCGACTCAAGGCCGATGTGGAGAAGCAAATGCCAGCCAAGTATGAGCATGTTGAG
CTTTGCAGGCTCTCGAAGCGGCAACGCGAGCTCTACGATGGCTTTCTCTCTCGGAGCGACACCAAGGAGACACTG
GCCTCGGGCAACTACATGTCCATTATTAACTGCCTTATGCAGCTTCGCAAGGTGTGCAATCATCCCGACTTGTTT
ATTGATCGCCCCATCATGACGTCGTTTCGCATGCAAAAATCGGTGGCGGCAGGCTTTGAAGTGACTGAGCGCCGG
TTGCGAGGCTCCCTGCTGGCAGAAGATGGCATGGCGTCGGTCAACTTTGGCTTCTTGAATCTCGTACCGGCCGAG
CATGAAAAACTTGACACGATGCACGCTGAGACAGTCTCGCGCTTGGCTTTGGGCGAATCCTTGATGAGGCTGGGC
GAGGTGCAGAAGGCACGGGCTCAGGAGACTTGCAGCGAGCTCAACCCGTCGACAATCAAGTCGACCCTGGCCCAT
GTTGAAAAGGCAGCTCGCTGGAGCCGGTTCGAAGAAGTGCAGCACTCGCTCTATCTCAATTCGCTTCGACGACAA
CAGCGACCGATATATGGGTGCAATGTGGTCAATCTGGTAAACATGGCAGCACACAGGCGCCCCTGCAGGCCTCGG
CCCAAAGTACCACACAAGATTATGGCTTGGTTCGAAAATGACTCGACTTTTGTCAAGGCAATGATGCCTACATTG
GATGAACGCGCCGACGCCCTCAAGACTGCAATCGACAAGTTTTCATGCGTGACGCCGGCGGTGGTTACCAGAGAC
TTGAATCCCTTTCTCCTGGGCCGCAGAGGCATCCAGGCGTTTACCGAATGCGATCTCGAGCTGTCAGCGCCAGTC
AGATGGGCACCCTTTTTGCCCAAGGAAGCACCAATTGATCCGTGGCAAGTGGCGCGTATGCGCCTGAGTATTCAG
TTTCCCGATAAGCGCCTGCTCCAGTACGATTGCGGCAAATTGCAGGTGTTGGACAAGCTGTTGCGCAAGCTGCAG
TCTGGAGGCCATCGAGCCCTCATCTTCACGCAAATGACCAAGGTTTTGGACGTTTTGGAGCGGTTTCTCAACATA
CATGGCCACAAGTATCTGCGGCTGGATGGAGCAACCAAGGTTGAGCAGCGTCAAATCATGACGGATCGCTTCAAT
AATGATGACCGCATCCTTTGCTTTATTCTCTCCACCAGATCGGGAGGTCTGGGCATCAACCTCACAGGCGCCGAC
ACTGTCATCTTTTACGATCAAGACTGGAACCCAGCCATGGACAAGCAGTGTCAGGACCGGTGCCATCGCATTGGG
CAGACTCGCGACGTGCACATATATCGACTGATTAGCGAGCACACGATTGAGGCCAATATTTTGCGCAAAGCCTCT
CAGAAGCAGATGCTCGACGACGTTGTCATTCAAGAGGGAGAGTTTACGACTGACTACTTCAACCGGCTATCGGTA
CGAGACGTCTTGACGGAAAATGTCGACTTGACGAGTGAGGGCGTAGCAGCGGCCGACGCAGCTCTTGACCGAGTG
CTTGGTGGGCCCGAGAGCAGCAGCAAAGAGCAGCAGACTGTTGGAAGAGCATTGGAGCAAGCAGAGGATCGAGAG
GATGTTGCCGCAGCGCGTGTAGCAGAGAGAGAAATCCAGGCCGACGACGCCGACTTTACAGAAAAGGCGAGCGGA
CCGGCAACCAGACAAGGCACGCCATCGGTTAAATCCGCCTTGGAAGCCAACGATGATGACGAGACAGAATACAAC
GCGTGGAATGTAAGAGTGCACAACATTGACGACTTTATGCTCACCTGGATGATGGAGGAATTGAAAGATAGTAAG
CTAGAGCTACCAAGGGACAAGAAGAAGAGCAAGAAGAAAAAGGGGAAAGACACGCGAAAGCGATGA
Gene >OphauB2|5870
ATGCTACAACAAGTTGTTGCTGCTTGCAACGTGATTCGGTTCCACTGTCCTCAACTCCATCGTCTCCCGGCCAAA
AAGTTTTGCAGACGATCCGACATCAGTACTCAAAAACCAACACTGGTAGCGCTACAGACTCCCGACCATGTGCAA
ACTTTGTATGAATACTTGCTAAACCACCCCCAATCCGTAGACTGCATTTTTGCCTCCGCAAATGTTGGCCTCGTC
GGGAACGCGCCCTCAGCATCTTTCGGCTCCACCCTGCCATGATGCCCGAAACCGCGTCGCCCGATCTCGTGCCAG
CCGTCGCGACTCTCCGCTCATCACAATCACCGCCAACAGAGCTCTCTCTGCCTCTGGAGTATGGTACAGGACGAA
ATAGGCCTGATAACTCTGTTTCCTCCGACTGCAATAACAACCGTGGCCTCACCTCAACCAGTCCACCAAGCCAAC
CCTTGAAAACCGACGCAACGTCTCACCCCAACGGGCACACAAACGGACATGCGAGCCAGCGTACAAACGGACACA
CCAACGGATCTAGTGACAAAGGTGCAAGAGATAGGATCAATCAAAGAAACGATGATGATGACAACGATCAACGTC
CTACGAAGCGGCGTCGGACCCGCGGAGATACGACTCCCCCACCCGGCCTCCGCAAGCCAAAGCCCGAGTCGCCGC
CTTGGAGGAGAATCGAGGCTGAAGGACCTACTTCATTTACGCAAAATGGGAGACGAAAATCAGGTCGCATCAACA
ACATTCCCGTCGAATTCCAGCCCCGCGGCAATAGGCGGACTAAGCAGCCCTCGGCCCCATGTGTTACAAGCTCGC
CGCACAACCAAGATTCGTCTTTGCCCGCCACTTCGAAAGGGGCCAAGAATACGTGGAATAAAGAAAAGCAACCCA
CCTCGAAAAGTGCCCTTAGCGGCCCCAAGGCGCTCAAAAAGCCAAGTCCTGAGTCTAGATCATCATCCCGTTCTC
TACGGCGTCGCAGCCACTCTCCCCCGCCGCAACCTACGCGACATTCGGCCCGCCGACGCCAGACGTCACGTCTTG
CACAGTCGCCTGAGCGGATAGCTGCTGCTGCTGTCTCTTCCACTCATCATCGCCACCCTCCAGAAAATGACTACA
AATCGCCCAGGATTAAGCTGCGTGTTTCTCGATCGGGAACAATTCCTCTGGTCCACCCCGACCAAGTTCAAAAAC
GGCCCAAAATTGGCACAAGCTTCCAAGATTTTTGGGAGCGTGCTGGCTGTATCCCTGTCGAAGAGGGCGGGCTGC
TAGCATCAGAAGATGGAGCACCATACACAGACGAGATGGCAGTAAGAGACGCACGCCTTATTCTGCGCATCGAAG
AAGAATTAGAGCCTGGTGGAATCCTATCGCAGCAGCGTTGCTCCTTGTTTGCTCCGGAGCCTGAGGAAGAGCCTC
CGCGACAATGGGCGCGACAGGACCACATGGTCAAAGCCATGGCCAACTTTCGCAAACTCCTTTTGGCGGAGCAGC
AAAGACATCGGGCCACGGCCAAGAAGCTCGCAGAGGCTTGCCGGGATGAGTGGCTGCGTCGGCAGCCCAAATCTG
CTAAAGAAGTCGAGGCAGAAGAAACAGAACACTGGACTAACCGCTATCGGACTGTGGTCAAGGCCATGACCAGCA
CGTGGGAAAATGTTCGAGTCGAGGTCAATAAACGCCGTCTAGAGCAGTGGGAGGCAGAGGAACAAAAGCGAGTCA
AAGCCGCCCTCAATGAAGCCGTGAGTTTGTCTGAGCAGAAGCTGCAGGCTCGTCGTGGGGGGCTGGACTCGGAAC
TGCCATCCGACGACGACGGTTTTAGTGATCTGAGCGACGAAATGAGCATCACCGGTAGCGACAACGAGCATCTTC
TCGTGGACTTGGATGATGACGTTGGCGACGAGATGGGCCAAGATGATGACAGCGACAACATGTCGACTTCTGACG
AAGAGGATGAAGGCGACACCTCGCGAGACTTGGGTGACGAGAACCTAACTCAAGAGCAGCTACGGGCCAAGTATG
CGAACCTTCCAGATATAGATCTGTCAGTGGACGAACAAGTACATGATGCATCGAGAAACAATGACGAGACGGCGG
GTGAGACAGGACTTGATACAGCCGCTGATACGAGTGATGAGTCGGTGAACATGGATGACGATCTTGGGTCCAGCG
ATATTGAAAGCAATGACGAAAATCAAGACGATGGTGAGGATACGAGCTCCGAGTCAGGCGAGGAAACAACAGGAC
TACTCGGACTTCTTTTTGGCAAGGCGGAATTGAGGAAGATGAGGACAAATGCATCAGTCTCTGCGCATCAGCAGC
AAGAAAGTGATATTGAAATGCCAAACAGAGATGACGTGGCCACAGCCTCTAACCGAGTAAATCACAATGGCGATG
AGGAAGAAGAAGATGATGACAAGATGTCGCTCGTCAGACATCCCGACTCGTGTGATGACGACGCGCAGTCAGACT
CCAACATGCTCGAGGACACGGCGCAACCCGACATTGGCGCAGAAGAGTCAAACAAGATGATTGATGATGATGGGT
TGACAAGGTCGGATGATGCCAAAATATATACGACTGTTTTAAAGGCCGACCAAGTTAAAAACCAAGACTTGCAAA
TGTCGACTCTGTCCGATTCTGGGCCTCATGATGGAGGCGCTGTGGACCAAGGCGCCATTACAGATGGCGTCAAAC
AAGTTGCGGAGAAAGTCAGAAGCACCGAGATGAAGCCAGACACAAGCACGCCTAGTCCTGCGCGAAGCCAAGGCT
CATCAATGTTGGGGCCAAAGCCACTCGAAGCAGACATGTTGGCTCCCACAGACACAAAGATGGCGAGAGCAGAGA
CCAGCAGAGGCTCCTCGGCCCAGCCGCGTAGCGTACACAAGACTGAAATACCATTCTTGCTTCGTGGAACCTTGC
GTGAGTACCAACATGATGGACTGGACTGGCTAGCTGGTCTCTACATGAACAATACAAATGGCATTCTTGCAGATG
AGATGGGACTGGGCAAGACGATACAAACAATAGCGCTCCTAGCGCACCTGGCCTGCTTTCACGAGGTCTGGGGCC
CTCACTTGGTAGTCGTACCGACTAGTGTCATGCTCAACTGGGAGATGGAGTTCAAGAAGTGGTGTCCTGGATTCA
AGATTCTTGCTTACTACGGCTCGCAAGAGGAGCGGAAACGCAAGCGCCAAGGCTGGAACAATGACGATGTGTGGA
ATGTCTGCATTACGTCGTATCAGCTTGTACTCCAAGACCAACAAGTCTTCAAACGACGCCGATGGCACTACATGA
TTCTCGACGAGGCCCACAATATTAAAAACTTCAAATCGCAGCGCTGGCAAACGCTGCTGGGCTTCAACACGCACT
CGCGTCTCCTTTTAACAGGTACTCCGCTCCAGAACAATCTCACGGAGCTCTGGTCTCTTTTATTCTTCTTGATGC
CATCGGAAAATGGCGTGGGCGGATTTGCCGACCTCCAAGAGTTTCACGACTGGTTCCATAAGCCCGAGTCACAGA
TCTTGGAGAGCGGCAGGGACCAGATGGACGAAGAAGCCAAGGCAATCATCTCCAAGCTGCACAAGGTGTTGCGTC
CGTATCTCTTGCGTCGACTCAAGGCCGATGTGGAGAAGCAAATGCCAGCCAAGTATGAGCATGTTGAGCTTTGCA
GGCTCTCGAAGCGGCAACGCGAGCTCTACGATGGCTTTCTCTCTCGGAGCGACACCAAGGAGACACTGGCCTCGG
GCAACTACATGTCCATTATTAACTGCCTTATGCAGCTTCGCAAGGTGTGCAATCATCCCGACTTGTTTATTGATC
GCCCCATCATGACGTCGTTTCGCATGCAAAAATCGGTGGCGGCAGGCTTTGAAGTGACTGAGCGCCGGTTGCGAG
GCTCCCTGCTGGCAGAAGATGGCATGGCGTCGGTCAACTTTGGCTTCTTGAATCTCGTACCGGCCGAGCATGAAA
AACTTGACACGATGCACGCTGAGACAGTCTCGCGCTTGGCTTTGGGCGAATCCTTGATGAGGCTGGGCGAGGTGC
AGAAGGCACGGGCTCAGGAGACTTGCAGCGAGCTCAACCCGTCGACAATCAAGTCGACCCTGGCCCATGTTGAAA
AGGCAGCTCGCTGGAGCCGGTTCGAAGAAGTGCAGCACTCGCTCTATCTCAATTCGCTTCGACGACAACAGCGAC
CGATATATGGGTGCAATGTGGTCAATCTGGTAAACATGGCAGCACACAGGCGCCCCTGCAGGCCTCGGCCCAAAG
TACCACACAAGATTATGGCTTGGTTCGAAAATGACTCGACTTTTGTCAAGGCAATGATGCCTACATTGGATGAAC
GCGCCGACGCCCTCAAGACTGCAATCGACAAGTTTTCATGCGTGACGCCGGCGGTGGTTACCAGAGACTTGAATC
CCTTTCTCCTGGGCCGCAGAGGCATCCAGGCGTTTACCGAATGCGATCTCGAGCTGTCAGCGCCAGTCAGATGGG
CACCCTTTTTGCCCAAGGAAGCACCAATTGATCCGTGGCAAGTGGCGCGTATGCGCCTGAGTATTCAGTTTCCCG
ATAAGCGCCTGCTCCAGTACGATTGCGGCAAATTGCAGGTGTTGGACAAGCTGTTGCGCAAGCTGCAGTCTGGAG
GCCATCGAGCCCTCATCTTCACGCAAATGACCAAGGTTTTGGACGTTTTGGAGCGGTTTCTCAACATACATGGCC
ACAAGTATCTGCGGCTGGATGGAGCAACCAAGGTTGAGCAGCGTCAAATCATGACGGATCGCTTCAATAATGATG
ACCGCATCCTTTGCTTTATTCTCTCCACCAGATCGGGAGGTCTGGGCATCAACCTCACAGGCGCCGACACTGTCA
TCTTTTACGATCAAGACTGGAACCCAGCCATGGACAAGCAGTGTCAGGACCGGTGCCATCGCATTGGGCAGACTC
GCGACGTGCACATATATCGACTGATTAGCGAGCACACGATTGAGGCCAATATTTTGCGCAAAGCCTCTCAGAAGC
AGATGCTCGACGACGTTGTCATTCAAGAGGGAGAGTTTACGACTGACTACTTCAACCGGCTATCGGTACGAGACG
TCTTGACGGAAAATGTCGACTTGACGAGTGAGGGCGTAGCAGCGGCCGACGCAGCTCTTGACCGAGTGCTTGGTG
GGCCCGAGAGCAGCAGCAAAGAGCAGCAGACTGTTGGAAGAGCATTGGAGCAAGCAGAGGATCGAGAGGATGTTG
CCGCAGCGCGTGTAGCAGAGAGAGAAATCCAGGCCGACGACGCCGACTTTACAGAAAAGGCGAGCGGACCGGCAA
CCAGACAAGGCACGCCATCGGTTAAATCCGCCTTGGAAGCCAACGATGATGACGAGACAGAATACAACGCGTGGA
ATGTAAGAGTGCACAACATTGACGACTTTATGCTCACCTGGATGATGGAGGAATTGAAAGATAGTAAGCTAGAGC
TACCAAGGGACAAGAAGAAGAGCAAGAAGAAAAAGGGGAAAGACACGCGAAAGCGATGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail