Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|5869
Gene name
LocationContig_5:38932..39672
Strand-
Gene length (bp)740
Transcript length (bp)531
Coding sequence length (bp)531
Protein length (aa) 177

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05821 NDUF_B8 NADH-ubiquinone oxidoreductase ASHI subunit (CI-ASHI or NDUFB8) 7.0E-09 12 126

Swissprot hits

(None)

GO

GO Term Description Terminal node
GO:0005739 mitochondrion Yes
GO:0110165 cellular anatomical entity No
GO:0043229 intracellular organelle No
GO:0043226 organelle No
GO:0005575 cellular_component No
GO:0043231 intracellular membrane-bounded organelle No
GO:0043227 membrane-bounded organelle No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 13 0.45

Transmembrane Domains

Domain # Start End Length
1 120 142 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|5869
MMLSTRLVRVAALRSSLTAPASQRLLSTTQRRSFFPNDHSTRRVLDEKYPEPPHLTEAEDPGMNGGYINPPYIKR
QFRDPYADWWDPQERRNFGEPVHEDNDRLAIFSPYEYTWTTPGPGFVMLMAFVSVFLGLSAIVYYNYPDRVSYPR
EFEGGLERELGGPGARRARMAGDPDP*
Coding >OphauB2|5869
ATGATGCTCTCCACGAGACTTGTGCGCGTTGCGGCGCTGCGCTCCAGCTTAACAGCGCCCGCATCCCAACGACTC
CTCTCGACAACACAGCGCCGGAGTTTCTTTCCCAATGATCACTCTACGAGGCGCGTGCTGGATGAAAAGTACCCC
GAACCGCCGCACTTGACCGAAGCCGAAGATCCGGGCATGAACGGTGGCTACATCAATCCTCCATATATCAAGCGG
CAATTCCGCGATCCTTATGCCGATTGGTGGGACCCGCAGGAACGACGCAACTTTGGCGAACCAGTCCATGAAGAC
AACGACAGACTAGCCATCTTTTCACCCTACGAGTACACATGGACGACACCTGGTCCAGGCTTCGTCATGCTCATG
GCCTTTGTTTCCGTCTTTCTCGGGCTTTCTGCGATTGTTTATTACAACTACCCAGATAGAGTGAGCTACCCGAGA
GAATTCGAGGGCGGCTTGGAACGGGAGCTTGGCGGTCCCGGTGCGCGCAGGGCCCGCATGGCGGGTGATCCAGAT
CCATGA
Transcript >OphauB2|5869
ATGATGCTCTCCACGAGACTTGTGCGCGTTGCGGCGCTGCGCTCCAGCTTAACAGCGCCCGCATCCCAACGACTC
CTCTCGACAACACAGCGCCGGAGTTTCTTTCCCAATGATCACTCTACGAGGCGCGTGCTGGATGAAAAGTACCCC
GAACCGCCGCACTTGACCGAAGCCGAAGATCCGGGCATGAACGGTGGCTACATCAATCCTCCATATATCAAGCGG
CAATTCCGCGATCCTTATGCCGATTGGTGGGACCCGCAGGAACGACGCAACTTTGGCGAACCAGTCCATGAAGAC
AACGACAGACTAGCCATCTTTTCACCCTACGAGTACACATGGACGACACCTGGTCCAGGCTTCGTCATGCTCATG
GCCTTTGTTTCCGTCTTTCTCGGGCTTTCTGCGATTGTTTATTACAACTACCCAGATAGAGTGAGCTACCCGAGA
GAATTCGAGGGCGGCTTGGAACGGGAGCTTGGCGGTCCCGGTGCGCGCAGGGCCCGCATGGCGGGTGATCCAGAT
CCATGA
Gene >OphauB2|5869
ATGGTCAGCCGCAGCTATACATGATTTCTCTCTTGACTGGGTGCGGCTGTTTGTCAAGCCAGCGACTGACCTTGC
TGCCCAGATGCTCTCCACGAGACTTGTGCGCGTTGCGGCGCTGCGCTCCAGCTTAACAGCGCCCGCATCCCAACG
ACTCCTCTCGACAACACAGCGCCGGAGTTTCTTTCCCAATGATCACTCTACGAGGCGCGTGCTGGATGAAAAGTA
CCCCGAACCGCCGCACTTGACCGAAGCCGAAGATCCGGGCATGGTCAGTCCCAATCTGAGCTGCTGCATCATTGT
TCCCTCTTCACCTTGGAGCGCAGCTGATACTCGATGGTCTCGATAGAACGGTGGCTACATCAATCCTCCATATAT
CAAGCGGCAATTCCGCGATCCTTATGCCGATTGGTGGGACCCGCAGGAACGACGCAACTTTGGCGAACCAGTCCA
TGAAGACAACGACAGACTAGCCATCTTTTCACCCTACGAGTACACATGGACGACACCTGGTCCAGGCTTCGTCAT
GCTCATGGCCTTTGTTTCCGTCTTTCTCGGGCTTTCTGCGATTGTTTATTACAACTACCCAGATAGAGTGAGCTA
CCCGAGAGAATTCGAGGGCGGCTTGGAACGGGAGCTTGGCGGTCCCGGTGCGCGCAGGGTAAGCCGTATTGGTCA
TATCTTTGAAGCTATATAATAACATTTTCTTCTAGGCCCGCATGGCGGGTGATCCAGATCCATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail