Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|5866
Gene name
LocationContig_5:32141..33841
Strand+
Gene length (bp)1700
Transcript length (bp)1638
Coding sequence length (bp)1638
Protein length (aa) 546

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01053 Cys_Met_Meta_PP Cys/Met metabolism PLP-dependent enzyme 2.2E-19 208 533

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O74314|MET7_SCHPO Probable cystathionine gamma-synthase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC15D4.09c PE=3 SV=1 208 530 8.0E-63
sp|Q12198|METW_YEAST Putative cystathionine gamma-synthase YLL058W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YLL058W PE=1 SV=1 9 534 5.0E-62
sp|P38675|MET7_NEUCR Cystathionine gamma-synthase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=met-7 PE=3 SV=3 208 539 3.0E-56
sp|P47164|MET7_YEAST Cystathionine gamma-synthase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=STR2 PE=1 SV=1 203 537 1.0E-43
sp|Q04533|METX_YEAST Putative cystathionine gamma-synthase YML082W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YML082W PE=1 SV=1 208 534 5.0E-40
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O74314|MET7_SCHPO Probable cystathionine gamma-synthase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC15D4.09c PE=3 SV=1 208 530 8.0E-63
sp|Q12198|METW_YEAST Putative cystathionine gamma-synthase YLL058W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YLL058W PE=1 SV=1 9 534 5.0E-62
sp|P38675|MET7_NEUCR Cystathionine gamma-synthase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=met-7 PE=3 SV=3 208 539 3.0E-56
sp|P47164|MET7_YEAST Cystathionine gamma-synthase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=STR2 PE=1 SV=1 203 537 1.0E-43
sp|Q04533|METX_YEAST Putative cystathionine gamma-synthase YML082W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YML082W PE=1 SV=1 208 534 5.0E-40
sp|P0A4K2|METC_LACLA Cystathionine beta-lyase OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=metC PE=3 SV=1 210 534 1.0E-10
sp|A2RM21|METC_LACLM Cystathionine beta-lyase OS=Lactococcus lactis subsp. cremoris (strain MG1363) GN=metC PE=1 SV=1 210 534 1.0E-10
sp|Q04533|METX_YEAST Putative cystathionine gamma-synthase YML082W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YML082W PE=1 SV=1 1 170 1.0E-09
sp|P0C2T9|METC_LACLC Cystathionine beta-lyase OS=Lactococcus lactis subsp. cremoris GN=metC PE=1 SV=1 210 534 1.0E-09
sp|Q83A83|METC_COXBU Cystathionine beta-lyase OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) GN=metC PE=1 SV=1 282 534 7.0E-09
sp|Q1M0P5|METB_HELPX Cystathionine gamma-synthase OS=Helicobacter pylori GN=metB PE=1 SV=1 164 533 6.0E-08
sp|P47164|MET7_YEAST Cystathionine gamma-synthase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=STR2 PE=1 SV=1 5 152 8.0E-08
sp|P56069|METB_HELPY Cystathionine gamma-synthase OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=metB PE=1 SV=1 210 533 1.0E-07
sp|P31373|CYS3_YEAST Cystathionine gamma-lyase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CYS3 PE=1 SV=2 186 537 2.0E-07
sp|O05394|MCCB_BACSU Cystathionine gamma-lyase OS=Bacillus subtilis (strain 168) GN=mccB PE=1 SV=1 210 530 4.0E-07
sp|Q9ZMW7|METB_HELPJ Cystathionine gamma-synthase OS=Helicobacter pylori (strain J99 / ATCC 700824) GN=metB PE=3 SV=1 210 530 6.0E-07
sp|P55216|CGL2_CAEEL Putative cystathionine gamma-lyase 2 OS=Caenorhabditis elegans GN=cth-2 PE=3 SV=1 260 523 8.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0019346 transsulfuration Yes
GO:0030170 pyridoxal phosphate binding Yes
GO:0043436 oxoacid metabolic process No
GO:0019842 vitamin binding No
GO:0006790 sulfur compound metabolic process No
GO:0019752 carboxylic acid metabolic process No
GO:0006082 organic acid metabolic process No
GO:0008150 biological_process No
GO:0005488 binding No
GO:0000096 sulfur amino acid metabolic process No
GO:0003674 molecular_function No
GO:1901605 alpha-amino acid metabolic process No
GO:0006534 cysteine metabolic process No
GO:0043167 ion binding No
GO:0006520 cellular amino acid metabolic process No
GO:0050667 homocysteine metabolic process No
GO:0009069 serine family amino acid metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0097159 organic cyclic compound binding No
GO:1901363 heterocyclic compound binding No
GO:0071704 organic substance metabolic process No
GO:0044281 small molecule metabolic process No
GO:0044237 cellular metabolic process No
GO:0036094 small molecule binding No
GO:0008152 metabolic process No
GO:0009987 cellular process No
GO:0070279 vitamin B6 binding No
GO:0044238 primary metabolic process No
GO:0009092 homoserine metabolic process No
GO:1901564 organonitrogen compound metabolic process No
GO:0043168 anion binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 32 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|5866
MSAPITTPFGHAIPPAPRHSVTVHMPGWAAAERFAYDVGSLVASFKNAYPRMKPHPDITSLSQAVLGRLGTADRD
CYLFSSLQSARECVEYSTSSARDNGTDKQPVALDQISIRCFTAKDLFYAVIFPLPQSATVAGFWSSPGAGLSSRF
AEANLACLECLTQVAVPDSETPRPRFDGAVHHLLRERIISYLERAPCSLAQPSPTTGDVYLFQSGMAAIYKPHSY
MLSLYHGTTVLFGMAFTNTVTLFGELGPGLKFFPRGIDEDLSDLEAFLQDERVHGRKVQAIWAEFPANPSLITPN
LVRLRSLADEYDIVLAIDDTIGSWANIDITSKVDILVTSLTKSFNGYADVIAGSAILNPSSAKYRDLKPLFDRHY
VPELYADDVETIERNSRDYLTRAAILNANASALAQYFAQCAKDPSNAVVRALYPSVNASGKYYTQVMRSETTHFK
PGYGSLLSVEFCDLATTRAFYEELNVHKGPHQGAPLTLAVPYNVCVYGKRLDWAIEHGYKPTQIRIAVGLEDTNT
LLEDFRIAVVAANQAKGQAE*
Coding >OphauB2|5866
ATGTCGGCTCCCATCACGACTCCCTTTGGCCATGCCATACCGCCAGCGCCCCGCCATTCAGTAACGGTGCACATG
CCTGGATGGGCAGCTGCTGAGCGGTTCGCTTACGATGTTGGCTCCCTTGTTGCATCTTTCAAAAATGCCTACCCT
CGAATGAAGCCGCACCCAGACATAACCAGCCTCAGCCAAGCTGTCCTTGGACGACTAGGGACAGCTGACCGTGAT
TGCTATCTCTTCTCGTCTCTGCAGTCTGCCAGAGAATGCGTCGAGTACTCTACGTCGAGCGCACGAGACAACGGC
ACCGATAAGCAGCCAGTGGCGTTGGACCAAATCAGTATTCGTTGTTTTACTGCCAAGGACCTTTTCTATGCCGTC
ATCTTTCCCCTGCCCCAGAGCGCCACTGTTGCCGGCTTCTGGAGCAGCCCAGGCGCGGGCTTATCGTCTCGATTT
GCAGAGGCCAACCTCGCCTGTCTAGAATGTCTGACTCAAGTGGCAGTGCCCGACTCTGAGACGCCCAGGCCAAGA
TTTGACGGTGCCGTGCATCACCTGCTACGGGAGAGAATTATCTCCTATCTTGAGCGCGCCCCGTGCAGCCTCGCG
CAACCGAGTCCAACGACAGGCGACGTTTACCTCTTCCAGTCAGGCATGGCCGCCATCTATAAGCCGCACTCGTAC
ATGCTCAGTCTCTACCACGGAACAACTGTCCTCTTTGGCATGGCATTCACAAATACCGTTACCTTGTTTGGAGAA
CTAGGTCCTGGTTTGAAATTCTTTCCCCGCGGCATAGATGAGGACCTGTCGGATTTAGAGGCTTTTCTCCAAGAC
GAACGCGTTCACGGACGCAAAGTCCAGGCGATTTGGGCCGAATTTCCTGCCAATCCCAGTCTCATTACTCCAAAC
CTCGTCCGGCTCCGCTCGCTGGCAGACGAATACGACATAGTACTTGCCATTGACGACACCATAGGAAGCTGGGCC
AACATTGACATCACCAGCAAGGTTGATATATTGGTCACTTCACTGACCAAGTCTTTCAATGGCTATGCAGATGTC
ATTGCTGGGAGCGCCATTCTCAACCCCTCGTCTGCCAAGTATCGCGATTTGAAGCCGCTCTTTGATCGACACTAT
GTCCCGGAGCTGTACGCCGACGACGTTGAGACTATTGAGCGAAACAGCCGCGATTATCTCACTCGCGCTGCGATA
CTCAATGCCAATGCCAGTGCCCTTGCGCAGTACTTTGCACAATGTGCAAAGGATCCCAGCAATGCAGTTGTCAGA
GCGCTCTATCCCTCAGTTAATGCCTCTGGCAAGTATTACACCCAAGTCATGCGCTCTGAAACAACACACTTCAAG
CCCGGCTACGGCAGCCTCTTGAGCGTCGAGTTTTGCGACTTGGCCACGACGCGTGCCTTTTATGAAGAGCTCAAT
GTGCATAAAGGCCCCCACCAAGGAGCTCCACTCACCTTGGCCGTTCCGTATAACGTTTGCGTCTATGGGAAGCGC
CTTGATTGGGCAATAGAGCATGGCTATAAGCCGACGCAGATACGCATTGCCGTGGGCCTGGAGGATACGAATACT
CTCCTCGAGGACTTTAGAATTGCAGTAGTGGCGGCCAACCAGGCAAAGGGACAAGCAGAGTAA
Transcript >OphauB2|5866
ATGTCGGCTCCCATCACGACTCCCTTTGGCCATGCCATACCGCCAGCGCCCCGCCATTCAGTAACGGTGCACATG
CCTGGATGGGCAGCTGCTGAGCGGTTCGCTTACGATGTTGGCTCCCTTGTTGCATCTTTCAAAAATGCCTACCCT
CGAATGAAGCCGCACCCAGACATAACCAGCCTCAGCCAAGCTGTCCTTGGACGACTAGGGACAGCTGACCGTGAT
TGCTATCTCTTCTCGTCTCTGCAGTCTGCCAGAGAATGCGTCGAGTACTCTACGTCGAGCGCACGAGACAACGGC
ACCGATAAGCAGCCAGTGGCGTTGGACCAAATCAGTATTCGTTGTTTTACTGCCAAGGACCTTTTCTATGCCGTC
ATCTTTCCCCTGCCCCAGAGCGCCACTGTTGCCGGCTTCTGGAGCAGCCCAGGCGCGGGCTTATCGTCTCGATTT
GCAGAGGCCAACCTCGCCTGTCTAGAATGTCTGACTCAAGTGGCAGTGCCCGACTCTGAGACGCCCAGGCCAAGA
TTTGACGGTGCCGTGCATCACCTGCTACGGGAGAGAATTATCTCCTATCTTGAGCGCGCCCCGTGCAGCCTCGCG
CAACCGAGTCCAACGACAGGCGACGTTTACCTCTTCCAGTCAGGCATGGCCGCCATCTATAAGCCGCACTCGTAC
ATGCTCAGTCTCTACCACGGAACAACTGTCCTCTTTGGCATGGCATTCACAAATACCGTTACCTTGTTTGGAGAA
CTAGGTCCTGGTTTGAAATTCTTTCCCCGCGGCATAGATGAGGACCTGTCGGATTTAGAGGCTTTTCTCCAAGAC
GAACGCGTTCACGGACGCAAAGTCCAGGCGATTTGGGCCGAATTTCCTGCCAATCCCAGTCTCATTACTCCAAAC
CTCGTCCGGCTCCGCTCGCTGGCAGACGAATACGACATAGTACTTGCCATTGACGACACCATAGGAAGCTGGGCC
AACATTGACATCACCAGCAAGGTTGATATATTGGTCACTTCACTGACCAAGTCTTTCAATGGCTATGCAGATGTC
ATTGCTGGGAGCGCCATTCTCAACCCCTCGTCTGCCAAGTATCGCGATTTGAAGCCGCTCTTTGATCGACACTAT
GTCCCGGAGCTGTACGCCGACGACGTTGAGACTATTGAGCGAAACAGCCGCGATTATCTCACTCGCGCTGCGATA
CTCAATGCCAATGCCAGTGCCCTTGCGCAGTACTTTGCACAATGTGCAAAGGATCCCAGCAATGCAGTTGTCAGA
GCGCTCTATCCCTCAGTTAATGCCTCTGGCAAGTATTACACCCAAGTCATGCGCTCTGAAACAACACACTTCAAG
CCCGGCTACGGCAGCCTCTTGAGCGTCGAGTTTTGCGACTTGGCCACGACGCGTGCCTTTTATGAAGAGCTCAAT
GTGCATAAAGGCCCCCACCAAGGAGCTCCACTCACCTTGGCCGTTCCGTATAACGTTTGCGTCTATGGGAAGCGC
CTTGATTGGGCAATAGAGCATGGCTATAAGCCGACGCAGATACGCATTGCCGTGGGCCTGGAGGATACGAATACT
CTCCTCGAGGACTTTAGAATTGCAGTAGTGGCGGCCAACCAGGCAAAGGGACAAGCAGAGTAA
Gene >OphauB2|5866
ATGTCGGCTCCCATCACGACTCCCTTTGGCCATGCCATACCGCCAGCGCCCCGCCATTCAGTAACGGTGCACATG
CCTGGATGGGCAGCTGCTGAGCGGTTCGCTTACGATGTTGGCTCCCTTGTTGCATCTTTCAAAAATGCCTACCCT
CGAATGAAGCCGCACCCAGACATAACCAGCGTGACTATACCTCCCCCACCCGTGACTTTTGCTCGCCTCGCCTCA
TCTGACACTCCGTGCAGCTCAGCCAAGCTGTCCTTGGACGACTAGGGACAGCTGACCGTGATTGCTATCTCTTCT
CGTCTCTGCAGTCTGCCAGAGAATGCGTCGAGTACTCTACGTCGAGCGCACGAGACAACGGCACCGATAAGCAGC
CAGTGGCGTTGGACCAAATCAGTATTCGTTGTTTTACTGCCAAGGACCTTTTCTATGCCGTCATCTTTCCCCTGC
CCCAGAGCGCCACTGTTGCCGGCTTCTGGAGCAGCCCAGGCGCGGGCTTATCGTCTCGATTTGCAGAGGCCAACC
TCGCCTGTCTAGAATGTCTGACTCAAGTGGCAGTGCCCGACTCTGAGACGCCCAGGCCAAGATTTGACGGTGCCG
TGCATCACCTGCTACGGGAGAGAATTATCTCCTATCTTGAGCGCGCCCCGTGCAGCCTCGCGCAACCGAGTCCAA
CGACAGGCGACGTTTACCTCTTCCAGTCAGGCATGGCCGCCATCTATAAGCCGCACTCGTACATGCTCAGTCTCT
ACCACGGAACAACTGTCCTCTTTGGCATGGCATTCACAAATACCGTTACCTTGTTTGGAGAACTAGGTCCTGGTT
TGAAATTCTTTCCCCGCGGCATAGATGAGGACCTGTCGGATTTAGAGGCTTTTCTCCAAGACGAACGCGTTCACG
GACGCAAAGTCCAGGCGATTTGGGCCGAATTTCCTGCCAATCCCAGTCTCATTACTCCAAACCTCGTCCGGCTCC
GCTCGCTGGCAGACGAATACGACATAGTACTTGCCATTGACGACACCATAGGAAGCTGGGCCAACATTGACATCA
CCAGCAAGGTTGATATATTGGTCACTTCACTGACCAAGTCTTTCAATGGCTATGCAGATGTCATTGCTGGGAGCG
CCATTCTCAACCCCTCGTCTGCCAAGTATCGCGATTTGAAGCCGCTCTTTGATCGACACTATGTCCCGGAGCTGT
ACGCCGACGACGTTGAGACTATTGAGCGAAACAGCCGCGATTATCTCACTCGCGCTGCGATACTCAATGCCAATG
CCAGTGCCCTTGCGCAGTACTTTGCACAATGTGCAAAGGATCCCAGCAATGCAGTTGTCAGAGCGCTCTATCCCT
CAGTTAATGCCTCTGGCAAGTATTACACCCAAGTCATGCGCTCTGAAACAACACACTTCAAGCCCGGCTACGGCA
GCCTCTTGAGCGTCGAGTTTTGCGACTTGGCCACGACGCGTGCCTTTTATGAAGAGCTCAATGTGCATAAAGGCC
CCCACCAAGGAGCTCCACTCACCTTGGCCGTTCCGTATAACGTTTGCGTCTATGGGAAGCGCCTTGATTGGGCAA
TAGAGCATGGCTATAAGCCGACGCAGATACGCATTGCCGTGGGCCTGGAGGATACGAATACTCTCCTCGAGGACT
TTAGAATTGCAGTAGTGGCGGCCAACCAGGCAAAGGGACAAGCAGAGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail