Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|5850
Gene name
LocationContig_49:123218..124754
Strand+
Gene length (bp)1536
Transcript length (bp)1359
Coding sequence length (bp)1359
Protein length (aa) 453

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF14027 Questin_oxidase Questin oxidase-like 5.0E-65 48 386

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q6UEF1|AFLY_ASPPA Oxidoreductase AflY OS=Aspergillus parasiticus GN=aflY PE=4 SV=1 2 452 3.0E-47

GO

GO Term Description Terminal node
GO:0016491 oxidoreductase activity Yes
GO:0003824 catalytic activity No
GO:0003674 molecular_function No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup405
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|6941
Ophiocordyceps australis map64 (Brazil) OphauB2|5850 (this protein)
Ophiocordyceps camponoti-floridani Ophcf2|04830
Ophiocordyceps camponoti-rufipedis Ophun1|5854
Ophiocordyceps kimflemingae Ophio5|5164
Ophiocordyceps kimflemingae Ophio5|682
Ophiocordyceps subramaniannii Hirsu2|2221
Ophiocordyceps subramaniannii Hirsu2|2825

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|5850
MATPKVNVSAKQTGLLNMEQTPEAAETVSQLLNQDLERHHVFYNDRGFHDHIVHHLLTLYGSGANASALAAAYQA
NQVVQRRAGQADASLVAALHADWPATSRAHFGQGEHYASFLRFFQDAIAQRGAQAVAQDVLFAELPNPPRRGMVA
RLYSGLVHPLLQLLYGLEWEQPAIVAAALAQTAVHPSDVGDLMVGVDEYSRDKQADAASVEDLCHEVHRRGGPLA
QAASFNDMGFEYIERMGRHGLVALLARIRVDPSHDLDQDTARLVHSAAYLVAAAAWHPPHKPTFDFFLMQVAPSF
HLLTSSLFFLSLPPLSPAARARLIEWHLRLQVFEYIAHGCPALRLDHVLRDWSAPAGMAAATPRHLLPRLLLTAD
DGHVVKVARALVVACDLSRKWQGCSWIRIAGHDAWVKLMQILLTSVDGRGDDWLRQGKQWVRGAGFEEAWEEMPI
ME*
Coding >OphauB2|5850
ATGGCGACACCAAAGGTCAACGTGTCGGCAAAGCAGACGGGCCTGCTAAACATGGAGCAGACACCCGAGGCAGCA
GAGACGGTGTCGCAGCTCCTCAACCAGGACCTCGAGAGGCATCACGTCTTTTACAACGATCGAGGCTTCCACGAC
CACATTGTCCACCACCTCCTCACCCTCTACGGCAGCGGCGCCAACGCGTCTGCCCTGGCGGCCGCCTACCAAGCC
AACCAGGTTGTCCAGCGTCGCGCAGGCCAGGCCGACGCCTCTCTGGTTGCAGCGCTCCACGCCGACTGGCCGGCA
ACAAGCCGCGCGCACTTTGGGCAGGGCGAGCACTATGCCTCGTTTCTGCGCTTCTTCCAAGACGCCATTGCGCAG
CGCGGCGCACAAGCCGTGGCGCAAGACGTGCTCTTTGCCGAGCTGCCCAACCCGCCGCGCCGAGGCATGGTGGCG
CGTCTCTACAGCGGGCTCGTGCATCCGCTGCTGCAGCTGCTCTATGGGCTCGAGTGGGAGCAGCCAGCCATTGTG
GCGGCCGCCCTGGCGCAGACGGCGGTGCATCCCAGCGACGTGGGCGACTTGATGGTTGGCGTGGATGAGTATAGT
CGGGACAAGCAGGCCGACGCAGCCTCGGTGGAGGACTTGTGCCACGAGGTGCATCGTCGTGGCGGCCCCTTGGCC
CAGGCGGCCAGCTTCAACGACATGGGCTTTGAGTATATTGAAAGAATGGGGCGCCACGGCCTTGTTGCGCTGCTG
GCGCGCATCCGCGTCGACCCCAGCCACGACCTCGACCAAGACACTGCCCGCCTCGTCCACTCGGCTGCCTACCTC
GTCGCCGCCGCTGCCTGGCACCCTCCCCACAAGCCCACCTTTGACTTTTTCCTCATGCAAGTCGCCCCCTCTTTC
CACCTCCTCACCTCGTCCCTCTTCTTCCTCTCTCTGCCTCCCCTCAGCCCCGCCGCCCGCGCCCGCCTCATTGAG
TGGCACCTCCGCCTGCAAGTCTTTGAGTACATTGCCCACGGCTGTCCCGCTCTGCGCCTCGACCATGTCCTGCGC
GACTGGTCTGCCCCAGCCGGCATGGCTGCCGCCACTCCCCGCCACCTGCTGCCGCGTCTCCTGCTCACTGCTGAC
GACGGCCATGTCGTCAAGGTGGCGCGCGCCCTCGTTGTCGCCTGCGACTTGTCTCGCAAGTGGCAAGGCTGCTCC
TGGATCCGCATCGCCGGCCATGATGCCTGGGTCAAGCTGATGCAGATACTCCTGACTAGTGTCGACGGCCGTGGC
GACGACTGGCTGCGCCAAGGAAAGCAATGGGTCCGCGGCGCTGGCTTTGAAGAGGCTTGGGAGGAGATGCCAATC
ATGGAGTAG
Transcript >OphauB2|5850
ATGGCGACACCAAAGGTCAACGTGTCGGCAAAGCAGACGGGCCTGCTAAACATGGAGCAGACACCCGAGGCAGCA
GAGACGGTGTCGCAGCTCCTCAACCAGGACCTCGAGAGGCATCACGTCTTTTACAACGATCGAGGCTTCCACGAC
CACATTGTCCACCACCTCCTCACCCTCTACGGCAGCGGCGCCAACGCGTCTGCCCTGGCGGCCGCCTACCAAGCC
AACCAGGTTGTCCAGCGTCGCGCAGGCCAGGCCGACGCCTCTCTGGTTGCAGCGCTCCACGCCGACTGGCCGGCA
ACAAGCCGCGCGCACTTTGGGCAGGGCGAGCACTATGCCTCGTTTCTGCGCTTCTTCCAAGACGCCATTGCGCAG
CGCGGCGCACAAGCCGTGGCGCAAGACGTGCTCTTTGCCGAGCTGCCCAACCCGCCGCGCCGAGGCATGGTGGCG
CGTCTCTACAGCGGGCTCGTGCATCCGCTGCTGCAGCTGCTCTATGGGCTCGAGTGGGAGCAGCCAGCCATTGTG
GCGGCCGCCCTGGCGCAGACGGCGGTGCATCCCAGCGACGTGGGCGACTTGATGGTTGGCGTGGATGAGTATAGT
CGGGACAAGCAGGCCGACGCAGCCTCGGTGGAGGACTTGTGCCACGAGGTGCATCGTCGTGGCGGCCCCTTGGCC
CAGGCGGCCAGCTTCAACGACATGGGCTTTGAGTATATTGAAAGAATGGGGCGCCACGGCCTTGTTGCGCTGCTG
GCGCGCATCCGCGTCGACCCCAGCCACGACCTCGACCAAGACACTGCCCGCCTCGTCCACTCGGCTGCCTACCTC
GTCGCCGCCGCTGCCTGGCACCCTCCCCACAAGCCCACCTTTGACTTTTTCCTCATGCAAGTCGCCCCCTCTTTC
CACCTCCTCACCTCGTCCCTCTTCTTCCTCTCTCTGCCTCCCCTCAGCCCCGCCGCCCGCGCCCGCCTCATTGAG
TGGCACCTCCGCCTGCAAGTCTTTGAGTACATTGCCCACGGCTGTCCCGCTCTGCGCCTCGACCATGTCCTGCGC
GACTGGTCTGCCCCAGCCGGCATGGCTGCCGCCACTCCCCGCCACCTGCTGCCGCGTCTCCTGCTCACTGCTGAC
GACGGCCATGTCGTCAAGGTGGCGCGCGCCCTCGTTGTCGCCTGCGACTTGTCTCGCAAGTGGCAAGGCTGCTCC
TGGATCCGCATCGCCGGCCATGATGCCTGGGTCAAGCTGATGCAGATACTCCTGACTAGTGTCGACGGCCGTGGC
GACGACTGGCTGCGCCAAGGAAAGCAATGGGTCCGCGGCGCTGGCTTTGAAGAGGCTTGGGAGGAGATGCCAATC
ATGGAGTAG
Gene >OphauB2|5850
ATGGCGACACCAAAGGTCAACGTGTCGGCAAAGCAGACGGGCCTGCTAAACATGGAGCAGACACCCGAGGCAGCA
GAGACGGTGTCGCAGCTCCTCAACCAGGACCTCGAGGTGAGTCGGACAAGGCAAGCGCTGAGCAAAGACGGACAG
CTAAAGCACAGTGGACAGAGGCATCACGTCTTTTACAACGATCGAGGCTTCCACGACCACGTAATCTACTCGGCT
CCTCTGACTCGCCCCGTGACCCAAGAGCCTGCTCTAACGCCTCTCAGATTGTCCACCACCTCCTCACCCTCTACG
GCAGCGGCGCCAACGCGTCTGCCCTGGCGGCCGCCTACCAAGCCAACCAGGTTGTCCAGCGTCGCGCAGGCCAGG
CCGACGCCTCTCTGGTTGCAGCGCTCCACGCCGACTGGCCGGCAACAAGCCGCGCGCACTTTGGGCAGGGCGAGC
ACTATGCCTCGTTTCTGCGCTTCTTCCAAGACGCCATTGCGCAGCGCGGCGCACAAGCCGTGGCGCAAGACGTGC
TCTTTGCCGAGCTGCCCAACCCGCCGCGCCGAGGCATGGTGGCGCGTCTCTACAGCGGGCTCGTGCATCCGCTGC
TGCAGCTGCTCTATGGGCTCGAGTGGGAGCAGCCAGCCATTGTGGCGGCCGCCCTGGCGCAGACGGCGGTGCATC
CCAGCGACGTGGGCGACTTGATGGTTGGCGTGGATGAGTATAGTCGGGACAAGCAGGCCGACGCAGCCTCGGTGG
AGGACTTGTGCCACGAGGTGCATCGTCGTGGCGGCCCCTTGGCCCAGGCGGCCAGCTTCAACGACATGGGCTTTG
AGTATATTGAAAGAATGGGGCGCCACGGCCTTGTTGCGCTGCTGGCGCGCATCCGCGTCGACCCCAGCCACGACC
TCGACCAAGACACTGCCCGCCTCGTCCACTCGGCTGCCTACCTCGTCGCCGCCGCTGCCTGGCACCCTCCCCACA
AGCCCACCTTTGACTTTTTCCTCATGCAAGTCGCCCCCTCTTTGTCAACTCTCTCCCCCCTCTTTTGCTCCCAGC
CTCGACTAACCCCTCTTCTCCTTCAGCCACCTCCTCACCTCGTCCCTCTTCTTCCTCTCTCTGCCTCCCCTCAGC
CCCGCCGCCCGCGCCCGCCTCATTGAGTGGCACCTCCGCCTGCAAGTCTTTGAGTACATTGCCCACGGCTGTCCC
GCTCTGCGCCTCGACCATGTCCTGCGCGACTGGTCTGCCCCAGCCGGCATGGCTGCCGCCACTCCCCGCCACCTG
CTGCCGCGTCTCCTGCTCACTGCTGACGACGGCCATGTCGTCAAGGTGGCGCGCGCCCTCGTTGTCGCCTGCGAC
TTGTCTCGCAAGTGGCAAGGCTGCTCCTGGATCCGCATCGCCGGCCATGATGCCTGGGTCAAGCTGATGCAGATA
CTCCTGACTAGTGTCGACGGCCGTGGCGACGACTGGCTGCGCCAAGGAAAGCAATGGGTCCGCGGCGCTGGCTTT
GAAGAGGCTTGGGAGGAGATGCCAATCATGGAGTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail