Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|5848
Gene name
LocationContig_49:119064..120613
Strand-
Gene length (bp)1549
Transcript length (bp)1419
Coding sequence length (bp)1419
Protein length (aa) 473

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00296 Bac_luciferase Luciferase-like monooxygenase 1.5E-53 32 404

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|E9JFX9|DMOA_HYPSL Dimethyl-sulfide monooxygenase OS=Hyphomicrobium sulfonivorans GN=dmoA PE=1 SV=1 11 467 2.0E-139
sp|P54950|YXEK_BACSU Putative monooxygenase YxeK OS=Bacillus subtilis (strain 168) GN=yxeK PE=3 SV=1 9 439 4.0E-72
sp|P54995|SOXA_RHOSG Dibenzothiophene desulfurization enzyme A OS=Rhodococcus sp. (strain IGTS8) GN=soxA PE=3 SV=1 9 439 3.0E-68
sp|O34974|MOXC_BACSU Putative monooxygenase MoxC OS=Bacillus subtilis (strain 168) GN=moxC PE=1 SV=1 31 449 4.0E-64
sp|P54989|NTAA_AMIAI Nitrilotriacetate monooxygenase component A OS=Aminobacter aminovorans GN=ntaA PE=1 SV=2 10 439 5.0E-60
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|E9JFX9|DMOA_HYPSL Dimethyl-sulfide monooxygenase OS=Hyphomicrobium sulfonivorans GN=dmoA PE=1 SV=1 11 467 2.0E-139
sp|P54950|YXEK_BACSU Putative monooxygenase YxeK OS=Bacillus subtilis (strain 168) GN=yxeK PE=3 SV=1 9 439 4.0E-72
sp|P54995|SOXA_RHOSG Dibenzothiophene desulfurization enzyme A OS=Rhodococcus sp. (strain IGTS8) GN=soxA PE=3 SV=1 9 439 3.0E-68
sp|O34974|MOXC_BACSU Putative monooxygenase MoxC OS=Bacillus subtilis (strain 168) GN=moxC PE=1 SV=1 31 449 4.0E-64
sp|P54989|NTAA_AMIAI Nitrilotriacetate monooxygenase component A OS=Aminobacter aminovorans GN=ntaA PE=1 SV=2 10 439 5.0E-60
sp|P54991|SNAA_STRPR Pristinamycin IIA synthase subunit A OS=Streptomyces pristinaespiralis GN=snaA PE=1 SV=3 8 456 9.0E-59
sp|A1VPZ7|SSUD_POLNA Alkanesulfonate monooxygenase OS=Polaromonas naphthalenivorans (strain CJ2) GN=ssuD PE=3 SV=1 87 426 3.0E-18
sp|A9C3F6|SSUD_DELAS Alkanesulfonate monooxygenase OS=Delftia acidovorans (strain DSM 14801 / SPH-1) GN=ssuD PE=3 SV=1 87 427 6.0E-16
sp|Q6FFZ7|RUTA_ACIAD Pyrimidine monooxygenase RutA OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=rutA PE=3 SV=1 94 431 6.0E-15
sp|A8GCT6|RUTA_SERP5 Pyrimidine monooxygenase RutA OS=Serratia proteamaculans (strain 568) GN=rutA PE=3 SV=1 94 431 8.0E-15
sp|A9FK50|SSUD_SORC5 Alkanesulfonate monooxygenase OS=Sorangium cellulosum (strain So ce56) GN=ssuD PE=3 SV=1 97 428 2.0E-14
sp|A1TRM3|SSUD_ACIAC Alkanesulfonate monooxygenase OS=Acidovorax citrulli (strain AAC00-1) GN=ssuD PE=3 SV=1 71 426 3.0E-14
sp|P40402|SSUD_BACSU Alkanesulfonate monooxygenase OS=Bacillus subtilis (strain 168) GN=ssuD PE=2 SV=2 93 317 7.0E-14
sp|A1JMY1|RUTA_YERE8 Pyrimidine monooxygenase RutA OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=rutA PE=3 SV=1 94 431 8.0E-14
sp|B2UAU3|SSUD_RALPJ Alkanesulfonate monooxygenase OS=Ralstonia pickettii (strain 12J) GN=ssuD PE=3 SV=1 87 426 8.0E-14
sp|C5CNW9|SSUD_VARPS Alkanesulfonate monooxygenase OS=Variovorax paradoxus (strain S110) GN=ssuD PE=3 SV=1 87 428 1.0E-13
sp|Q48H03|SSUD_PSE14 Alkanesulfonate monooxygenase OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=ssuD PE=3 SV=1 98 426 1.0E-13
sp|B2JKA8|SSUD_BURP8 Alkanesulfonate monooxygenase OS=Burkholderia phymatum (strain DSM 17167 / STM815) GN=ssuD PE=3 SV=1 98 426 1.0E-13
sp|C9Y0S7|RUTA_SICTZ Pyrimidine monooxygenase RutA OS=Siccibacter turicensis (strain DSM 18703 / LMG 23827 / z3032) GN=rutA PE=3 SV=1 94 431 3.0E-13
sp|A5EB33|RUTA_BRASB Pyrimidine monooxygenase RutA OS=Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182) GN=rutA PE=3 SV=1 94 310 3.0E-13
sp|Q65M61|SSUD_BACLD Alkanesulfonate monooxygenase OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=ssuD PE=3 SV=1 94 303 3.0E-13
sp|Q87ZG3|SSUD_PSESM Alkanesulfonate monooxygenase OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=ssuD PE=3 SV=1 98 426 4.0E-13
sp|B7KX11|SSUD_METC4 Alkanesulfonate monooxygenase OS=Methylobacterium extorquens (strain CM4 / NCIMB 13688) GN=ssuD PE=3 SV=1 98 432 4.0E-13
sp|A7ME52|RUTA_CROS8 Pyrimidine monooxygenase RutA OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=rutA PE=3 SV=1 94 431 5.0E-13
sp|D3RKL0|RUTA_KLEVT Pyrimidine monooxygenase RutA OS=Klebsiella variicola (strain At-22) GN=rutA PE=3 SV=1 94 431 9.0E-13
sp|A6T7A2|RUTA_KLEP7 Pyrimidine monooxygenase RutA OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=rutA PE=3 SV=1 94 431 9.0E-13
sp|C5B0U9|RUTA_METEA Pyrimidine monooxygenase RutA OS=Methylobacterium extorquens (strain ATCC 14718 / DSM 1338 / AM1) GN=rutA PE=3 SV=1 94 431 1.0E-12
sp|D0LI58|RUTA_HALO1 Pyrimidine monooxygenase RutA OS=Haliangium ochraceum (strain DSM 14365 / JCM 11303 / SMP-2) GN=rutA PE=3 SV=1 94 351 1.0E-12
sp|Q46ZU3|SSUD_CUPPJ Alkanesulfonate monooxygenase OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=ssuD PE=3 SV=1 87 427 1.0E-12
sp|D5CE32|RUTA_ENTCC Pyrimidine monooxygenase RutA OS=Enterobacter cloacae subsp. cloacae (strain ATCC 13047 / DSM 30054 / NBRC 13535 / NCDC 279-56) GN=rutA PE=3 SV=1 94 431 2.0E-12
sp|B9JLT9|RUTA_AGRRK Pyrimidine monooxygenase RutA OS=Agrobacterium radiobacter (strain K84 / ATCC BAA-868) GN=rutA PE=3 SV=1 94 329 2.0E-12
sp|A4W925|RUTA_ENT38 Pyrimidine monooxygenase RutA OS=Enterobacter sp. (strain 638) GN=rutA PE=3 SV=1 94 317 2.0E-12
sp|B5XXN0|RUTA_KLEP3 Pyrimidine monooxygenase RutA OS=Klebsiella pneumoniae (strain 342) GN=rutA PE=3 SV=1 94 431 2.0E-12
sp|Q1LNM2|SSUD_CUPMC Alkanesulfonate monooxygenase OS=Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34) GN=ssuD PE=3 SV=1 87 312 4.0E-12
sp|Q8XZQ6|SSUD_RALSO Alkanesulfonate monooxygenase OS=Ralstonia solanacearum (strain GMI1000) GN=ssuD PE=3 SV=1 87 426 5.0E-12
sp|P58759|RUTA_AGRFC Pyrimidine monooxygenase RutA OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=rutA PE=3 SV=1 94 431 8.0E-12
sp|D2NGI9|RUTA_ECOS5 Pyrimidine monooxygenase RutA OS=Escherichia coli O150:H5 (strain SE15) GN=rutA PE=3 SV=1 94 364 9.0E-12
sp|B7UNZ5|RUTA_ECO27 Pyrimidine monooxygenase RutA OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=rutA PE=3 SV=1 94 317 9.0E-12
sp|A7ZKB7|RUTA_ECO24 Pyrimidine monooxygenase RutA OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=rutA PE=3 SV=1 94 363 1.0E-11
sp|B1LIZ3|RUTA_ECOSM Pyrimidine monooxygenase RutA OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=rutA PE=3 SV=1 94 317 1.0E-11
sp|A1A9R7|RUTA_ECOK1 Pyrimidine monooxygenase RutA OS=Escherichia coli O1:K1 / APEC GN=rutA PE=3 SV=1 94 317 1.0E-11
sp|B7MIF9|RUTA_ECO45 Pyrimidine monooxygenase RutA OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=rutA PE=3 SV=1 94 317 1.0E-11
sp|Q0TJ55|RUTA_ECOL5 Pyrimidine monooxygenase RutA OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=rutA PE=3 SV=1 94 317 1.0E-11
sp|Q8FJ41|RUTA_ECOL6 Pyrimidine monooxygenase RutA OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=rutA PE=3 SV=1 94 364 1.0E-11
sp|B7MTF5|RUTA_ECO81 Pyrimidine monooxygenase RutA OS=Escherichia coli O81 (strain ED1a) GN=rutA PE=3 SV=1 94 317 1.0E-11
sp|A4VQH4|RUTA_PSEU5 Pyrimidine monooxygenase RutA OS=Pseudomonas stutzeri (strain A1501) GN=rutA PE=3 SV=1 94 363 1.0E-11
sp|Q1RDK5|RUTA_ECOUT Pyrimidine monooxygenase RutA OS=Escherichia coli (strain UTI89 / UPEC) GN=rutA PE=3 SV=1 94 317 1.0E-11
sp|D5CZH2|RUTA_ECOKI Pyrimidine monooxygenase RutA OS=Escherichia coli O18:K1:H7 (strain IHE3034 / ExPEC) GN=rutA PE=3 SV=1 94 317 1.0E-11
sp|C9QZ64|RUTA_ECOD1 Pyrimidine monooxygenase RutA OS=Escherichia coli (strain ATCC 33849 / DSM 4235 / NCIB 12045 / K12 / DH1) GN=rutA PE=3 SV=1 94 317 1.0E-11
sp|P75898|RUTA_ECOLI Pyrimidine monooxygenase RutA OS=Escherichia coli (strain K12) GN=rutA PE=1 SV=3 94 363 1.0E-11
sp|B1X9D3|RUTA_ECODH Pyrimidine monooxygenase RutA OS=Escherichia coli (strain K12 / DH10B) GN=rutA PE=3 SV=1 94 363 1.0E-11
sp|C4ZQE0|RUTA_ECOBW Pyrimidine monooxygenase RutA OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=rutA PE=3 SV=1 94 363 1.0E-11
sp|C5CN79|RUTA_VARPS Pyrimidine monooxygenase RutA OS=Variovorax paradoxus (strain S110) GN=rutA PE=3 SV=1 94 347 2.0E-11
sp|Q4ZRE3|SSUD_PSEU2 Alkanesulfonate monooxygenase OS=Pseudomonas syringae pv. syringae (strain B728a) GN=ssuD PE=3 SV=1 98 426 2.0E-11
sp|B6I988|RUTA_ECOSE Pyrimidine monooxygenase RutA OS=Escherichia coli (strain SE11) GN=rutA PE=3 SV=1 94 363 2.0E-11
sp|D3QPK5|RUTA_ECOCB Pyrimidine monooxygenase RutA OS=Escherichia coli O55:H7 (strain CB9615 / EPEC) GN=rutA PE=3 SV=1 94 363 2.0E-11
sp|C8TNC2|RUTA_ECO26 Pyrimidine monooxygenase RutA OS=Escherichia coli O26:H11 (strain 11368 / EHEC) GN=rutA PE=3 SV=1 94 317 2.0E-11
sp|C8UMM8|RUTA_ECO1A Pyrimidine monooxygenase RutA OS=Escherichia coli O111:H- (strain 11128 / EHEC) GN=rutA PE=3 SV=1 94 317 2.0E-11
sp|C8U5H4|RUTA_ECO10 Pyrimidine monooxygenase RutA OS=Escherichia coli O103:H2 (strain 12009 / EHEC) GN=rutA PE=3 SV=1 94 317 2.0E-11
sp|C6UFC3|RUTA_ECOBR Pyrimidine monooxygenase RutA OS=Escherichia coli (strain B / REL606) GN=rutA PE=3 SV=1 94 363 2.0E-11
sp|C6EHJ5|RUTA_ECOBD Pyrimidine monooxygenase RutA OS=Escherichia coli (strain B / BL21-DE3) GN=rutA PE=3 SV=2 94 363 2.0E-11
sp|C6UPN4|RUTA_ECO5T Pyrimidine monooxygenase RutA OS=Escherichia coli O157:H7 (strain TW14359 / EHEC) GN=rutA PE=3 SV=1 94 363 2.0E-11
sp|Q8XAU1|RUTA_ECO57 Pyrimidine monooxygenase RutA OS=Escherichia coli O157:H7 GN=rutA PE=3 SV=3 94 363 2.0E-11
sp|B7KWT7|RUTA_METC4 Pyrimidine monooxygenase RutA OS=Methylobacterium extorquens (strain CM4 / NCIMB 13688) GN=rutA PE=3 SV=1 94 431 2.0E-11
sp|A7ZYW7|RUTA_ECOHS Pyrimidine monooxygenase RutA OS=Escherichia coli O9:H4 (strain HS) GN=rutA PE=3 SV=1 94 363 2.0E-11
sp|C7CM36|RUTA_METED Pyrimidine monooxygenase RutA OS=Methylobacterium extorquens (strain DSM 5838 / DM4) GN=rutA PE=3 SV=1 94 431 2.0E-11
sp|B1IV85|RUTA_ECOLC Pyrimidine monooxygenase RutA OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=rutA PE=3 SV=1 94 317 2.0E-11
sp|B5YU53|RUTA_ECO5E Pyrimidine monooxygenase RutA OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=rutA PE=3 SV=1 94 317 2.0E-11
sp|B7N3G8|RUTA_ECOLU Pyrimidine monooxygenase RutA OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=rutA PE=3 SV=1 94 363 2.0E-11
sp|B7LFC2|RUTA_ECO55 Pyrimidine monooxygenase RutA OS=Escherichia coli (strain 55989 / EAEC) GN=rutA PE=3 SV=1 94 363 2.0E-11
sp|A9W3I1|RUTA_METEP Pyrimidine monooxygenase RutA OS=Methylobacterium extorquens (strain PA1) GN=rutA PE=3 SV=1 94 431 2.0E-11
sp|Q32HQ0|RUTA_SHIDS Pyrimidine monooxygenase RutA OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=rutA PE=3 SV=1 94 363 2.0E-11
sp|D4GEU4|RUTA_PANAM Pyrimidine monooxygenase RutA OS=Pantoea ananatis (strain LMG 20103) GN=rutA PE=3 SV=1 94 310 3.0E-11
sp|B0SW63|RUTA_CAUSK Pyrimidine monooxygenase RutA OS=Caulobacter sp. (strain K31) GN=rutA PE=3 SV=1 94 310 3.0E-11
sp|B1ZB15|RUTA_METPB Pyrimidine monooxygenase RutA OS=Methylobacterium populi (strain ATCC BAA-705 / NCIMB 13946 / BJ001) GN=rutA PE=3 SV=1 94 347 3.0E-11
sp|Q8UAE8|SSUD_AGRFC Alkanesulfonate monooxygenase OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=ssuD PE=3 SV=2 86 317 3.0E-11
sp|B1M6B9|RUTA_METRJ Pyrimidine monooxygenase RutA OS=Methylobacterium radiotolerans (strain ATCC 27329 / DSM 1819 / JCM 2831) GN=rutA PE=3 SV=1 94 347 4.0E-11
sp|Q9I1C2|MSUD_PSEAE Methanesulfonate monooxygenase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=msuD PE=2 SV=1 98 433 4.0E-11
sp|Q9A4N2|RUTA_CAUCR Pyrimidine monooxygenase RutA OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=rutA PE=3 SV=1 94 310 4.0E-11
sp|B8H1Q4|RUTA_CAUCN Pyrimidine monooxygenase RutA OS=Caulobacter crescentus (strain NA1000 / CB15N) GN=rutA PE=3 SV=1 94 310 4.0E-11
sp|B7NLB4|RUTA_ECO7I Pyrimidine monooxygenase RutA OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=rutA PE=3 SV=1 94 317 4.0E-11
sp|Q89ER2|SSUD_BRADU Alkanesulfonate monooxygenase OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=ssuD PE=3 SV=1 98 317 6.0E-11
sp|B7M8Z7|RUTA_ECO8A Pyrimidine monooxygenase RutA OS=Escherichia coli O8 (strain IAI1) GN=rutA PE=3 SV=1 94 363 6.0E-11
sp|D3H125|RUTA_ECO44 Pyrimidine monooxygenase RutA OS=Escherichia coli O44:H18 (strain 042 / EAEC) GN=rutA PE=3 SV=1 94 363 6.0E-11
sp|Q6N6K3|SSUD_RHOPA Alkanesulfonate monooxygenase OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=ssuD PE=3 SV=1 98 317 6.0E-11
sp|A4Y0F3|SSUD_PSEMY Alkanesulfonate monooxygenase OS=Pseudomonas mendocina (strain ymp) GN=ssuD PE=3 SV=1 98 317 7.0E-11
sp|Q0T622|RUTA_SHIF8 Pyrimidine monooxygenase RutA OS=Shigella flexneri serotype 5b (strain 8401) GN=rutA PE=3 SV=1 94 317 8.0E-11
sp|Q0K9I0|SSUD_CUPNH Alkanesulfonate monooxygenase OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=ssuD PE=3 SV=1 87 426 9.0E-11
sp|D5VGV4|RUTA_CAUST Pyrimidine monooxygenase RutA OS=Caulobacter segnis (strain ATCC 21756 / DSM 7131 / JCM 7823 / NBRC 15250 / LMG 17158 / TK0059) GN=rutA PE=3 SV=1 94 310 1.0E-10
sp|Q2SVM8|SSUD_BURTA Alkanesulfonate monooxygenase OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=ssuD PE=3 SV=2 98 303 1.0E-10
sp|Q83LK6|RUTA_SHIFL Pyrimidine monooxygenase RutA OS=Shigella flexneri GN=rutA PE=3 SV=4 94 317 1.0E-10
sp|D2AC43|RUTA_SHIF2 Pyrimidine monooxygenase RutA OS=Shigella flexneri serotype X (strain 2002017) GN=rutA PE=3 SV=1 94 317 1.0E-10
sp|B3QIN8|SSUD_RHOPT Alkanesulfonate monooxygenase OS=Rhodopseudomonas palustris (strain TIE-1) GN=ssuD PE=3 SV=1 98 430 2.0E-10
sp|B2T3J1|SSUD_BURPP Alkanesulfonate monooxygenase OS=Burkholderia phytofirmans (strain DSM 17436 / PsJN) GN=ssuD PE=3 SV=1 98 459 3.0E-10
sp|A7Z2Q3|SSUD_BACMF Alkanesulfonate monooxygenase OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=ssuD PE=3 SV=1 93 278 5.0E-10
sp|B1JEV9|SSUD_PSEPW Alkanesulfonate monooxygenase OS=Pseudomonas putida (strain W619) GN=ssuD PE=3 SV=1 98 317 5.0E-10
sp|Q4ZXR7|RUTA_PSEU2 Pyrimidine monooxygenase RutA OS=Pseudomonas syringae pv. syringae (strain B728a) GN=rutA PE=3 SV=1 94 363 7.0E-10
sp|O85764|SSUD_PSEPU Alkanesulfonate monooxygenase OS=Pseudomonas putida GN=ssuD PE=2 SV=2 98 317 7.0E-10
sp|B0KH56|SSUD_PSEPG Alkanesulfonate monooxygenase OS=Pseudomonas putida (strain GB-1) GN=ssuD PE=3 SV=1 98 317 8.0E-10
sp|Q98DT4|SSUD2_RHILO Alkanesulfonate monooxygenase 2 OS=Rhizobium loti (strain MAFF303099) GN=ssuD2 PE=3 SV=1 101 303 9.0E-10
sp|Q88R95|SSUD_PSEPK Alkanesulfonate monooxygenase OS=Pseudomonas putida (strain KT2440) GN=ssuD PE=3 SV=1 98 317 1.0E-09
sp|Q1IGL6|SSUD_PSEE4 Alkanesulfonate monooxygenase OS=Pseudomonas entomophila (strain L48) GN=ssuD PE=3 SV=1 98 317 1.0E-09
sp|A5VX17|SSUD_PSEP1 Alkanesulfonate monooxygenase OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=ssuD PE=3 SV=1 98 317 2.0E-09
sp|Q9KHS2|SSUD_PSESP Alkanesulfonate monooxygenase OS=Pseudomonas sp. GN=ssuD PE=3 SV=1 98 317 2.0E-09
sp|B3R2K7|SSUD_CUPTR Alkanesulfonate monooxygenase OS=Cupriavidus taiwanensis (strain R1 / LMG 19424) GN=ssuD PE=3 SV=1 87 426 3.0E-09
sp|Q48MQ4|RUTA_PSE14 Pyrimidine monooxygenase RutA OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=rutA PE=3 SV=1 94 321 3.0E-09
sp|A8AID7|SSUD_CITK8 Alkanesulfonate monooxygenase OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=ssuD PE=3 SV=1 98 303 3.0E-09
sp|Q9KHR3|SSUD_BUTSP Alkanesulfonate monooxygenase OS=Buttiauxella sp. (strain PNBS) GN=ssuD PE=3 SV=1 98 313 3.0E-09
sp|Q98CB9|SSUD1_RHILO Alkanesulfonate monooxygenase 1 OS=Rhizobium loti (strain MAFF303099) GN=ssuD1 PE=3 SV=1 98 284 4.0E-09
sp|P54993|SNAB_STRPR Pristinamycin IIA synthase subunit B OS=Streptomyces pristinaespiralis GN=snaB PE=1 SV=3 120 238 6.0E-09
sp|C1DN48|SSUD_AZOVD Alkanesulfonate monooxygenase OS=Azotobacter vinelandii (strain DJ / ATCC BAA-1303) GN=ssuD PE=3 SV=1 98 428 7.0E-09
sp|D2TDP0|SSUD_ERWP6 Alkanesulfonate monooxygenase OS=Erwinia pyrifoliae (strain DSM 12163 / CIP 106111 / Ep16/96) GN=ssuD PE=3 SV=2 98 303 8.0E-09
sp|B3Q1C3|SSUD_RHIE6 Alkanesulfonate monooxygenase OS=Rhizobium etli (strain CIAT 652) GN=ssuD PE=3 SV=1 86 317 1.0E-08
sp|B9K4P2|RUTA_AGRVS Pyrimidine monooxygenase RutA OS=Agrobacterium vitis (strain S4 / ATCC BAA-846) GN=rutA PE=3 SV=1 94 310 2.0E-08
sp|P80645|SSUD_ECOLI Alkanesulfonate monooxygenase OS=Escherichia coli (strain K12) GN=ssuD PE=1 SV=3 98 428 2.0E-08
sp|B1IVZ6|SSUD_ECOLC Alkanesulfonate monooxygenase OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=ssuD PE=3 SV=1 98 428 2.0E-08
sp|A7ZYN8|SSUD_ECOHS Alkanesulfonate monooxygenase OS=Escherichia coli O9:H4 (strain HS) GN=ssuD PE=3 SV=1 98 428 2.0E-08
sp|B1X8N9|SSUD_ECODH Alkanesulfonate monooxygenase OS=Escherichia coli (strain K12 / DH10B) GN=ssuD PE=3 SV=1 98 428 2.0E-08
sp|C4ZQ61|SSUD_ECOBW Alkanesulfonate monooxygenase OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=ssuD PE=3 SV=1 98 428 2.0E-08
sp|B1JKC0|SSUD_YERPY Alkanesulfonate monooxygenase OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=ssuD PE=3 SV=1 98 303 3.0E-08
sp|Q665B4|SSUD_YERPS Alkanesulfonate monooxygenase OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=ssuD PE=3 SV=1 98 303 3.0E-08
sp|B2K4U5|SSUD_YERPB Alkanesulfonate monooxygenase OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=ssuD PE=3 SV=1 98 303 3.0E-08
sp|A7FDL9|SSUD_YERP3 Alkanesulfonate monooxygenase OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=ssuD PE=3 SV=1 98 303 4.0E-08
sp|B2VC88|SSUD_ERWT9 Alkanesulfonate monooxygenase OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=ssuD PE=3 SV=1 98 303 4.0E-08
sp|A4TH89|SSUD_YERPP Alkanesulfonate monooxygenase OS=Yersinia pestis (strain Pestoides F) GN=ssuD PE=3 SV=1 98 303 5.0E-08
sp|Q1CDQ8|SSUD_YERPN Alkanesulfonate monooxygenase OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=ssuD PE=3 SV=1 98 303 5.0E-08
sp|Q8ZB04|SSUD_YERPE Alkanesulfonate monooxygenase OS=Yersinia pestis GN=ssuD PE=3 SV=1 98 303 5.0E-08
sp|Q1C1S2|SSUD_YERPA Alkanesulfonate monooxygenase OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=ssuD PE=3 SV=1 98 303 5.0E-08
sp|C6DGK1|SSUD_PECCP Alkanesulfonate monooxygenase OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=ssuD PE=3 SV=1 98 303 6.0E-08
sp|A7MEW3|SSUD_CROS8 Alkanesulfonate monooxygenase OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=ssuD PE=3 SV=1 98 303 8.0E-08
sp|Q6CYU4|SSUD_PECAS Alkanesulfonate monooxygenase OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=ssuD PE=3 SV=1 98 316 9.0E-08
sp|A4W8V4|SSUD_ENT38 Alkanesulfonate monooxygenase OS=Enterobacter sp. (strain 638) GN=ssuD PE=3 SV=1 98 317 1.0E-07
sp|B7LNV2|SSUD_ESCF3 Alkanesulfonate monooxygenase OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=ssuD PE=3 SV=1 98 313 1.0E-07
sp|B7MS53|SSUD_ECO81 Alkanesulfonate monooxygenase OS=Escherichia coli O81 (strain ED1a) GN=ssuD PE=3 SV=1 98 313 1.0E-07
sp|B5YT69|SSUD_ECO5E Alkanesulfonate monooxygenase OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=ssuD PE=3 SV=1 98 313 2.0E-07
sp|Q8XDD9|SSUD_ECO57 Alkanesulfonate monooxygenase OS=Escherichia coli O157:H7 GN=ssuD PE=3 SV=3 98 313 2.0E-07
sp|Q8FJ93|SSUD_ECOL6 Alkanesulfonate monooxygenase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=ssuD PE=3 SV=3 98 303 2.0E-07
sp|Q1RDS2|SSUD_ECOUT Alkanesulfonate monooxygenase OS=Escherichia coli (strain UTI89 / UPEC) GN=ssuD PE=3 SV=1 98 303 2.0E-07
sp|A1A9L2|SSUD_ECOK1 Alkanesulfonate monooxygenase OS=Escherichia coli O1:K1 / APEC GN=ssuD PE=3 SV=1 98 303 2.0E-07
sp|B7MHP4|SSUD_ECO45 Alkanesulfonate monooxygenase OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=ssuD PE=3 SV=1 98 303 2.0E-07
sp|B1LJS7|SSUD_ECOSM Alkanesulfonate monooxygenase OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=ssuD PE=3 SV=1 98 313 3.0E-07
sp|B7NM39|SSUD_ECO7I Alkanesulfonate monooxygenase OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=ssuD PE=3 SV=1 101 313 3.0E-07
sp|Q9HYG2|SSUD_PSEAE Alkanesulfonate monooxygenase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=ssuD PE=1 SV=3 98 428 3.0E-07
sp|P59189|SSUD_SHIFL Alkanesulfonate monooxygenase OS=Shigella flexneri GN=ssuD PE=3 SV=2 98 313 5.0E-07
sp|Q0T6A4|SSUD_SHIF8 Alkanesulfonate monooxygenase OS=Shigella flexneri serotype 5b (strain 8401) GN=ssuD PE=3 SV=1 98 313 6.0E-07
sp|B6I909|SSUD_ECOSE Alkanesulfonate monooxygenase OS=Escherichia coli (strain SE11) GN=ssuD PE=3 SV=1 98 313 7.0E-07
sp|B7LE35|SSUD_ECO55 Alkanesulfonate monooxygenase OS=Escherichia coli (strain 55989 / EAEC) GN=ssuD PE=3 SV=1 98 313 7.0E-07
sp|A7ZK27|SSUD_ECO24 Alkanesulfonate monooxygenase OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=ssuD PE=3 SV=1 98 313 7.0E-07
sp|Q0TJB9|SSUD_ECOL5 Alkanesulfonate monooxygenase OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=ssuD PE=3 SV=1 98 313 7.0E-07
sp|B7M864|SSUD_ECO8A Alkanesulfonate monooxygenase OS=Escherichia coli O8 (strain IAI1) GN=ssuD PE=3 SV=1 98 313 8.0E-07
sp|B7UN21|SSUD_ECO27 Alkanesulfonate monooxygenase OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=ssuD PE=3 SV=1 98 313 9.0E-07
sp|B7N3A4|SSUD_ECOLU Alkanesulfonate monooxygenase OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=ssuD PE=3 SV=1 98 313 2.0E-06
sp|Q3JSR8|SSUD_BURP1 Alkanesulfonate monooxygenase OS=Burkholderia pseudomallei (strain 1710b) GN=ssuD PE=3 SV=2 98 432 5.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016705 oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen Yes
GO:0003824 catalytic activity No
GO:0003674 molecular_function No
GO:0016491 oxidoreductase activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 25 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|5848
MASVTDQPRNKKLLIHAFVESCSGHQSPGLWTHPRDRSTDFNKLSHWVELAKLLERGKFHGMFIADVLGPYDVYK
GPNNASPSIISGAQIPVNEPLAVVPAMAAATKNLCFGVTIATTYEEPYHLARRLSTVDHLTGGRVGWNVVTGYLE
SAAKNLGHSELRQHDERYLYAEEYINVAYKLWQSSWRDDAVKLDRANRVYTDPALVRTIDHQGKYYKVTGPHMCQ
PSPQRTPLILQAGTSSAGKQFAAKHAEVVFVAGHSPSDVAGNIADIRQLAKRQFGRRGSSIKILALLCPIIGSTQ
QEAEAKYKEYLSYGSEDGAFALFGGWTGIDLSKYGDDEELTNVESNAIRSAVKSWSRASPEIAKWTKHTVADYIK
VGGLGATAVGTAERVADEMERWVAEADVDGFNLSYALMPETFEQVIDHLLPVLRSRGLFWDDYEIENGTYREQVC
GIKGQRYPPPDHPAAPYHWRAE*
Coding >OphauB2|5848
ATGGCCTCTGTCACAGACCAGCCGCGTAACAAGAAACTCCTTATACATGCCTTTGTCGAGTCTTGCTCTGGCCAC
CAGAGCCCGGGCCTCTGGACGCATCCCAGGGACCGTTCAACCGACTTTAACAAGCTCTCGCATTGGGTTGAGCTG
GCCAAGCTGCTGGAAAGGGGCAAGTTTCATGGCATGTTCATCGCCGATGTGCTTGGCCCGTATGATGTGTACAAA
GGCCCCAATAATGCCTCTCCTTCCATCATCTCAGGGGCTCAGATTCCAGTCAACGAGCCTCTGGCCGTAGTTCCG
GCCATGGCTGCCGCGACCAAGAACCTCTGCTTTGGTGTCACGATAGCAACAACGTATGAGGAGCCCTACCATCTT
GCTCGCCGTCTGAGCACCGTGGACCACTTGACAGGAGGCCGCGTCGGCTGGAACGTGGTGACGGGCTATCTCGAG
TCGGCGGCCAAGAATCTGGGACACTCAGAGCTGCGCCAGCACGACGAGCGATATTTATATGCCGAAGAATACATC
AATGTCGCCTACAAGCTTTGGCAATCTTCATGGCGAGACGACGCCGTCAAGCTTGACCGCGCCAACAGAGTCTAT
ACAGACCCGGCTCTGGTGCGCACCATTGACCACCAGGGCAAGTACTACAAGGTGACAGGGCCGCACATGTGCCAG
CCATCGCCCCAGCGTACTCCCCTCATCCTACAGGCCGGCACGTCGAGCGCTGGGAAGCAGTTTGCAGCCAAGCAC
GCCGAAGTAGTCTTTGTAGCAGGCCATAGCCCATCGGATGTGGCAGGCAACATTGCCGACATTCGGCAGCTGGCC
AAGAGGCAGTTTGGCCGCCGTGGCAGCTCCATCAAGATACTCGCCTTGCTGTGTCCCATTATCGGCAGCACGCAG
CAAGAGGCCGAGGCCAAGTACAAGGAATATCTCAGCTACGGGTCCGAAGACGGAGCGTTTGCCCTCTTTGGCGGC
TGGACGGGCATCGACTTGAGCAAGTATGGCGACGACGAGGAGCTGACCAATGTCGAGTCCAATGCCATTCGGTCC
GCCGTCAAGTCGTGGTCGAGGGCGTCTCCAGAGATAGCAAAGTGGACAAAGCACACTGTCGCCGACTACATCAAG
GTTGGAGGGCTGGGAGCGACGGCCGTCGGCACGGCGGAAAGGGTTGCCGACGAGATGGAGAGATGGGTGGCAGAG
GCAGACGTGGACGGCTTCAACCTATCGTATGCCCTCATGCCCGAGACGTTTGAGCAAGTCATTGACCACCTGCTG
CCGGTGCTGCGTAGCAGGGGCCTCTTTTGGGATGACTATGAGATTGAAAACGGCACATATCGGGAGCAAGTCTGT
GGTATTAAAGGACAGCGGTATCCACCGCCTGATCATCCTGCGGCGCCGTATCACTGGAGGGCAGAATAA
Transcript >OphauB2|5848
ATGGCCTCTGTCACAGACCAGCCGCGTAACAAGAAACTCCTTATACATGCCTTTGTCGAGTCTTGCTCTGGCCAC
CAGAGCCCGGGCCTCTGGACGCATCCCAGGGACCGTTCAACCGACTTTAACAAGCTCTCGCATTGGGTTGAGCTG
GCCAAGCTGCTGGAAAGGGGCAAGTTTCATGGCATGTTCATCGCCGATGTGCTTGGCCCGTATGATGTGTACAAA
GGCCCCAATAATGCCTCTCCTTCCATCATCTCAGGGGCTCAGATTCCAGTCAACGAGCCTCTGGCCGTAGTTCCG
GCCATGGCTGCCGCGACCAAGAACCTCTGCTTTGGTGTCACGATAGCAACAACGTATGAGGAGCCCTACCATCTT
GCTCGCCGTCTGAGCACCGTGGACCACTTGACAGGAGGCCGCGTCGGCTGGAACGTGGTGACGGGCTATCTCGAG
TCGGCGGCCAAGAATCTGGGACACTCAGAGCTGCGCCAGCACGACGAGCGATATTTATATGCCGAAGAATACATC
AATGTCGCCTACAAGCTTTGGCAATCTTCATGGCGAGACGACGCCGTCAAGCTTGACCGCGCCAACAGAGTCTAT
ACAGACCCGGCTCTGGTGCGCACCATTGACCACCAGGGCAAGTACTACAAGGTGACAGGGCCGCACATGTGCCAG
CCATCGCCCCAGCGTACTCCCCTCATCCTACAGGCCGGCACGTCGAGCGCTGGGAAGCAGTTTGCAGCCAAGCAC
GCCGAAGTAGTCTTTGTAGCAGGCCATAGCCCATCGGATGTGGCAGGCAACATTGCCGACATTCGGCAGCTGGCC
AAGAGGCAGTTTGGCCGCCGTGGCAGCTCCATCAAGATACTCGCCTTGCTGTGTCCCATTATCGGCAGCACGCAG
CAAGAGGCCGAGGCCAAGTACAAGGAATATCTCAGCTACGGGTCCGAAGACGGAGCGTTTGCCCTCTTTGGCGGC
TGGACGGGCATCGACTTGAGCAAGTATGGCGACGACGAGGAGCTGACCAATGTCGAGTCCAATGCCATTCGGTCC
GCCGTCAAGTCGTGGTCGAGGGCGTCTCCAGAGATAGCAAAGTGGACAAAGCACACTGTCGCCGACTACATCAAG
GTTGGAGGGCTGGGAGCGACGGCCGTCGGCACGGCGGAAAGGGTTGCCGACGAGATGGAGAGATGGGTGGCAGAG
GCAGACGTGGACGGCTTCAACCTATCGTATGCCCTCATGCCCGAGACGTTTGAGCAAGTCATTGACCACCTGCTG
CCGGTGCTGCGTAGCAGGGGCCTCTTTTGGGATGACTATGAGATTGAAAACGGCACATATCGGGAGCAAGTCTGT
GGTATTAAAGGACAGCGGTATCCACCGCCTGATCATCCTGCGGCGCCGTATCACTGGAGGGCAGAATAA
Gene >OphauB2|5848
ATGGCCTCTGTCACAGACCAGCCGCGTAACAAGAAACTCCTTATACATGCCTTTGTCGAGTCTTGCTCTGGCCAC
CAGAGCCCGGGCCTCTGGACGCATCCCAGGGACCGTTCAACCGACTTTAACAAGCTCTCGCATTGGGTTGAGCTG
GCCAAGCTGCTGGAAAGGGGCAAGTTTCATGGCATGTTCATCGCCGATGTGCTTGTAAGTGGGCTGGCACGCTCG
CAGCGCTCGTCCCACTACGAGATGCTCACACGGTATTCCAGGGCCCGTATGATGTGTACAAAGGCCCCAATAATG
CCTCTCCTTCCATCATCTCAGGGGCTCAGATTCCAGTCAACGAGCCTCTGGCCGTAGTTCCGGCCATGGCTGCCG
CGACCAAGAACCTCTGCTTTGGTGTCACGATAGCAACAACGTATGAGGAGCCCTACCATCTTGCTCGCCGTCTGA
GCACCGTGGACCACTTGACAGGAGGCCGCGTCGGCTGGAACGTGGTGACGGGCTATCTCGAGTCGGCGGCCAAGA
ATCTGGGACACTCAGAGCTGCGCCAGCACGACGAGCGATATTTATATGCCGAAGAATACATCAATGTCGCCTACA
AGCTTTGGTTAGCATCCATGGCTGCAAATTAGATCAAGTCATGGCAGCGGGCTGACAGACGCCTTCATGCACCAG
GCAATCTTCATGGCGAGACGACGCCGTCAAGCTTGACCGCGCCAACAGAGTCTATACAGACCCGGCTCTGGTGCG
CACCATTGACCACCAGGGCAAGTACTACAAGGTGACAGGGCCGCACATGTGCCAGCCATCGCCCCAGCGTACTCC
CCTCATCCTACAGGCCGGCACGTCGAGCGCTGGGAAGCAGTTTGCAGCCAAGCACGCCGAAGTAGTCTTTGTAGC
AGGCCATAGCCCATCGGATGTGGCAGGCAACATTGCCGACATTCGGCAGCTGGCCAAGAGGCAGTTTGGCCGCCG
TGGCAGCTCCATCAAGATACTCGCCTTGCTGTGTCCCATTATCGGCAGCACGCAGCAAGAGGCCGAGGCCAAGTA
CAAGGAATATCTCAGCTACGGGTCCGAAGACGGAGCGTTTGCCCTCTTTGGCGGCTGGACGGGCATCGACTTGAG
CAAGTATGGCGACGACGAGGAGCTGACCAATGTCGAGTCCAATGCCATTCGGTCCGCCGTCAAGTCGTGGTCGAG
GGCGTCTCCAGAGATAGCAAAGTGGACAAAGCACACTGTCGCCGACTACATCAAGGTTGGAGGGCTGGGAGCGAC
GGCCGTCGGCACGGCGGAAAGGGTTGCCGACGAGATGGAGAGATGGGTGGCAGAGGCAGACGTGGACGGCTTCAA
CCTATCGTATGCCCTCATGCCCGAGACGTTTGAGCAAGTCATTGACCACCTGCTGCCGGTGCTGCGTAGCAGGGG
CCTCTTTTGGGATGACTATGAGATTGAAAACGGCACATATCGGGAGCAAGTCTGTGGTATTAAAGGACAGCGGTA
TCCACCGCCTGATCATCCTGCGGCGCCGTATCACTGGAGGGCAGAATAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail