Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|5847
Gene name
LocationContig_49:114915..116667
Strand-
Gene length (bp)1752
Transcript length (bp)1752
Coding sequence length (bp)1752
Protein length (aa) 584

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup1959
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|6944
Ophiocordyceps australis map64 (Brazil) OphauB2|1861
Ophiocordyceps australis map64 (Brazil) OphauB2|4619
Ophiocordyceps australis map64 (Brazil) OphauB2|5847 (this protein)
Ophiocordyceps kimflemingae Ophio5|2956
Ophiocordyceps subramaniannii Hirsu2|2119
Ophiocordyceps subramaniannii Hirsu2|5306

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|5847
MAALNGLAMAQDPPNPEAVAQEPPKPEAGAQQPPKPEEGVKTAVEDKADVDDPCHISGNYQCFKSSEPIPPCTAE
QLIAQRCEAILKEAKDEEHWKAYKNCTTGPDSTYKSDIMGCLKCKLDNKLHSEDENGRWIKDWNQALDAFDKEEV
PTKTPYDHVQELQQEAAPPTTERVKSQVPQKPLDFVAVPMEQYLDQLPTLQGCGIYFLGGKQFPLIGDEPDAGKP
PVEGPQQAIEPEGRLEEAKVKENETNADEANKPAPAAVPTTLLRAPIASKNQTATQTALEPQETGGVSNTFVSLV
YYRKCVNVVLFSTSVNCSYTFIRDKPALVEDIPPQKIDEKKAETLPDATECNACKSQSVNLDKIKQNEVAKPEPA
SEPLAQQVIEKVTTSKVVIIQEIQEVVNMVVGQASGTPSGQDKTQPPASGSDGSGSGSQPKPAPGPGPAPGPAPG
PEGSGSGTEPKPAPGPGPAPGPAPGPEGSGSEGSGSDGSGSGTQPKPAPGPGPSPGPAPGPEPKIDATTPGPAPA
PGPQGSQGQCPCSAGQPKAPEPESPEPKAPEPQAPEPPKPEEKSPESVVEPPEPIKAC*
Coding >OphauB2|5847
ATGGCTGCCCTCAACGGCCTCGCCATGGCACAGGACCCCCCCAATCCCGAGGCCGTGGCACAGGAACCCCCCAAG
CCCGAGGCCGGGGCACAGCAACCACCCAAGCCCGAGGAGGGTGTCAAGACAGCTGTGGAAGACAAGGCCGACGTC
GACGACCCTTGCCACATCTCTGGCAACTACCAGTGCTTCAAGAGCTCCGAGCCCATTCCTCCTTGCACAGCTGAG
CAGCTCATTGCCCAGCGCTGCGAAGCCATCCTCAAGGAAGCCAAGGACGAAGAGCACTGGAAAGCCTACAAGAAC
TGCACCACGGGCCCCGATTCGACGTACAAGTCTGACATTATGGGCTGCCTCAAGTGCAAGCTCGACAACAAGCTT
CACTCGGAGGATGAGAATGGCCGCTGGATCAAGGACTGGAACCAGGCTCTGGATGCCTTTGACAAGGAAGAGGTG
CCCACCAAGACACCCTATGACCATGTCCAGGAATTGCAACAAGAGGCCGCGCCTCCCACTACCGAGAGAGTCAAG
AGCCAGGTGCCGCAGAAGCCGCTTGACTTTGTTGCCGTGCCAATGGAGCAGTACTTGGACCAGCTTCCCACGCTC
CAGGGCTGTGGCATCTACTTCCTTGGCGGCAAGCAATTTCCTCTGATTGGCGACGAGCCCGACGCTGGCAAGCCT
CCCGTTGAGGGCCCTCAACAGGCCATTGAGCCCGAGGGCAGACTCGAGGAGGCCAAGGTCAAGGAGAACGAGACC
AATGCCGACGAGGCCAACAAGCCGGCGCCTGCTGCTGTGCCGACGACGCTTCTCCGTGCTCCCATTGCTTCCAAG
AACCAGACGGCCACCCAGACGGCTCTGGAGCCCCAGGAGACGGGAGGCGTGTCCAACACCTTTGTCAGCCTCGTC
TACTACAGGAAGTGTGTCAATGTCGTCTTGTTCTCGACGTCGGTCAACTGCTCCTACACCTTTATCCGCGACAAG
CCTGCGCTCGTCGAGGATATTCCGCCGCAAAAGATTGACGAGAAAAAGGCTGAGACGCTGCCTGATGCTACCGAA
TGCAATGCCTGCAAGTCTCAGTCGGTCAACCTGGACAAGATTAAGCAGAACGAGGTTGCCAAGCCGGAGCCTGCC
TCGGAGCCCCTTGCCCAGCAGGTGATTGAAAAGGTGACGACGAGCAAGGTTGTCATTATCCAGGAGATTCAAGAG
GTGGTCAACATGGTGGTTGGCCAGGCCAGCGGAACTCCCTCGGGACAGGACAAGACGCAGCCTCCTGCTTCTGGC
TCCGACGGTTCTGGCTCCGGATCCCAGCCCAAGCCTGCTCCTGGTCCCGGCCCTGCTCCTGGTCCGGCTCCTGGC
CCCGAGGGCTCTGGCTCCGGAACCGAGCCCAAGCCTGCTCCTGGTCCCGGCCCTGCTCCTGGTCCGGCTCCTGGC
CCCGAAGGCTCTGGCTCTGAGGGCTCTGGCTCCGACGGCTCTGGCTCCGGAACCCAGCCCAAGCCTGCTCCTGGT
CCCGGCCCTTCTCCTGGCCCTGCTCCTGGTCCCGAGCCCAAGATTGACGCCACTACTCCTGGCCCTGCTCCTGCT
CCTGGGCCCCAGGGCAGCCAGGGCCAGTGTCCCTGCTCTGCCGGTCAGCCCAAGGCCCCTGAGCCCGAGTCCCCT
GAGCCCAAGGCCCCTGAGCCCCAGGCCCCTGAGCCCCCCAAGCCCGAGGAAAAGAGTCCCGAGTCTGTTGTCGAG
CCCCCCGAGCCCATCAAGGCCTGCTAG
Transcript >OphauB2|5847
ATGGCTGCCCTCAACGGCCTCGCCATGGCACAGGACCCCCCCAATCCCGAGGCCGTGGCACAGGAACCCCCCAAG
CCCGAGGCCGGGGCACAGCAACCACCCAAGCCCGAGGAGGGTGTCAAGACAGCTGTGGAAGACAAGGCCGACGTC
GACGACCCTTGCCACATCTCTGGCAACTACCAGTGCTTCAAGAGCTCCGAGCCCATTCCTCCTTGCACAGCTGAG
CAGCTCATTGCCCAGCGCTGCGAAGCCATCCTCAAGGAAGCCAAGGACGAAGAGCACTGGAAAGCCTACAAGAAC
TGCACCACGGGCCCCGATTCGACGTACAAGTCTGACATTATGGGCTGCCTCAAGTGCAAGCTCGACAACAAGCTT
CACTCGGAGGATGAGAATGGCCGCTGGATCAAGGACTGGAACCAGGCTCTGGATGCCTTTGACAAGGAAGAGGTG
CCCACCAAGACACCCTATGACCATGTCCAGGAATTGCAACAAGAGGCCGCGCCTCCCACTACCGAGAGAGTCAAG
AGCCAGGTGCCGCAGAAGCCGCTTGACTTTGTTGCCGTGCCAATGGAGCAGTACTTGGACCAGCTTCCCACGCTC
CAGGGCTGTGGCATCTACTTCCTTGGCGGCAAGCAATTTCCTCTGATTGGCGACGAGCCCGACGCTGGCAAGCCT
CCCGTTGAGGGCCCTCAACAGGCCATTGAGCCCGAGGGCAGACTCGAGGAGGCCAAGGTCAAGGAGAACGAGACC
AATGCCGACGAGGCCAACAAGCCGGCGCCTGCTGCTGTGCCGACGACGCTTCTCCGTGCTCCCATTGCTTCCAAG
AACCAGACGGCCACCCAGACGGCTCTGGAGCCCCAGGAGACGGGAGGCGTGTCCAACACCTTTGTCAGCCTCGTC
TACTACAGGAAGTGTGTCAATGTCGTCTTGTTCTCGACGTCGGTCAACTGCTCCTACACCTTTATCCGCGACAAG
CCTGCGCTCGTCGAGGATATTCCGCCGCAAAAGATTGACGAGAAAAAGGCTGAGACGCTGCCTGATGCTACCGAA
TGCAATGCCTGCAAGTCTCAGTCGGTCAACCTGGACAAGATTAAGCAGAACGAGGTTGCCAAGCCGGAGCCTGCC
TCGGAGCCCCTTGCCCAGCAGGTGATTGAAAAGGTGACGACGAGCAAGGTTGTCATTATCCAGGAGATTCAAGAG
GTGGTCAACATGGTGGTTGGCCAGGCCAGCGGAACTCCCTCGGGACAGGACAAGACGCAGCCTCCTGCTTCTGGC
TCCGACGGTTCTGGCTCCGGATCCCAGCCCAAGCCTGCTCCTGGTCCCGGCCCTGCTCCTGGTCCGGCTCCTGGC
CCCGAGGGCTCTGGCTCCGGAACCGAGCCCAAGCCTGCTCCTGGTCCCGGCCCTGCTCCTGGTCCGGCTCCTGGC
CCCGAAGGCTCTGGCTCTGAGGGCTCTGGCTCCGACGGCTCTGGCTCCGGAACCCAGCCCAAGCCTGCTCCTGGT
CCCGGCCCTTCTCCTGGCCCTGCTCCTGGTCCCGAGCCCAAGATTGACGCCACTACTCCTGGCCCTGCTCCTGCT
CCTGGGCCCCAGGGCAGCCAGGGCCAGTGTCCCTGCTCTGCCGGTCAGCCCAAGGCCCCTGAGCCCGAGTCCCCT
GAGCCCAAGGCCCCTGAGCCCCAGGCCCCTGAGCCCCCCAAGCCCGAGGAAAAGAGTCCCGAGTCTGTTGTCGAG
CCCCCCGAGCCCATCAAGGCCTGCTAG
Gene >OphauB2|5847
ATGGCTGCCCTCAACGGCCTCGCCATGGCACAGGACCCCCCCAATCCCGAGGCCGTGGCACAGGAACCCCCCAAG
CCCGAGGCCGGGGCACAGCAACCACCCAAGCCCGAGGAGGGTGTCAAGACAGCTGTGGAAGACAAGGCCGACGTC
GACGACCCTTGCCACATCTCTGGCAACTACCAGTGCTTCAAGAGCTCCGAGCCCATTCCTCCTTGCACAGCTGAG
CAGCTCATTGCCCAGCGCTGCGAAGCCATCCTCAAGGAAGCCAAGGACGAAGAGCACTGGAAAGCCTACAAGAAC
TGCACCACGGGCCCCGATTCGACGTACAAGTCTGACATTATGGGCTGCCTCAAGTGCAAGCTCGACAACAAGCTT
CACTCGGAGGATGAGAATGGCCGCTGGATCAAGGACTGGAACCAGGCTCTGGATGCCTTTGACAAGGAAGAGGTG
CCCACCAAGACACCCTATGACCATGTCCAGGAATTGCAACAAGAGGCCGCGCCTCCCACTACCGAGAGAGTCAAG
AGCCAGGTGCCGCAGAAGCCGCTTGACTTTGTTGCCGTGCCAATGGAGCAGTACTTGGACCAGCTTCCCACGCTC
CAGGGCTGTGGCATCTACTTCCTTGGCGGCAAGCAATTTCCTCTGATTGGCGACGAGCCCGACGCTGGCAAGCCT
CCCGTTGAGGGCCCTCAACAGGCCATTGAGCCCGAGGGCAGACTCGAGGAGGCCAAGGTCAAGGAGAACGAGACC
AATGCCGACGAGGCCAACAAGCCGGCGCCTGCTGCTGTGCCGACGACGCTTCTCCGTGCTCCCATTGCTTCCAAG
AACCAGACGGCCACCCAGACGGCTCTGGAGCCCCAGGAGACGGGAGGCGTGTCCAACACCTTTGTCAGCCTCGTC
TACTACAGGAAGTGTGTCAATGTCGTCTTGTTCTCGACGTCGGTCAACTGCTCCTACACCTTTATCCGCGACAAG
CCTGCGCTCGTCGAGGATATTCCGCCGCAAAAGATTGACGAGAAAAAGGCTGAGACGCTGCCTGATGCTACCGAA
TGCAATGCCTGCAAGTCTCAGTCGGTCAACCTGGACAAGATTAAGCAGAACGAGGTTGCCAAGCCGGAGCCTGCC
TCGGAGCCCCTTGCCCAGCAGGTGATTGAAAAGGTGACGACGAGCAAGGTTGTCATTATCCAGGAGATTCAAGAG
GTGGTCAACATGGTGGTTGGCCAGGCCAGCGGAACTCCCTCGGGACAGGACAAGACGCAGCCTCCTGCTTCTGGC
TCCGACGGTTCTGGCTCCGGATCCCAGCCCAAGCCTGCTCCTGGTCCCGGCCCTGCTCCTGGTCCGGCTCCTGGC
CCCGAGGGCTCTGGCTCCGGAACCGAGCCCAAGCCTGCTCCTGGTCCCGGCCCTGCTCCTGGTCCGGCTCCTGGC
CCCGAAGGCTCTGGCTCTGAGGGCTCTGGCTCCGACGGCTCTGGCTCCGGAACCCAGCCCAAGCCTGCTCCTGGT
CCCGGCCCTTCTCCTGGCCCTGCTCCTGGTCCCGAGCCCAAGATTGACGCCACTACTCCTGGCCCTGCTCCTGCT
CCTGGGCCCCAGGGCAGCCAGGGCCAGTGTCCCTGCTCTGCCGGTCAGCCCAAGGCCCCTGAGCCCGAGTCCCCT
GAGCCCAAGGCCCCTGAGCCCCAGGCCCCTGAGCCCCCCAAGCCCGAGGAAAAGAGTCCCGAGTCTGTTGTCGAG
CCCCCCGAGCCCATCAAGGCCTGCTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail