Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|5839
Gene name
LocationContig_49:79174..81199
Strand+
Gene length (bp)2025
Transcript length (bp)2025
Coding sequence length (bp)2025
Protein length (aa) 675

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02219 MTHFR Methylenetetrahydrofolate reductase 2.1E-100 13 311

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P46151|MTHR1_YEAST Methylenetetrahydrofolate reductase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MET12 PE=1 SV=2 14 671 0.0E+00
sp|O74927|MTHR2_SCHPO Methylenetetrahydrofolate reductase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=met11 PE=1 SV=2 3 668 0.0E+00
sp|Q10258|MTHR1_SCHPO Methylenetetrahydrofolate reductase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=met9 PE=1 SV=1 3 672 2.0E-146
sp|P53128|MTHR2_YEAST Methylenetetrahydrofolate reductase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MET13 PE=1 SV=2 3 662 7.0E-127
sp|Q75HE6|MTHR_ORYSJ Probable methylenetetrahydrofolate reductase OS=Oryza sativa subsp. japonica GN=Os03g0815200 PE=2 SV=1 3 662 4.0E-122
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P46151|MTHR1_YEAST Methylenetetrahydrofolate reductase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MET12 PE=1 SV=2 14 671 0.0E+00
sp|O74927|MTHR2_SCHPO Methylenetetrahydrofolate reductase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=met11 PE=1 SV=2 3 668 0.0E+00
sp|Q10258|MTHR1_SCHPO Methylenetetrahydrofolate reductase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=met9 PE=1 SV=1 3 672 2.0E-146
sp|P53128|MTHR2_YEAST Methylenetetrahydrofolate reductase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MET13 PE=1 SV=2 3 662 7.0E-127
sp|Q75HE6|MTHR_ORYSJ Probable methylenetetrahydrofolate reductase OS=Oryza sativa subsp. japonica GN=Os03g0815200 PE=2 SV=1 3 662 4.0E-122
sp|Q9SE94|MTHR1_MAIZE Methylenetetrahydrofolate reductase 1 OS=Zea mays PE=2 SV=1 1 662 8.0E-121
sp|O80585|MTHR2_ARATH Methylenetetrahydrofolate reductase 2 OS=Arabidopsis thaliana GN=MTHFR2 PE=1 SV=2 3 662 9.0E-117
sp|Q9SE60|MTHR1_ARATH Methylenetetrahydrofolate reductase 1 OS=Arabidopsis thaliana GN=MTHFR1 PE=1 SV=1 3 662 2.0E-114
sp|Q5I598|MTHR_BOVIN Methylenetetrahydrofolate reductase OS=Bos taurus GN=MTHFR PE=2 SV=1 2 670 1.0E-113
sp|P42898|MTHR_HUMAN Methylenetetrahydrofolate reductase OS=Homo sapiens GN=MTHFR PE=1 SV=3 11 670 5.0E-108
sp|Q60HE5|MTHR_MACFA Methylenetetrahydrofolate reductase OS=Macaca fascicularis GN=MTHFR PE=2 SV=1 2 670 8.0E-107
sp|Q9WU20|MTHR_MOUSE Methylenetetrahydrofolate reductase OS=Mus musculus GN=Mthfr PE=1 SV=2 13 670 5.0E-99
sp|O67422|METF_AQUAE 5,10-methylenetetrahydrofolate reductase OS=Aquifex aeolicus (strain VF5) GN=metF PE=3 SV=1 19 308 2.0E-53
sp|Q17693|MTHR_CAEEL Probable methylenetetrahydrofolate reductase OS=Caenorhabditis elegans GN=mthf-1 PE=3 SV=2 16 312 5.0E-52
sp|O54235|METF_STRLI 5,10-methylenetetrahydrofolate reductase OS=Streptomyces lividans GN=metF PE=3 SV=1 11 312 2.0E-47
sp|Q17693|MTHR_CAEEL Probable methylenetetrahydrofolate reductase OS=Caenorhabditis elegans GN=mthf-1 PE=3 SV=2 408 670 5.0E-43
sp|P71319|METF_PECCC 5,10-methylenetetrahydrofolate reductase OS=Pectobacterium carotovorum subsp. carotovorum GN=metF PE=3 SV=1 19 315 8.0E-39
sp|P11003|METF_SALTY 5,10-methylenetetrahydrofolate reductase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=metF PE=3 SV=2 14 314 2.0E-34
sp|P57154|METF_BUCAI 5,10-methylenetetrahydrofolate reductase OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=metF PE=3 SV=1 19 312 8.0E-34
sp|P0AEZ2|METF_SHIFL 5,10-methylenetetrahydrofolate reductase OS=Shigella flexneri GN=metF PE=3 SV=1 14 314 6.0E-33
sp|P0AEZ1|METF_ECOLI 5,10-methylenetetrahydrofolate reductase OS=Escherichia coli (strain K12) GN=metF PE=1 SV=1 14 314 6.0E-33
sp|P45208|METF_HAEIN 5,10-methylenetetrahydrofolate reductase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=metF PE=3 SV=1 19 314 8.0E-31
sp|Q9JZQ3|METF_NEIMB 5,10-methylenetetrahydrofolate reductase OS=Neisseria meningitidis serogroup B (strain MC58) GN=metF PE=1 SV=1 19 314 1.0E-30
sp|Q8KA62|METF_BUCAP 5,10-methylenetetrahydrofolate reductase OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=metF PE=3 SV=1 1 312 1.0E-30
sp|Q89B13|METF_BUCBP 5,10-methylenetetrahydrofolate reductase OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=metF PE=3 SV=1 19 309 1.0E-24
sp|O06745|YITJ_BACSU Bifunctional homocysteine S-methyltransferase/5,10-methylenetetrahydrofolate reductase OS=Bacillus subtilis (strain 168) GN=yitJ PE=2 SV=1 70 277 2.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0006555 methionine metabolic process Yes
GO:0004489 methylenetetrahydrofolate reductase (NAD(P)H) activity Yes
GO:0006790 sulfur compound metabolic process No
GO:1901564 organonitrogen compound metabolic process No
GO:0019752 carboxylic acid metabolic process No
GO:0006082 organic acid metabolic process No
GO:0008150 biological_process No
GO:0000096 sulfur amino acid metabolic process No
GO:0003674 molecular_function No
GO:1901605 alpha-amino acid metabolic process No
GO:0006520 cellular amino acid metabolic process No
GO:0043436 oxoacid metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0003824 catalytic activity No
GO:0009066 aspartate family amino acid metabolic process No
GO:0071704 organic substance metabolic process No
GO:0044281 small molecule metabolic process No
GO:0044237 cellular metabolic process No
GO:0008152 metabolic process No
GO:0016645 oxidoreductase activity, acting on the CH-NH group of donors No
GO:0009987 cellular process No
GO:0044238 primary metabolic process No
GO:0016646 oxidoreductase activity, acting on the CH-NH group of donors, NAD or NADP as acceptor No
GO:0016491 oxidoreductase activity No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup503
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1626
Ophiocordyceps australis 1348a (Ghana) OphauG2|6038
Ophiocordyceps australis map64 (Brazil) OphauB2|5839 (this protein)
Ophiocordyceps camponoti-floridani Ophcf2|04845
Ophiocordyceps camponoti-rufipedis Ophun1|5393
Ophiocordyceps kimflemingae Ophio5|8357
Ophiocordyceps subramaniannii Hirsu2|1555
Ophiocordyceps subramaniannii Hirsu2|5579

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|5839
MEKITDKVAALPAGSEYFSLEFFPPKTAMGFANLRHRLQRMEQALRPLFVTVTWGAGGSTATKSLELAELCQREL
GLTTCLHLTCTNMSRRCLDKALDDAKAVGIRNLLALRGDPPRQDEYHDASDSEDDVDFAWAADLVRYIRKNHGDY
FCIGVAAYPEGHGEGSCPADQSLHKDLSYLVDKVRAGADFILTQLFFDVDAYDSFEKLLRDHSSGVFKTLPMIPG
LMPIQSYQMIKRTARLSHARIPDAMLERLEAVKSDDEQVKMVGVDIISEMVERLRAVKNRTSNRNGYHFFTLNLE
KAVSFIVERTGLIPDSFEQEEAVIDESSRLALPVVQINGNNSSRGRSHSRSSRRLSSVGSDPHNRVIVGNRPLTH
PEWEATGLEAGVPADSINTRANTLAISEGEGVLGREATWDDFPNGRFGDARSPAYGEIDGYGVSLRMSPRETLRF
FGVPRTRSDIDALFVKYVRGELHQLPWSEEKLMPESSKIRNQLEELNSRSLWTMASQPAVNGAPSSDATFGWGPH
HGFVFQKAFVEFFMSSTAWHQLLARLRSPEVLASVSFYATNSKGDFVSSDSSGGINSISLQASTNAVTWGVYPGK
EIVTPTIIEEVSFRAWSEEAFAIWGEWAKVYGRGSESEKLLKSLQDDCWLVNIIHHDFVDGDALWKLLSEQRLD*
Coding >OphauB2|5839
ATGGAAAAGATCACAGACAAGGTGGCGGCGCTGCCGGCGGGAAGCGAGTACTTCTCGCTCGAGTTCTTCCCGCCA
AAGACGGCCATGGGTTTTGCCAACCTCCGCCACCGGCTGCAGCGCATGGAACAGGCTCTGCGGCCTCTGTTCGTC
ACCGTCACCTGGGGCGCAGGCGGATCCACGGCCACCAAGTCGCTCGAGCTTGCCGAGCTGTGCCAGCGCGAGCTT
GGCCTCACAACGTGTCTTCACCTGACGTGCACCAACATGAGCCGCCGCTGCCTCGACAAGGCGCTAGATGACGCC
AAGGCGGTTGGCATCCGCAATCTCCTTGCTCTGAGAGGCGATCCTCCGCGCCAAGACGAATACCACGATGCCAGT
GACTCGGAAGACGACGTCGACTTTGCCTGGGCTGCTGACCTGGTGCGCTACATTCGCAAGAACCACGGCGACTAC
TTCTGTATCGGCGTCGCCGCCTATCCCGAGGGCCATGGCGAGGGCAGCTGTCCAGCCGACCAGAGCCTGCACAAG
GACTTGTCCTACCTGGTGGACAAGGTGCGGGCGGGCGCCGACTTTATCCTCACGCAGCTCTTCTTTGACGTTGAT
GCCTATGACTCGTTTGAAAAGCTGCTCCGAGACCACTCCAGCGGCGTCTTCAAGACACTGCCCATGATTCCAGGC
CTGATGCCTATCCAAAGCTACCAGATGATCAAGCGCACGGCAAGACTCAGCCATGCAAGGATACCCGACGCCATG
CTGGAGCGCCTCGAGGCCGTCAAGTCGGACGACGAGCAGGTCAAGATGGTGGGCGTTGACATCATCAGCGAAATG
GTGGAGAGGCTCCGAGCAGTCAAGAACCGGACGTCAAATCGCAACGGATACCACTTCTTCACATTAAACCTGGAA
AAGGCCGTCTCCTTCATCGTGGAAAGGACAGGCCTGATTCCCGACTCGTTTGAACAAGAAGAGGCTGTCATTGAC
GAGAGCTCCCGGCTGGCCCTGCCGGTAGTCCAGATCAACGGCAACAACTCGAGTCGCGGGCGCAGCCACTCAAGA
TCGTCGAGACGCTTGTCCTCAGTCGGCTCGGATCCGCACAACAGAGTCATTGTGGGAAACAGACCGCTGACGCAC
CCCGAGTGGGAGGCGACGGGACTCGAGGCCGGTGTCCCCGCAGATAGCATCAACACGCGGGCAAACACGCTGGCA
ATATCAGAAGGCGAAGGCGTGCTCGGGCGCGAAGCCACATGGGACGATTTCCCCAACGGCCGCTTTGGCGACGCT
CGGTCTCCGGCCTATGGCGAGATTGACGGCTACGGTGTCAGTTTGCGCATGTCTCCCAGAGAGACTCTGCGCTTC
TTTGGTGTTCCTCGAACGCGAAGTGACATTGACGCCTTGTTCGTCAAGTATGTGCGAGGAGAGCTGCATCAACTG
CCCTGGAGCGAGGAGAAGCTCATGCCCGAATCCTCAAAGATTCGCAACCAACTCGAGGAGCTCAACAGCAGAAGC
CTGTGGACCATGGCATCGCAGCCAGCCGTTAATGGCGCGCCGTCGAGCGATGCCACCTTTGGCTGGGGTCCGCAT
CACGGCTTCGTCTTCCAAAAGGCCTTTGTCGAGTTTTTCATGTCGTCGACGGCCTGGCACCAACTGCTCGCGCGA
CTGCGGTCTCCAGAGGTGCTAGCCTCGGTCAGCTTCTACGCGACCAATAGCAAGGGTGATTTTGTCTCGTCCGAC
TCTAGCGGCGGCATCAACAGCATCAGCCTGCAGGCCAGCACCAATGCCGTGACGTGGGGCGTCTATCCAGGCAAA
GAGATTGTCACACCCACCATTATCGAAGAAGTTAGCTTTCGTGCCTGGAGCGAAGAGGCCTTTGCCATATGGGGC
GAGTGGGCCAAGGTCTATGGCCGGGGCTCGGAAAGCGAGAAGCTGCTCAAGAGTCTGCAGGACGACTGTTGGCTC
GTCAACATTATTCACCACGACTTTGTAGACGGGGATGCGCTGTGGAAGCTGCTGTCGGAGCAGCGGTTGGATTGA
Transcript >OphauB2|5839
ATGGAAAAGATCACAGACAAGGTGGCGGCGCTGCCGGCGGGAAGCGAGTACTTCTCGCTCGAGTTCTTCCCGCCA
AAGACGGCCATGGGTTTTGCCAACCTCCGCCACCGGCTGCAGCGCATGGAACAGGCTCTGCGGCCTCTGTTCGTC
ACCGTCACCTGGGGCGCAGGCGGATCCACGGCCACCAAGTCGCTCGAGCTTGCCGAGCTGTGCCAGCGCGAGCTT
GGCCTCACAACGTGTCTTCACCTGACGTGCACCAACATGAGCCGCCGCTGCCTCGACAAGGCGCTAGATGACGCC
AAGGCGGTTGGCATCCGCAATCTCCTTGCTCTGAGAGGCGATCCTCCGCGCCAAGACGAATACCACGATGCCAGT
GACTCGGAAGACGACGTCGACTTTGCCTGGGCTGCTGACCTGGTGCGCTACATTCGCAAGAACCACGGCGACTAC
TTCTGTATCGGCGTCGCCGCCTATCCCGAGGGCCATGGCGAGGGCAGCTGTCCAGCCGACCAGAGCCTGCACAAG
GACTTGTCCTACCTGGTGGACAAGGTGCGGGCGGGCGCCGACTTTATCCTCACGCAGCTCTTCTTTGACGTTGAT
GCCTATGACTCGTTTGAAAAGCTGCTCCGAGACCACTCCAGCGGCGTCTTCAAGACACTGCCCATGATTCCAGGC
CTGATGCCTATCCAAAGCTACCAGATGATCAAGCGCACGGCAAGACTCAGCCATGCAAGGATACCCGACGCCATG
CTGGAGCGCCTCGAGGCCGTCAAGTCGGACGACGAGCAGGTCAAGATGGTGGGCGTTGACATCATCAGCGAAATG
GTGGAGAGGCTCCGAGCAGTCAAGAACCGGACGTCAAATCGCAACGGATACCACTTCTTCACATTAAACCTGGAA
AAGGCCGTCTCCTTCATCGTGGAAAGGACAGGCCTGATTCCCGACTCGTTTGAACAAGAAGAGGCTGTCATTGAC
GAGAGCTCCCGGCTGGCCCTGCCGGTAGTCCAGATCAACGGCAACAACTCGAGTCGCGGGCGCAGCCACTCAAGA
TCGTCGAGACGCTTGTCCTCAGTCGGCTCGGATCCGCACAACAGAGTCATTGTGGGAAACAGACCGCTGACGCAC
CCCGAGTGGGAGGCGACGGGACTCGAGGCCGGTGTCCCCGCAGATAGCATCAACACGCGGGCAAACACGCTGGCA
ATATCAGAAGGCGAAGGCGTGCTCGGGCGCGAAGCCACATGGGACGATTTCCCCAACGGCCGCTTTGGCGACGCT
CGGTCTCCGGCCTATGGCGAGATTGACGGCTACGGTGTCAGTTTGCGCATGTCTCCCAGAGAGACTCTGCGCTTC
TTTGGTGTTCCTCGAACGCGAAGTGACATTGACGCCTTGTTCGTCAAGTATGTGCGAGGAGAGCTGCATCAACTG
CCCTGGAGCGAGGAGAAGCTCATGCCCGAATCCTCAAAGATTCGCAACCAACTCGAGGAGCTCAACAGCAGAAGC
CTGTGGACCATGGCATCGCAGCCAGCCGTTAATGGCGCGCCGTCGAGCGATGCCACCTTTGGCTGGGGTCCGCAT
CACGGCTTCGTCTTCCAAAAGGCCTTTGTCGAGTTTTTCATGTCGTCGACGGCCTGGCACCAACTGCTCGCGCGA
CTGCGGTCTCCAGAGGTGCTAGCCTCGGTCAGCTTCTACGCGACCAATAGCAAGGGTGATTTTGTCTCGTCCGAC
TCTAGCGGCGGCATCAACAGCATCAGCCTGCAGGCCAGCACCAATGCCGTGACGTGGGGCGTCTATCCAGGCAAA
GAGATTGTCACACCCACCATTATCGAAGAAGTTAGCTTTCGTGCCTGGAGCGAAGAGGCCTTTGCCATATGGGGC
GAGTGGGCCAAGGTCTATGGCCGGGGCTCGGAAAGCGAGAAGCTGCTCAAGAGTCTGCAGGACGACTGTTGGCTC
GTCAACATTATTCACCACGACTTTGTAGACGGGGATGCGCTGTGGAAGCTGCTGTCGGAGCAGCGGTTGGATTGA
Gene >OphauB2|5839
ATGGAAAAGATCACAGACAAGGTGGCGGCGCTGCCGGCGGGAAGCGAGTACTTCTCGCTCGAGTTCTTCCCGCCA
AAGACGGCCATGGGTTTTGCCAACCTCCGCCACCGGCTGCAGCGCATGGAACAGGCTCTGCGGCCTCTGTTCGTC
ACCGTCACCTGGGGCGCAGGCGGATCCACGGCCACCAAGTCGCTCGAGCTTGCCGAGCTGTGCCAGCGCGAGCTT
GGCCTCACAACGTGTCTTCACCTGACGTGCACCAACATGAGCCGCCGCTGCCTCGACAAGGCGCTAGATGACGCC
AAGGCGGTTGGCATCCGCAATCTCCTTGCTCTGAGAGGCGATCCTCCGCGCCAAGACGAATACCACGATGCCAGT
GACTCGGAAGACGACGTCGACTTTGCCTGGGCTGCTGACCTGGTGCGCTACATTCGCAAGAACCACGGCGACTAC
TTCTGTATCGGCGTCGCCGCCTATCCCGAGGGCCATGGCGAGGGCAGCTGTCCAGCCGACCAGAGCCTGCACAAG
GACTTGTCCTACCTGGTGGACAAGGTGCGGGCGGGCGCCGACTTTATCCTCACGCAGCTCTTCTTTGACGTTGAT
GCCTATGACTCGTTTGAAAAGCTGCTCCGAGACCACTCCAGCGGCGTCTTCAAGACACTGCCCATGATTCCAGGC
CTGATGCCTATCCAAAGCTACCAGATGATCAAGCGCACGGCAAGACTCAGCCATGCAAGGATACCCGACGCCATG
CTGGAGCGCCTCGAGGCCGTCAAGTCGGACGACGAGCAGGTCAAGATGGTGGGCGTTGACATCATCAGCGAAATG
GTGGAGAGGCTCCGAGCAGTCAAGAACCGGACGTCAAATCGCAACGGATACCACTTCTTCACATTAAACCTGGAA
AAGGCCGTCTCCTTCATCGTGGAAAGGACAGGCCTGATTCCCGACTCGTTTGAACAAGAAGAGGCTGTCATTGAC
GAGAGCTCCCGGCTGGCCCTGCCGGTAGTCCAGATCAACGGCAACAACTCGAGTCGCGGGCGCAGCCACTCAAGA
TCGTCGAGACGCTTGTCCTCAGTCGGCTCGGATCCGCACAACAGAGTCATTGTGGGAAACAGACCGCTGACGCAC
CCCGAGTGGGAGGCGACGGGACTCGAGGCCGGTGTCCCCGCAGATAGCATCAACACGCGGGCAAACACGCTGGCA
ATATCAGAAGGCGAAGGCGTGCTCGGGCGCGAAGCCACATGGGACGATTTCCCCAACGGCCGCTTTGGCGACGCT
CGGTCTCCGGCCTATGGCGAGATTGACGGCTACGGTGTCAGTTTGCGCATGTCTCCCAGAGAGACTCTGCGCTTC
TTTGGTGTTCCTCGAACGCGAAGTGACATTGACGCCTTGTTCGTCAAGTATGTGCGAGGAGAGCTGCATCAACTG
CCCTGGAGCGAGGAGAAGCTCATGCCCGAATCCTCAAAGATTCGCAACCAACTCGAGGAGCTCAACAGCAGAAGC
CTGTGGACCATGGCATCGCAGCCAGCCGTTAATGGCGCGCCGTCGAGCGATGCCACCTTTGGCTGGGGTCCGCAT
CACGGCTTCGTCTTCCAAAAGGCCTTTGTCGAGTTTTTCATGTCGTCGACGGCCTGGCACCAACTGCTCGCGCGA
CTGCGGTCTCCAGAGGTGCTAGCCTCGGTCAGCTTCTACGCGACCAATAGCAAGGGTGATTTTGTCTCGTCCGAC
TCTAGCGGCGGCATCAACAGCATCAGCCTGCAGGCCAGCACCAATGCCGTGACGTGGGGCGTCTATCCAGGCAAA
GAGATTGTCACACCCACCATTATCGAAGAAGTTAGCTTTCGTGCCTGGAGCGAAGAGGCCTTTGCCATATGGGGC
GAGTGGGCCAAGGTCTATGGCCGGGGCTCGGAAAGCGAGAAGCTGCTCAAGAGTCTGCAGGACGACTGTTGGCTC
GTCAACATTATTCACCACGACTTTGTAGACGGGGATGCGCTGTGGAAGCTGCTGTCGGAGCAGCGGTTGGATTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail