Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|5837
Gene name
LocationContig_49:74351..75326
Strand+
Gene length (bp)975
Transcript length (bp)867
Coding sequence length (bp)867
Protein length (aa) 289

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04193 PQ-loop PQ loop repeat 1.3E-14 7 64
PF04193 PQ-loop PQ loop repeat 3.8E-14 164 220

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9VCR7|CTNS_DROME Cystinosin homolog OS=Drosophila melanogaster GN=CG17119 PE=1 SV=2 4 266 2.0E-51
sp|O60931|CTNS_HUMAN Cystinosin OS=Homo sapiens GN=CTNS PE=1 SV=2 6 258 6.0E-49
sp|A8WN56|CTNS_CAEBR Cystinosin homolog OS=Caenorhabditis briggsae GN=ctns-1 PE=3 SV=1 4 262 3.0E-47
sp|A7MB63|CTNS_BOVIN Cystinosin OS=Bos taurus GN=CTNS PE=2 SV=1 2 258 4.0E-47
sp|Q54WT7|CTNS_DICDI Cystinosin homolog OS=Dictyostelium discoideum GN=ctns PE=3 SV=1 12 255 1.0E-46
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9VCR7|CTNS_DROME Cystinosin homolog OS=Drosophila melanogaster GN=CG17119 PE=1 SV=2 4 266 2.0E-51
sp|O60931|CTNS_HUMAN Cystinosin OS=Homo sapiens GN=CTNS PE=1 SV=2 6 258 6.0E-49
sp|A8WN56|CTNS_CAEBR Cystinosin homolog OS=Caenorhabditis briggsae GN=ctns-1 PE=3 SV=1 4 262 3.0E-47
sp|A7MB63|CTNS_BOVIN Cystinosin OS=Bos taurus GN=CTNS PE=2 SV=1 2 258 4.0E-47
sp|Q54WT7|CTNS_DICDI Cystinosin homolog OS=Dictyostelium discoideum GN=ctns PE=3 SV=1 12 255 1.0E-46
sp|Q09500|CTNS_CAEEL Cystinosin homolog OS=Caenorhabditis elegans GN=ctns-1 PE=3 SV=2 3 262 2.0E-46
sp|P57757|CTNS_MOUSE Cystinosin OS=Mus musculus GN=Ctns PE=1 SV=1 6 258 2.0E-45
sp|P57758|CTNS_ARATH Cystinosin homolog OS=Arabidopsis thaliana GN=At5g40670 PE=2 SV=1 10 273 3.0E-42
sp|P17261|ERS1_YEAST Cystine transporter OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ERS1 PE=1 SV=1 7 270 6.0E-15
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 21 0.5

Transmembrane Domains

Domain # Start End Length
1 3 25 22
2 45 67 22
3 88 107 19
4 122 144 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|5837
MDLLFLLSAIFGWVYTLCWSASFYPQALLNVRRRSTSGTTIDYPFINVLGFAAYLASSASLLYSPTVRAQYAARH
HGLEPTVQLNDVLFALHALVLSLITASQYFCAQRLWHFHPAVGTRPSRAMVGIATGCVLAIVATYALAARAHRLG
RVDAASDWCQLDVVYAAGYVKLLVTLVKYTPQVVVNARARSTVGWSISQVLLDLVGGVLSLVQLALDSYRQHDWS
GVSGNPVKLALGNASMLYDSIFMVQHYVLYPQRAEGPWPDVEAPLLEAPRATDADSGRRRRLS*
Coding >OphauB2|5837
ATGGATCTTCTCTTTTTGCTATCAGCCATCTTTGGCTGGGTGTACACGCTGTGTTGGAGCGCGTCGTTTTACCCG
CAGGCGCTGCTTAACGTGCGGCGGCGCAGCACGTCGGGCACGACGATTGACTATCCTTTTATCAATGTGCTAGGC
TTTGCCGCCTATTTGGCGTCGAGCGCGTCGCTGCTCTACTCGCCCACTGTGCGCGCCCAGTATGCCGCACGGCAC
CACGGGCTGGAGCCCACGGTCCAGCTCAACGACGTGCTCTTTGCGCTCCACGCCCTCGTCCTCTCCCTCATTACG
GCATCGCAGTACTTTTGCGCCCAGCGGCTGTGGCATTTCCACCCCGCCGTGGGAACACGGCCCAGCCGCGCCATG
GTGGGCATCGCAACAGGCTGCGTGCTGGCCATTGTGGCCACGTATGCCCTCGCTGCGCGCGCGCACCGCCTCGGC
CGCGTCGACGCCGCTTCCGACTGGTGTCAGCTCGACGTGGTGTATGCCGCCGGCTATGTCAAGCTGCTCGTCACC
CTTGTCAAGTATACGCCCCAGGTGGTTGTCAATGCGCGCGCGCGCAGCACCGTTGGCTGGAGCATTAGCCAAGTC
TTGCTGGACCTGGTGGGCGGCGTGCTGAGCCTGGTGCAGCTGGCCCTGGACTCGTACCGCCAGCACGACTGGAGC
GGCGTCTCGGGCAACCCCGTCAAGCTGGCCCTGGGCAACGCGAGCATGCTGTATGATTCCATCTTTATGGTGCAG
CATTATGTGCTCTATCCGCAGCGTGCAGAGGGGCCGTGGCCAGACGTTGAGGCGCCGCTGCTCGAGGCGCCGCGG
GCGACGGATGCGGATAGTGGGCGGCGGAGGAGGCTTTCATGA
Transcript >OphauB2|5837
ATGGATCTTCTCTTTTTGCTATCAGCCATCTTTGGCTGGGTGTACACGCTGTGTTGGAGCGCGTCGTTTTACCCG
CAGGCGCTGCTTAACGTGCGGCGGCGCAGCACGTCGGGCACGACGATTGACTATCCTTTTATCAATGTGCTAGGC
TTTGCCGCCTATTTGGCGTCGAGCGCGTCGCTGCTCTACTCGCCCACTGTGCGCGCCCAGTATGCCGCACGGCAC
CACGGGCTGGAGCCCACGGTCCAGCTCAACGACGTGCTCTTTGCGCTCCACGCCCTCGTCCTCTCCCTCATTACG
GCATCGCAGTACTTTTGCGCCCAGCGGCTGTGGCATTTCCACCCCGCCGTGGGAACACGGCCCAGCCGCGCCATG
GTGGGCATCGCAACAGGCTGCGTGCTGGCCATTGTGGCCACGTATGCCCTCGCTGCGCGCGCGCACCGCCTCGGC
CGCGTCGACGCCGCTTCCGACTGGTGTCAGCTCGACGTGGTGTATGCCGCCGGCTATGTCAAGCTGCTCGTCACC
CTTGTCAAGTATACGCCCCAGGTGGTTGTCAATGCGCGCGCGCGCAGCACCGTTGGCTGGAGCATTAGCCAAGTC
TTGCTGGACCTGGTGGGCGGCGTGCTGAGCCTGGTGCAGCTGGCCCTGGACTCGTACCGCCAGCACGACTGGAGC
GGCGTCTCGGGCAACCCCGTCAAGCTGGCCCTGGGCAACGCGAGCATGCTGTATGATTCCATCTTTATGGTGCAG
CATTATGTGCTCTATCCGCAGCGTGCAGAGGGGCCGTGGCCAGACGTTGAGGCGCCGCTGCTCGAGGCGCCGCGG
GCGACGGATGCGGATAGTGGGCGGCGGAGGAGGCTTTCATGA
Gene >OphauB2|5837
ATGGATCTTCTCTTTTTGCTATCAGCCATCTTTGGCTGGGTGTACACGCTGTGTTGGAGCGCGTCGTTTTACCCG
CAGGCGCTGCTTAACGTGCGGCGGCGCAGCACGTCGGGCACGACGATTGACTATCCTTTTATCAATGTGCTAGGT
TGGCTTCTCCCCTTTGCCCTGTTTCTTTGCCCGCGCTTTTGCCCACCTTTGCTCTCTTGGCCTCTTGGCCTCCCT
CTCGCCGAGTCGCAGCTAACCCGGGCGCCAGGCTTTGCCGCCTATTTGGCGTCGAGCGCGTCGCTGCTCTACTCG
CCCACTGTGCGCGCCCAGTATGCCGCACGGCACCACGGGCTGGAGCCCACGGTCCAGCTCAACGACGTGCTCTTT
GCGCTCCACGCCCTCGTCCTCTCCCTCATTACGGCATCGCAGTACTTTTGCGCCCAGCGGCTGTGGCATTTCCAC
CCCGCCGTGGGAACACGGCCCAGCCGCGCCATGGTGGGCATCGCAACAGGCTGCGTGCTGGCCATTGTGGCCACG
TATGCCCTCGCTGCGCGCGCGCACCGCCTCGGCCGCGTCGACGCCGCTTCCGACTGGTGTCAGCTCGACGTGGTG
TATGCCGCCGGCTATGTCAAGCTGCTCGTCACCCTTGTCAAGTATACGCCCCAGGTGGTTGTCAATGCGCGCGCG
CGCAGCACCGTTGGCTGGAGCATTAGCCAAGTCTTGCTGGACCTGGTGGGCGGCGTGCTGAGCCTGGTGCAGCTG
GCCCTGGACTCGTACCGCCAGCACGACTGGAGCGGCGTCTCGGGCAACCCCGTCAAGCTGGCCCTGGGCAACGCG
AGCATGCTGTATGATTCCATCTTTATGGTGCAGCATTATGTGCTCTATCCGCAGCGTGCAGAGGGGCCGTGGCCA
GACGTTGAGGCGCCGCTGCTCGAGGCGCCGCGGGCGACGGATGCGGATAGTGGGCGGCGGAGGAGGCTTTCATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail