Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|583
Gene name
LocationContig_11:153255..153641
Strand+
Gene length (bp)386
Transcript length (bp)321
Coding sequence length (bp)321
Protein length (aa) 107

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

SignalP signal predicted Location Score
Yes 1 - 20 0.999741

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup6519
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis map64 (Brazil) OphauB2|583 (this protein)
Ophiocordyceps camponoti-floridani Ophcf2|06227
Ophiocordyceps kimflemingae Ophio5|2117
Ophiocordyceps subramaniannii Hirsu2|1175

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|583
MKLAIALITLAFSMATWSLAVLDSTPKLETLPRVKVLETRHTCGSYRARSDVCTGRRLGPQNSFSNCKNRQGKCC
AKYKEGSGGINVGKAIGREDCGFCFTGSCKS*
Coding >OphauB2|583
ATGAAACTCGCCATTGCGCTCATCACTCTTGCCTTTAGCATGGCTACATGGAGCCTTGCCGTGCTCGACTCAACT
CCAAAGCTCGAGACATTGCCACGAGTCAAAGTTCTCGAGACTCGTCATACATGTGGTTCGTATCGAGCAAGGAGC
GATGTATGCACTGGTAGGAGACTGGGGCCTCAAAACTCCTTTTCAAACTGCAAGAATAGGCAGGGCAAATGCTGT
GCCAAGTACAAGGAAGGATCTGGAGGCATCAATGTAGGCAAAGCTATTGGACGAGAGGACTGTGGTTTCTGCTTC
ACTGGCTCGTGCAAATCATGA
Transcript >OphauB2|583
ATGAAACTCGCCATTGCGCTCATCACTCTTGCCTTTAGCATGGCTACATGGAGCCTTGCCGTGCTCGACTCAACT
CCAAAGCTCGAGACATTGCCACGAGTCAAAGTTCTCGAGACTCGTCATACATGTGGTTCGTATCGAGCAAGGAGC
GATGTATGCACTGGTAGGAGACTGGGGCCTCAAAACTCCTTTTCAAACTGCAAGAATAGGCAGGGCAAATGCTGT
GCCAAGTACAAGGAAGGATCTGGAGGCATCAATGTAGGCAAAGCTATTGGACGAGAGGACTGTGGTTTCTGCTTC
ACTGGCTCGTGCAAATCATGA
Gene >OphauB2|583
ATGAAACTCGCCATTGCGCTCATCACTCTTGCCTTTAGCATGGCTACATGGAGCCTTGCCGTGCTCGACTCAACT
CCAAAGCTCGAGACATTGCCACGAGTCAAAGTTCTCGAGACTCGTCATACATGTGGTTCGTATCGAGCAAGGAGC
GATGTATGCACTGGTAGGAGACTGGGGCCTCAAAACTCCTTTTCAAACTGGTACGTCTTGCAATCACTTGGGCTT
ATTGTCCTAGCCTGCGCAGTGTGCTAAAAGTGACGTGTAGCAAGAATAGGCAGGGCAAATGCTGTGCCAAGTACA
AGGAAGGATCTGGAGGCATCAATGTAGGCAAAGCTATTGGACGAGAGGACTGTGGTTTCTGCTTCACTGGCTCGT
GCAAATCATGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail