Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|5826
Gene name
LocationContig_49:35369..37438
Strand+
Gene length (bp)2069
Transcript length (bp)1911
Coding sequence length (bp)1911
Protein length (aa) 637

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF16686 POT1PC ssDNA-binding domain of telomere protection protein 7.3E-40 184 333
PF02765 POT1 Telomeric single stranded DNA binding POT1/CDC13 1.1E-12 27 157

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|O13988|POT1_SCHPO Protection of telomeres protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pot1 PE=1 SV=2 184 561 4.0E-16

GO

GO Term Description Terminal node
GO:0003677 DNA binding Yes
GO:0000781 chromosome, telomeric region Yes
GO:0000723 telomere maintenance Yes
GO:0043047 single-stranded telomeric DNA binding Yes
GO:0006996 organelle organization No
GO:0042162 telomeric DNA binding No
GO:1901360 organic cyclic compound metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0032200 telomere organization No
GO:0003674 molecular_function No
GO:0005488 binding No
GO:0110165 cellular anatomical entity No
GO:0008150 biological_process No
GO:0016043 cellular component organization No
GO:0006725 cellular aromatic compound metabolic process No
GO:0005575 cellular_component No
GO:0043170 macromolecule metabolic process No
GO:0098847 sequence-specific single stranded DNA binding No
GO:0003697 single-stranded DNA binding No
GO:0008152 metabolic process No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0046483 heterocycle metabolic process No
GO:0003676 nucleic acid binding No
GO:0098687 chromosomal region No
GO:0044238 primary metabolic process No
GO:0071840 cellular component organization or biogenesis No
GO:0009987 cellular process No
GO:0043565 sequence-specific DNA binding No
GO:0051276 chromosome organization No
GO:0044237 cellular metabolic process No
GO:0006259 DNA metabolic process No
GO:0071704 organic substance metabolic process No
GO:0044260 cellular macromolecule metabolic process No
GO:1901363 heterocyclic compound binding No
GO:0097159 organic cyclic compound binding No
GO:0090304 nucleic acid metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|5826
MAQPKNDHLLPPSFSTIRDILNGRHPENSLVNVAGLVMDYRAPIKTKGTDYKCEIRLFDQSVENQDDSICLNIFR
PCDEIPFAGCGDVVLLFRVKVQCRPDVSLVTNRSSDIYTFDANSIPRPPADASRALRCMDMKKHHTLNPTETTFV
SSLYHRADKSRMPTKFEFAEKVKISANVKEKVKLLRDVSDSTFADIVGRVVKEPFDDNERITLWISDYTENEAFF
NFSYKGGDMMGMSGWTGPFGKRSIQITCYEPHASFIQSSKLRDCWVYLRNVHIKYGKNGCNLEGFLRGDRTPGQG
RRTGVQRLDHLQDRESLDPRLVDAIRRKRDYERSQAKQLEEITEAAMAGQRRKAALAAEAEPLAKKKKTNRYKDR
AARFQPAAKQEASAAVTVADINSQVKCEHLDKPVSLVSDMLKPQTLKTSIDGSEVALELPFTNHNYRANMHVVDF
APCDLRRFARPVYAKADEYQALSDNDSVSSANDCSSSPTSSAAPSSWEWRFFLKLQDATPSPSPRQSLWVLVDNQ
AAQCLINLDATDLTRHPDALHTLRERLFILWGELEEHKSRARDDAKTRGPPDSDDEQLRLARRHKVLNRPFACCV
CQFGVRVRERDEARANAGARKRWQRVFALFGTKIVA*
Coding >OphauB2|5826
ATGGCACAGCCAAAAAATGACCATCTGCTGCCCCCTTCCTTCTCCACAATCCGCGACATCCTCAACGGCAGGCAT
CCCGAAAATTCCCTTGTCAATGTTGCCGGGCTCGTAATGGATTATCGAGCACCCATCAAAACCAAAGGAACGGAC
TATAAATGCGAGATTCGACTCTTCGACCAGTCTGTAGAGAATCAAGACGATTCGATTTGCCTCAATATTTTCCGG
CCCTGCGATGAAATACCGTTTGCAGGCTGTGGTGACGTTGTTCTATTGTTTCGTGTCAAGGTGCAATGTCGACCT
GATGTTTCGCTCGTCACCAATCGCTCCTCCGATATCTACACCTTTGATGCCAATTCAATTCCCAGACCGCCGGCA
GATGCATCTCGTGCCCTGCGTTGTATGGATATGAAGAAACACCATACGCTGAACCCGACGGAGACTACGTTTGTC
TCGTCATTATACCACAGGGCAGACAAGAGTAGAATGCCCACCAAATTCGAGTTTGCAGAAAAGGTAAAGATCTCG
GCCAATGTAAAGGAAAAGGTCAAGCTCCTGCGAGATGTATCTGACTCGACCTTTGCCGACATTGTTGGCCGGGTC
GTTAAAGAGCCTTTTGATGACAATGAGCGCATCACCCTCTGGATCTCAGACTATACTGAAAATGAAGCGTTTTTC
AACTTTTCCTACAAAGGCGGCGACATGATGGGCATGTCTGGATGGACAGGCCCCTTTGGCAAGCGCAGCATCCAA
ATCACCTGCTACGAGCCACATGCCTCGTTTATTCAAAGCTCCAAGCTGCGTGACTGCTGGGTCTATTTGCGCAAT
GTGCACATCAAGTATGGCAAGAATGGGTGCAACCTGGAAGGATTTCTCAGAGGCGATCGAACCCCTGGGCAGGGG
CGGCGGACAGGAGTCCAGCGGTTGGATCATCTCCAAGATCGCGAGTCTTTGGATCCCCGACTAGTTGATGCGATT
CGCCGCAAGCGCGACTATGAGCGCAGCCAGGCAAAGCAGCTGGAGGAAATCACAGAGGCGGCAATGGCGGGACAA
CGGCGCAAGGCAGCCCTGGCGGCAGAGGCGGAGCCGCTAGCCAAGAAGAAGAAGACGAACCGCTACAAGGATCGC
GCTGCGAGATTTCAGCCGGCGGCGAAGCAAGAAGCTTCAGCGGCTGTGACGGTGGCAGATATCAACTCACAAGTC
AAGTGCGAGCACCTGGACAAGCCCGTGAGCCTCGTGTCCGACATGCTCAAACCGCAGACGCTCAAGACGAGCATC
GACGGCTCAGAGGTGGCCCTGGAGCTGCCCTTTACCAACCACAACTACCGCGCCAACATGCACGTGGTGGACTTT
GCGCCTTGCGACCTGCGCCGCTTCGCCCGGCCCGTATATGCCAAGGCAGACGAATACCAAGCCCTCTCGGACAAC
GACTCTGTCTCGTCGGCCAACGATTGCTCCTCGTCGCCCACCAGCAGCGCCGCCCCAAGCTCATGGGAGTGGCGC
TTCTTCCTCAAACTCCAAGACGCCACGCCCTCGCCCTCGCCTCGGCAAAGCCTCTGGGTCCTCGTCGACAATCAG
GCCGCCCAGTGTCTCATCAACCTCGACGCCACAGACCTGACGCGCCACCCCGACGCGCTCCACACCCTGCGCGAG
CGCCTCTTCATCCTCTGGGGCGAGCTGGAGGAACACAAGAGTCGCGCGCGCGACGACGCCAAGACGCGCGGCCCG
CCTGATAGCGATGACGAGCAGCTTAGGCTGGCGCGCCGACACAAGGTGCTGAACCGGCCGTTTGCCTGCTGCGTG
TGCCAGTTTGGCGTCAGGGTGCGCGAGCGGGATGAGGCGAGGGCCAATGCGGGCGCCAGGAAGCGCTGGCAGAGA
GTCTTTGCCCTCTTTGGCACCAAGATTGTGGCTTGA
Transcript >OphauB2|5826
ATGGCACAGCCAAAAAATGACCATCTGCTGCCCCCTTCCTTCTCCACAATCCGCGACATCCTCAACGGCAGGCAT
CCCGAAAATTCCCTTGTCAATGTTGCCGGGCTCGTAATGGATTATCGAGCACCCATCAAAACCAAAGGAACGGAC
TATAAATGCGAGATTCGACTCTTCGACCAGTCTGTAGAGAATCAAGACGATTCGATTTGCCTCAATATTTTCCGG
CCCTGCGATGAAATACCGTTTGCAGGCTGTGGTGACGTTGTTCTATTGTTTCGTGTCAAGGTGCAATGTCGACCT
GATGTTTCGCTCGTCACCAATCGCTCCTCCGATATCTACACCTTTGATGCCAATTCAATTCCCAGACCGCCGGCA
GATGCATCTCGTGCCCTGCGTTGTATGGATATGAAGAAACACCATACGCTGAACCCGACGGAGACTACGTTTGTC
TCGTCATTATACCACAGGGCAGACAAGAGTAGAATGCCCACCAAATTCGAGTTTGCAGAAAAGGTAAAGATCTCG
GCCAATGTAAAGGAAAAGGTCAAGCTCCTGCGAGATGTATCTGACTCGACCTTTGCCGACATTGTTGGCCGGGTC
GTTAAAGAGCCTTTTGATGACAATGAGCGCATCACCCTCTGGATCTCAGACTATACTGAAAATGAAGCGTTTTTC
AACTTTTCCTACAAAGGCGGCGACATGATGGGCATGTCTGGATGGACAGGCCCCTTTGGCAAGCGCAGCATCCAA
ATCACCTGCTACGAGCCACATGCCTCGTTTATTCAAAGCTCCAAGCTGCGTGACTGCTGGGTCTATTTGCGCAAT
GTGCACATCAAGTATGGCAAGAATGGGTGCAACCTGGAAGGATTTCTCAGAGGCGATCGAACCCCTGGGCAGGGG
CGGCGGACAGGAGTCCAGCGGTTGGATCATCTCCAAGATCGCGAGTCTTTGGATCCCCGACTAGTTGATGCGATT
CGCCGCAAGCGCGACTATGAGCGCAGCCAGGCAAAGCAGCTGGAGGAAATCACAGAGGCGGCAATGGCGGGACAA
CGGCGCAAGGCAGCCCTGGCGGCAGAGGCGGAGCCGCTAGCCAAGAAGAAGAAGACGAACCGCTACAAGGATCGC
GCTGCGAGATTTCAGCCGGCGGCGAAGCAAGAAGCTTCAGCGGCTGTGACGGTGGCAGATATCAACTCACAAGTC
AAGTGCGAGCACCTGGACAAGCCCGTGAGCCTCGTGTCCGACATGCTCAAACCGCAGACGCTCAAGACGAGCATC
GACGGCTCAGAGGTGGCCCTGGAGCTGCCCTTTACCAACCACAACTACCGCGCCAACATGCACGTGGTGGACTTT
GCGCCTTGCGACCTGCGCCGCTTCGCCCGGCCCGTATATGCCAAGGCAGACGAATACCAAGCCCTCTCGGACAAC
GACTCTGTCTCGTCGGCCAACGATTGCTCCTCGTCGCCCACCAGCAGCGCCGCCCCAAGCTCATGGGAGTGGCGC
TTCTTCCTCAAACTCCAAGACGCCACGCCCTCGCCCTCGCCTCGGCAAAGCCTCTGGGTCCTCGTCGACAATCAG
GCCGCCCAGTGTCTCATCAACCTCGACGCCACAGACCTGACGCGCCACCCCGACGCGCTCCACACCCTGCGCGAG
CGCCTCTTCATCCTCTGGGGCGAGCTGGAGGAACACAAGAGTCGCGCGCGCGACGACGCCAAGACGCGCGGCCCG
CCTGATAGCGATGACGAGCAGCTTAGGCTGGCGCGCCGACACAAGGTGCTGAACCGGCCGTTTGCCTGCTGCGTG
TGCCAGTTTGGCGTCAGGGTGCGCGAGCGGGATGAGGCGAGGGCCAATGCGGGCGCCAGGAAGCGCTGGCAGAGA
GTCTTTGCCCTCTTTGGCACCAAGATTGTGGCTTGA
Gene >OphauB2|5826
ATGGCACAGCCAAAAAATGACCATCTGCTGCCCCCTTCCTTCTCCACAATCCGCGACATCCTCAACGGCAGGCAT
CCCGAAAATTCCCTTGTCAATGTTGCCGGGCTCGTAATGGATTATCGAGCACCCATCAAAACCAAAGGAACGGGT
GAGGAGCGCTCACATCTTTGCCAGACCAAAATGTTCATGCCCAGCAGACTATAAATGCGAGATTCGACTCTTCGA
CCAGTCTGTAGAGAATCAAGACGATTCGATTTGCCTCAATATTTTCCGGCCCTGCGATGAAATACCGTTTGCAGG
CTGTGGTGACGTTGTTCTATTGTTTCGTGTCAAGGCATGTTTTGCTTGGAATACATTACTGCTTCTAGAGACGTA
GCCGCTAAGCCTCTGCTAGGTGCAATGTCGACCTGATGTTTCGCTCGTCACCAATCGCTCCTCCGATATCTACAC
CTTTGATGCCAATTCAATTCCCAGACCGCCGGCAGATGCATCTCGTGCCCTGCGTTGTATGGATATGAAGAAACA
CCATACGCTGAACCCGACGGAGACTACGTTTGTCTCGTCATTATACCACAGGGCAGACAAGAGTAGAATGCCCAC
CAAATTCGAGTTTGCAGAAAAGGTAAAGATCTCGGCCAATGTAAAGGAAAAGGTCAAGCTCCTGCGAGATGTATC
TGACTCGACCTTTGCCGACATTGTTGGCCGGGTCGTTAAAGAGCCTTTTGATGACAATGAGCGCATCACCCTCTG
GATCTCAGACTATACTGAAAATGAAGCGTTTTTCAACTTTTCCTACAAAGGCGGCGACATGATGGGCATGTCTGG
ATGGACAGGCCCCTTTGGCAAGCGCAGCATCCAAATCACCTGCTACGAGCCACATGCCTCGTTTATTCAAAGCTC
CAAGCTGCGTGACTGCTGGGTCTATTTGCGCAATGTGCACATCAAGTATGGCAAGAATGGGTGCAACCTGGAAGG
ATTTCTCAGAGGCGATCGAACCCCTGGGCAGGGGCGGCGGACAGGAGTCCAGCGGTTGGATCATCTCCAAGATCG
CGAGTCTTTGGATCCCCGACTAGTTGATGCGATTCGCCGCAAGCGCGACTATGAGCGCAGCCAGGCAAAGCAGCT
GGAGGAAATCACAGAGGCGGCAATGGCGGGACAACGGCGCAAGGCAGCCCTGGCGGCAGAGGCGGAGCCGCTAGC
CAAGAAGAAGAAGACGAACCGCTACAAGGATCGCGCTGCGAGATTTCAGCCGGCGGCGAAGCAAGAAGCTTCAGC
GGCTGTGACGGTGGCAGATATCAACTCACAAGGTAGGCCAAGAGAGCATGATGACTGACTGGCAATACTGACTCG
AGACAGTCAAGTGCGAGCACCTGGACAAGCCCGTGAGCCTCGTGTCCGACATGCTCAAACCGCAGACGCTCAAGA
CGAGCATCGACGGCTCAGAGGTGGCCCTGGAGCTGCCCTTTACCAACCACAACTACCGCGCCAACATGCACGTGG
TGGACTTTGCGCCTTGCGACCTGCGCCGCTTCGCCCGGCCCGTATATGCCAAGGCAGACGAATACCAAGCCCTCT
CGGACAACGACTCTGTCTCGTCGGCCAACGATTGCTCCTCGTCGCCCACCAGCAGCGCCGCCCCAAGCTCATGGG
AGTGGCGCTTCTTCCTCAAACTCCAAGACGCCACGCCCTCGCCCTCGCCTCGGCAAAGCCTCTGGGTCCTCGTCG
ACAATCAGGCCGCCCAGTGTCTCATCAACCTCGACGCCACAGACCTGACGCGCCACCCCGACGCGCTCCACACCC
TGCGCGAGCGCCTCTTCATCCTCTGGGGCGAGCTGGAGGAACACAAGAGTCGCGCGCGCGACGACGCCAAGACGC
GCGGCCCGCCTGATAGCGATGACGAGCAGCTTAGGCTGGCGCGCCGACACAAGGTGCTGAACCGGCCGTTTGCCT
GCTGCGTGTGCCAGTTTGGCGTCAGGGTGCGCGAGCGGGATGAGGCGAGGGCCAATGCGGGCGCCAGGAAGCGCT
GGCAGAGAGTCTTTGCCCTCTTTGGCACCAAGATTGTGGCTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail