Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|5825
Gene name
LocationContig_49:31961..33536
Strand-
Gene length (bp)1575
Transcript length (bp)1176
Coding sequence length (bp)1176
Protein length (aa) 392

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 63 0.5

Transmembrane Domains

Domain # Start End Length
1 26 45 19
2 66 88 22
3 108 130 22
4 142 164 22
5 188 210 22
6 223 242 19
7 262 284 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|5825
MASLGNDVALPPAGTKPNFLNPEDHMVQNVALHTVCLVLITGFVAMRVYTRIHIIKTALGADDYCCLVSYCLSVA
FSGLALKSYTLGIGRHMWDVPAPWLPFAFKFYTIAAQVFMLLSGFVKLAILFSYRHFLSPAAKTRHLVNYGIALI
CCFHTGLYFASLFACRPITAIWDANTKGHCFPLSIIPYASAVSSCVMDLYVLLLPLPVVWSLNLSFTWKLRILAV
FNLGLMACVASIIRLVMSPRIQKSADLTWILSKIAVWGLLEVDLGILCACLMLLPAFLGQVIPERAQSLFCRFCS
VVPGPSSRRSLDLSLTFTNRGHKSWAHCKHDATRVDQVQCSSNRIIRHQSFSINSIRTPQDGTSSSSINGKTSMG
DYYTKTAAQAKTFDIP*
Coding >OphauB2|5825
ATGGCTTCACTGGGCAATGACGTCGCATTGCCTCCAGCAGGCACCAAGCCCAATTTTCTCAATCCAGAGGACCAT
ATGGTGCAAAATGTAGCGCTGCATACCGTCTGTCTGGTCCTCATTACCGGCTTTGTGGCCATGCGAGTCTATACT
CGGATACACATTATCAAGACTGCCTTGGGGGCTGATGACTATTGCTGTCTTGTTTCCTACTGCTTGTCAGTAGCG
TTTTCAGGCTTGGCGCTCAAGTCTTATACACTGGGCATTGGCCGCCACATGTGGGATGTTCCCGCGCCATGGCTC
CCATTTGCTTTCAAGTTTTACACCATCGCAGCCCAGGTGTTCATGCTGCTCTCGGGCTTCGTCAAGCTCGCCATC
CTCTTCTCCTACCGCCACTTTCTGTCGCCCGCCGCAAAGACGCGCCATCTGGTCAACTATGGCATCGCCCTGATA
TGCTGTTTTCACACTGGCCTATACTTTGCTAGCCTCTTTGCTTGTAGGCCCATTACCGCCATCTGGGATGCTAAC
ACCAAGGGCCACTGCTTCCCTCTGTCAATCATTCCCTATGCGTCAGCCGTTTCGAGCTGTGTCATGGACCTCTAC
GTCTTGCTTCTTCCTTTGCCCGTAGTCTGGAGTCTCAATCTGAGCTTCACATGGAAACTGAGGATTTTAGCCGTC
TTTAACCTTGGGTTAATGGCTTGTGTTGCCAGTATCATTCGGCTAGTAATGAGTCCGAGGATCCAAAAAAGCGCC
GATTTGACCTGGATCCTCTCCAAGATAGCAGTATGGGGGCTCCTTGAGGTCGACCTAGGCATTTTGTGCGCCTGT
CTCATGCTGCTGCCAGCATTTCTCGGCCAAGTCATACCAGAGCGAGCCCAGAGCTTGTTTTGCCGGTTCTGTTCA
GTCGTTCCGGGACCGTCGTCGAGGAGAAGTCTTGACCTGAGTTTGACCTTTACCAATAGAGGACACAAGAGCTGG
GCGCACTGCAAGCATGACGCGACCCGCGTCGATCAAGTTCAGTGCAGCAGTAATAGAATTATCCGACACCAAAGC
TTCAGTATTAACAGTATCAGAACACCCCAAGATGGTACCAGTAGTTCTAGTATCAACGGCAAGACTTCAATGGGC
GATTATTATACCAAGACCGCGGCACAGGCCAAGACCTTTGACATACCTTAA
Transcript >OphauB2|5825
ATGGCTTCACTGGGCAATGACGTCGCATTGCCTCCAGCAGGCACCAAGCCCAATTTTCTCAATCCAGAGGACCAT
ATGGTGCAAAATGTAGCGCTGCATACCGTCTGTCTGGTCCTCATTACCGGCTTTGTGGCCATGCGAGTCTATACT
CGGATACACATTATCAAGACTGCCTTGGGGGCTGATGACTATTGCTGTCTTGTTTCCTACTGCTTGTCAGTAGCG
TTTTCAGGCTTGGCGCTCAAGTCTTATACACTGGGCATTGGCCGCCACATGTGGGATGTTCCCGCGCCATGGCTC
CCATTTGCTTTCAAGTTTTACACCATCGCAGCCCAGGTGTTCATGCTGCTCTCGGGCTTCGTCAAGCTCGCCATC
CTCTTCTCCTACCGCCACTTTCTGTCGCCCGCCGCAAAGACGCGCCATCTGGTCAACTATGGCATCGCCCTGATA
TGCTGTTTTCACACTGGCCTATACTTTGCTAGCCTCTTTGCTTGTAGGCCCATTACCGCCATCTGGGATGCTAAC
ACCAAGGGCCACTGCTTCCCTCTGTCAATCATTCCCTATGCGTCAGCCGTTTCGAGCTGTGTCATGGACCTCTAC
GTCTTGCTTCTTCCTTTGCCCGTAGTCTGGAGTCTCAATCTGAGCTTCACATGGAAACTGAGGATTTTAGCCGTC
TTTAACCTTGGGTTAATGGCTTGTGTTGCCAGTATCATTCGGCTAGTAATGAGTCCGAGGATCCAAAAAAGCGCC
GATTTGACCTGGATCCTCTCCAAGATAGCAGTATGGGGGCTCCTTGAGGTCGACCTAGGCATTTTGTGCGCCTGT
CTCATGCTGCTGCCAGCATTTCTCGGCCAAGTCATACCAGAGCGAGCCCAGAGCTTGTTTTGCCGGTTCTGTTCA
GTCGTTCCGGGACCGTCGTCGAGGAGAAGTCTTGACCTGAGTTTGACCTTTACCAATAGAGGACACAAGAGCTGG
GCGCACTGCAAGCATGACGCGACCCGCGTCGATCAAGTTCAGTGCAGCAGTAATAGAATTATCCGACACCAAAGC
TTCAGTATTAACAGTATCAGAACACCCCAAGATGGTACCAGTAGTTCTAGTATCAACGGCAAGACTTCAATGGGC
GATTATTATACCAAGACCGCGGCACAGGCCAAGACCTTTGACATACCTTAA
Gene >OphauB2|5825
ATGGCTTCACTGGGCAATGACGTCGCATTGCCTCCAGCAGGCACCAAGCCCAATTTTCTCAATCCAGAGGACCAT
ATGGTGCAAAATGTAGCGCTGCATACCGTCTGTCTGGTCCTCATTACCGGCTTTGTGGCCATGCGAGTCTATACT
CGGATACACATTATCAAGACTGCCTTGGGGGCTGATGACTGTAGGCGAGCCTGCGATGGATACTGCAGAGGAAGA
GACAATTGCTAATTTGGTCAATGGCAGATTGCTGTCTTGTTTCCTACGTGAGTAAAGACTGGGACGGGTGCTGCA
AATGCAAAAATGCACTGCTGCCTCGCCTTTAGACAATAGCTAATGGCTCGCTCCAATATACCAGTGCTTGTCAGT
AGCGTTTTCAGGCTTGGCGCTCAAGTGTCTGTCCCTGCTTCATCCTCCAAGCCGTCAGCGACTGACGCTGTAAAC
AGCTTATACACTGGGCATTGGCCGCCACATGTGGGATGTTCCCGCGCCATGGCTCCCATTTGCTTTCAAGGTGCG
CCACTCAGACTTGGATGCCAGCATGACGGCGAGCCTGACCCGCCTGTTTCCCACATAGTTTTACACCATCGCAGC
CCAGGTGTTCATGCTGCTCTCGGGCTTCGTCAAGCTCGCCATCCTCTTCTCCTACCGCCACTTTCTGTCGCCCGC
CGCAAAGACGCGCCATCTGGTCAACTATGGCATCGCCCTGATATGCTGTTTTCACACTGGCCTATACTTTGCTAG
CCTCTTTGCTTGTAGGCCCATTACCGCCATCTGGGATGCTAACACCAAGGGCCACTGCTTCCCTCTGTCAATCAT
TCCCTATGCGTCAGCCGTTTCGAGCTGTGTCATGGACCTCTACGTCTTGCTTCTTCCTTTGCCCGTAGTCTGGAG
TCTCAATCTGAGCTTCACATGGAAACTGAGGATTTTAGCCGTCTTTAACCTTGGGTTAATGTGAGCAAACTCTAC
CCATTCTTGGCATCAAAAATTCCAGCTAATGTATCCCCAAAATCTACAGGGCTTGTGTTGCCAGTATCATTCGGC
TAGTAATGAGTCCGAGGATCCAAAAAAGCGCCGATTTGACCTGGATCCTCTCCAAGATAGCAGTATGGGGGTATG
TTGTCTCACACTGCCATCTTTTCACCGTCTTGTGACTGACAAGATTTACTTTTGCCTTGCAGGCTCCTTGAGGTC
GACCTAGGCATTTTGTGCGCCTGTCTCATGCTGCTGCCAGCATTTCTCGGCCAAGTCATACCAGAGCGAGCCCAG
AGCTTGTTTTGCCGGTTCTGTTCAGTCGTTCCGGGACCGTCGTCGAGGAGAAGTCTTGACCTGAGTTTGACCTTT
ACCAATAGAGGACACAAGAGCTGGGCGCACTGCAAGCATGACGCGACCCGCGTCGATCAAGTTCAGTGCAGCAGT
AATAGAATTATCCGACACCAAAGCTTCAGTATTAACAGTATCAGAACACCCCAAGATGGTACCAGTAGTTCTAGT
ATCAACGGCAAGACTTCAATGGGCGATTATTATACCAAGACCGCGGCACAGGCCAAGACCTTTGACATACCTTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail