Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|5819
Gene name
LocationContig_49:16763..17643
Strand-
Gene length (bp)880
Transcript length (bp)756
Coding sequence length (bp)756
Protein length (aa) 252

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01652 IF4E Eukaryotic initiation factor 4E 4.2E-37 43 190

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q66HY7|IF4E3_DANRE Eukaryotic translation initiation factor 4E type 3 OS=Danio rerio GN=eif4e3 PE=2 SV=1 6 220 1.0E-22
sp|O60573|IF4E2_HUMAN Eukaryotic translation initiation factor 4E type 2 OS=Homo sapiens GN=EIF4E2 PE=1 SV=1 43 214 8.0E-22
sp|Q8BMB3|IF4E2_MOUSE Eukaryotic translation initiation factor 4E type 2 OS=Mus musculus GN=Eif4e2 PE=1 SV=1 43 214 2.0E-21
sp|Q8N5X7|IF4E3_HUMAN Eukaryotic translation initiation factor 4E type 3 OS=Homo sapiens GN=EIF4E3 PE=2 SV=4 41 220 5.0E-21
sp|Q9DBB5|IF4E3_MOUSE Eukaryotic translation initiation factor 4E type 3 OS=Mus musculus GN=Eif4e3 PE=1 SV=1 41 220 9.0E-21
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q66HY7|IF4E3_DANRE Eukaryotic translation initiation factor 4E type 3 OS=Danio rerio GN=eif4e3 PE=2 SV=1 6 220 1.0E-22
sp|O60573|IF4E2_HUMAN Eukaryotic translation initiation factor 4E type 2 OS=Homo sapiens GN=EIF4E2 PE=1 SV=1 43 214 8.0E-22
sp|Q8BMB3|IF4E2_MOUSE Eukaryotic translation initiation factor 4E type 2 OS=Mus musculus GN=Eif4e2 PE=1 SV=1 43 214 2.0E-21
sp|Q8N5X7|IF4E3_HUMAN Eukaryotic translation initiation factor 4E type 3 OS=Homo sapiens GN=EIF4E3 PE=2 SV=4 41 220 5.0E-21
sp|Q9DBB5|IF4E3_MOUSE Eukaryotic translation initiation factor 4E type 3 OS=Mus musculus GN=Eif4e3 PE=1 SV=1 41 220 9.0E-21
sp|Q6GR08|I4E3A_XENLA Eukaryotic translation initiation factor 4E type 3-A OS=Xenopus laevis GN=eif4e3-a PE=2 SV=1 41 220 5.0E-20
sp|Q28ET8|IF4E3_XENTR Eukaryotic translation initiation factor 4E type 3 OS=Xenopus tropicalis GN=eif4e3 PE=2 SV=1 41 220 8.0E-20
sp|Q6NU27|I4E3B_XENLA Eukaryotic translation initiation factor 4E type 3-B OS=Xenopus laevis GN=eif4e3-b PE=2 SV=1 41 220 1.0E-19
sp|Q9FK59|IF4E5_ARATH Eukaryotic translation initiation factor NCBP OS=Arabidopsis thaliana GN=NCBP PE=2 SV=1 43 185 6.0E-18
sp|P48598|IF4E_DROME Eukaryotic translation initiation factor 4E OS=Drosophila melanogaster GN=eIF-4E PE=1 SV=1 13 196 3.0E-17
sp|Q10NQ9|IF4E3_ORYSJ Eukaryotic translation initiation factor NCBP OS=Oryza sativa subsp. japonica GN=NCBP PE=2 SV=1 43 188 1.0E-16
sp|A3RCV9|IF4E3_WHEAT Eukaryotic translation initiation factor NCBP OS=Triticum aestivum GN=NCBP PE=2 SV=1 43 188 1.0E-16
sp|Q22888|IF4E4_CAEEL Eukaryotic translation initiation factor 4E-4 OS=Caenorhabditis elegans GN=ife-4 PE=2 SV=1 47 214 1.0E-14
sp|O23252|IF4E1_ARATH Eukaryotic translation initiation factor 4E-1 OS=Arabidopsis thaliana GN=EIF4E1 PE=1 SV=1 43 188 2.0E-14
sp|Q55FE0|IF4E_DICDI Eukaryotic translation initiation factor 4E OS=Dictyostelium discoideum GN=eif4e PE=3 SV=1 43 192 2.0E-14
sp|O81481|IF4E1_MAIZE Eukaryotic translation initiation factor 4E-1 OS=Zea mays PE=2 SV=1 15 188 2.0E-14
sp|P48599|IF4E1_ORYSJ Eukaryotic translation initiation factor 4E-1 OS=Oryza sativa subsp. japonica GN=Os01g0970400 PE=2 SV=1 4 188 4.0E-14
sp|Q9P975|IF4E_CANAL Eukaryotic translation initiation factor 4E OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=TIF45 PE=3 SV=1 79 193 9.0E-14
sp|O77210|IF4E_APLCA Eukaryotic translation initiation factor 4E OS=Aplysia californica PE=1 SV=1 43 233 1.0E-13
sp|Q9C7P2|IF4E2_ARATH Eukaryotic translation initiation factor 4E-2 OS=Arabidopsis thaliana GN=EIF4E2 PE=1 SV=2 13 182 1.0E-13
sp|Q9C7P6|IF4E3_ARATH Eukaryotic translation initiation factor 4E-3 OS=Arabidopsis thaliana GN=EIF4E3 PE=1 SV=1 13 182 2.0E-13
sp|P29557|IF4E1_WHEAT Eukaryotic translation initiation factor 4E-1 OS=Triticum aestivum PE=1 SV=3 39 188 6.0E-13
sp|Q9DFS6|IF4EA_DANRE Eukaryotic translation initiation factor 4E-1A OS=Danio rerio GN=eif4e1a PE=1 SV=1 43 233 2.0E-12
sp|O61955|IF4E3_CAEEL Eukaryotic translation initiation factor 4E-3 OS=Caenorhabditis elegans GN=ife-3 PE=1 SV=2 43 181 2.0E-12
sp|O04663|IF4E4_ARATH Eukaryotic translation initiation factor isoform 4E OS=Arabidopsis thaliana GN=EIF(ISO)4E PE=1 SV=2 48 188 3.0E-12
sp|Q03389|IF4E2_WHEAT Eukaryotic translation initiation factor isoform 4E-2 OS=Triticum aestivum PE=1 SV=1 45 182 1.0E-11
sp|P06730|IF4E_HUMAN Eukaryotic translation initiation factor 4E OS=Homo sapiens GN=EIF4E PE=1 SV=2 43 233 1.0E-11
sp|Q9N0T5|IF4E_BOVIN Eukaryotic translation initiation factor 4E OS=Bos taurus GN=EIF4E PE=2 SV=2 43 233 2.0E-11
sp|P63074|IF4E_RAT Eukaryotic translation initiation factor 4E OS=Rattus norvegicus GN=Eif4e PE=1 SV=1 43 233 2.0E-11
sp|P63073|IF4E_MOUSE Eukaryotic translation initiation factor 4E OS=Mus musculus GN=Eif4e PE=1 SV=1 43 233 2.0E-11
sp|P29338|IF4E_RABIT Eukaryotic translation initiation factor 4E OS=Oryctolagus cuniculus GN=EIF4E PE=1 SV=1 43 233 2.0E-11
sp|P07260|IF4E_YEAST Eukaryotic translation initiation factor 4E OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CDC33 PE=1 SV=1 43 182 2.0E-11
sp|O81482|IF4E2_MAIZE Eukaryotic translation initiation factor isoform 4E-2 OS=Zea mays PE=2 SV=1 48 182 2.0E-11
sp|P48600|IF4E2_ORYSJ Eukaryotic translation initiation factor isoform 4E-2 OS=Oryza sativa subsp. japonica GN=Os10g0467600 PE=2 SV=2 48 182 2.0E-11
sp|A6NMX2|I4E1B_HUMAN Eukaryotic translation initiation factor 4E type 1B OS=Homo sapiens GN=EIF4E1B PE=3 SV=3 43 233 3.0E-11
sp|P48597|IF4E_XENLA Eukaryotic translation initiation factor 4E OS=Xenopus laevis GN=eif4e PE=1 SV=1 43 216 5.0E-11
sp|Q9P974|IF4E_CANGA Eukaryotic translation initiation factor 4E OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=TIF45 PE=3 SV=2 43 182 1.0E-10
sp|Q21693|IF4E2_CAEEL Eukaryotic translation initiation factor 4E-2 OS=Caenorhabditis elegans GN=ife-2 PE=1 SV=1 64 212 2.0E-10
sp|P78954|IF4E1_SCHPO Eukaryotic translation initiation factor 4E-1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tif451 PE=3 SV=1 15 188 2.0E-10
sp|O74743|IF4E2_SCHPO Eukaryotic translation initiation factor 4E-2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tif452 PE=3 SV=1 39 188 3.0E-10
sp|Q75AV8|IF4E_ASHGO Eukaryotic translation initiation factor 4E OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=TIF45 PE=3 SV=2 43 177 5.0E-10
sp|Q9PW28|IF4EB_DANRE Eukaryotic translation initiation factor 4E-1B OS=Danio rerio GN=eif4e1b PE=2 SV=1 43 188 2.0E-08
sp|Q3UTA9|I4E1B_MOUSE Eukaryotic translation initiation factor 4E type 1B OS=Mus musculus GN=Eif4e1b PE=2 SV=1 43 188 3.0E-08
sp|Q5UQG4|IF4EH_MIMIV Eukaryotic translation initiation factor 4E homolog OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L496 PE=3 SV=1 80 170 3.0E-07
sp|O45551|IF4E1_CAEEL Eukaryotic translation initiation factor 4E-1 OS=Caenorhabditis elegans GN=ife-1 PE=1 SV=2 79 180 8.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0006413 translational initiation Yes
GO:0003723 RNA binding Yes
GO:0003743 translation initiation factor activity Yes
GO:0009987 cellular process No
GO:0003674 molecular_function No
GO:0045182 translation regulator activity No
GO:0008152 metabolic process No
GO:0005488 binding No
GO:0008135 translation factor activity, RNA binding No
GO:0008150 biological_process No
GO:0044237 cellular metabolic process No
GO:1901363 heterocyclic compound binding No
GO:0090079 translation regulator activity, nucleic acid binding No
GO:0097159 organic cyclic compound binding No
GO:0003676 nucleic acid binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 22 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|5819
MSMRPQLFTRGLAGPAPSSEANSPAEQRDDAKRNLFKTMRALPTQHYWTVYFDRQSKDHRPDADEYNVQLEQLGS
QIESVQDFWRYNNNTPVENIKMRESIYLFKAGFRPVWEDRRNVNGGSWTFRVPKASGPDVWTRIQLLAIGEKLQS
ALDDGDQLCGVGLSVRFNSHLISIWHRDSSKQTSVDAILACVLDELPPELRPKPDNFFYKRHCDHAGFKAPVDDA
KKPGDDAKEPIDGAQPEVRVDPPSAH*
Coding >OphauB2|5819
ATGTCGATGCGGCCGCAGCTCTTTACGCGCGGGCTGGCCGGCCCCGCGCCCAGCTCCGAGGCCAACTCGCCGGCC
GAGCAGCGCGACGACGCCAAGCGCAACCTCTTCAAGACGATGCGGGCGCTGCCCACGCAGCACTACTGGACCGTC
TACTTTGACCGGCAGTCCAAGGACCACCGTCCCGATGCCGACGAGTACAATGTGCAGCTGGAGCAGCTGGGCAGC
CAGATTGAGTCGGTCCAAGACTTTTGGCGCTATAATAATAACACGCCCGTTGAGAATATCAAGATGCGTGAGAGC
ATCTATCTCTTCAAGGCGGGCTTCCGGCCGGTTTGGGAGGATAGGCGTAATGTTAATGGCGGTAGTTGGACCTTT
CGCGTCCCCAAGGCGAGCGGGCCCGATGTCTGGACGCGCATCCAGCTGCTGGCTATTGGCGAGAAGCTGCAGAGT
GCGCTCGACGATGGCGACCAGCTCTGCGGCGTCGGCCTCTCTGTGCGCTTCAACTCGCACCTCATTTCCATTTGG
CACCGCGACTCGTCCAAACAAACGTCGGTCGACGCCATCCTCGCCTGCGTACTCGACGAGTTGCCGCCCGAGCTG
CGGCCCAAGCCCGACAACTTTTTCTACAAGCGCCACTGCGACCACGCCGGCTTCAAGGCGCCCGTCGACGATGCA
AAGAAGCCCGGCGACGATGCCAAGGAGCCAATCGATGGGGCGCAGCCAGAGGTGCGTGTTGATCCGCCGTCGGCA
CATTAG
Transcript >OphauB2|5819
ATGTCGATGCGGCCGCAGCTCTTTACGCGCGGGCTGGCCGGCCCCGCGCCCAGCTCCGAGGCCAACTCGCCGGCC
GAGCAGCGCGACGACGCCAAGCGCAACCTCTTCAAGACGATGCGGGCGCTGCCCACGCAGCACTACTGGACCGTC
TACTTTGACCGGCAGTCCAAGGACCACCGTCCCGATGCCGACGAGTACAATGTGCAGCTGGAGCAGCTGGGCAGC
CAGATTGAGTCGGTCCAAGACTTTTGGCGCTATAATAATAACACGCCCGTTGAGAATATCAAGATGCGTGAGAGC
ATCTATCTCTTCAAGGCGGGCTTCCGGCCGGTTTGGGAGGATAGGCGTAATGTTAATGGCGGTAGTTGGACCTTT
CGCGTCCCCAAGGCGAGCGGGCCCGATGTCTGGACGCGCATCCAGCTGCTGGCTATTGGCGAGAAGCTGCAGAGT
GCGCTCGACGATGGCGACCAGCTCTGCGGCGTCGGCCTCTCTGTGCGCTTCAACTCGCACCTCATTTCCATTTGG
CACCGCGACTCGTCCAAACAAACGTCGGTCGACGCCATCCTCGCCTGCGTACTCGACGAGTTGCCGCCCGAGCTG
CGGCCCAAGCCCGACAACTTTTTCTACAAGCGCCACTGCGACCACGCCGGCTTCAAGGCGCCCGTCGACGATGCA
AAGAAGCCCGGCGACGATGCCAAGGAGCCAATCGATGGGGCGCAGCCAGAGGTGCGTGTTGATCCGCCGTCGGCA
CATTAG
Gene >OphauB2|5819
ATGTCGATGCGGCCGCAGCTCTTTACGCGCGGGCTGGCCGGCCCCGCGCCCAGCTCCGAGGCCAACTCGCCGGCC
GAGCAGCGCGACGACGCCAAGCGCAACCTCTTCAAGACGATGCGGGCGCTGCCCACGCAGCACTACTGGACCGTC
TACTTTGACCGGCAGTCCAAGGACCACCGTCCCGATGCCGACGAGTACAATGTGCAGCTGGAGCAGCTGGGCAGC
CAGATTGAGTCGGTCCAAGACTTTTGGCGCTATAATAATAACACGCCCGTTGAGAATATCAAGATGCGTGAGAGC
ATCTATCTCTTCAAGGCGGGCTTCCGGCCGGTTTGGGAGGATAGGCGTAATGTTAATGGCGGTAGTTGGACCTTT
CGCGTCCCCAAGGCGAGCGGGCCCGATGTCTGGACGCGCATCCAGCTGCTGGCTATTGGCGAGAAGCTGCAGAGT
GCGCTCGACGATGGTATGTTGTCCTCTTGTTTTTTTTCCTTTTCCCCTCTCTCCCTCTCTCGGTGTTTGTACATG
TGGGGGAAAAGAAGAGACAAAGACTTGTTTTGCCAACACAACTTGCCCCCCCCCCCCCTTAGGCGACCAGCTCTG
CGGCGTCGGCCTCTCTGTGCGCTTCAACTCGCACCTCATTTCCATTTGGCACCGCGACTCGTCCAAACAAACGTC
GGTCGACGCCATCCTCGCCTGCGTACTCGACGAGTTGCCGCCCGAGCTGCGGCCCAAGCCCGACAACTTTTTCTA
CAAGCGCCACTGCGACCACGCCGGCTTCAAGGCGCCCGTCGACGATGCAAAGAAGCCCGGCGACGATGCCAAGGA
GCCAATCGATGGGGCGCAGCCAGAGGTGCGTGTTGATCCGCCGTCGGCACATTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail