Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|5818
Gene name
LocationContig_49:15550..16278
Strand-
Gene length (bp)728
Transcript length (bp)654
Coding sequence length (bp)654
Protein length (aa) 218

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01569 PAP2 PAP2 superfamily 2.4E-14 79 171

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9C2M6|DOPP_NEUCR Putative dolichyldiphosphatase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=17E5.220 PE=3 SV=1 1 179 6.0E-63
sp|Q86IX2|DOPP1_DICDI Dolichyldiphosphatase 1 OS=Dictyostelium discoideum GN=dolpp1 PE=3 SV=1 6 173 7.0E-25
sp|P53223|CAX4_YEAST Dolichyldiphosphatase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CAX4 PE=1 SV=1 14 180 2.0E-24
sp|B2KI79|DOPP1_RHIFE Dolichyldiphosphatase 1 OS=Rhinolophus ferrumequinum GN=DOLPP1 PE=3 SV=1 11 173 4.0E-24
sp|B0CM95|DOPP1_PAPAN Dolichyldiphosphatase 1 OS=Papio anubis GN=DOLPP1 PE=3 SV=1 11 173 1.0E-22
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9C2M6|DOPP_NEUCR Putative dolichyldiphosphatase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=17E5.220 PE=3 SV=1 1 179 6.0E-63
sp|Q86IX2|DOPP1_DICDI Dolichyldiphosphatase 1 OS=Dictyostelium discoideum GN=dolpp1 PE=3 SV=1 6 173 7.0E-25
sp|P53223|CAX4_YEAST Dolichyldiphosphatase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CAX4 PE=1 SV=1 14 180 2.0E-24
sp|B2KI79|DOPP1_RHIFE Dolichyldiphosphatase 1 OS=Rhinolophus ferrumequinum GN=DOLPP1 PE=3 SV=1 11 173 4.0E-24
sp|B0CM95|DOPP1_PAPAN Dolichyldiphosphatase 1 OS=Papio anubis GN=DOLPP1 PE=3 SV=1 11 173 1.0E-22
sp|B0KWE9|DOPP1_CALJA Dolichyldiphosphatase 1 OS=Callithrix jacchus GN=DOLPP1 PE=3 SV=1 11 173 2.0E-22
sp|Q86YN1|DOPP1_HUMAN Dolichyldiphosphatase 1 OS=Homo sapiens GN=DOLPP1 PE=2 SV=1 11 173 2.0E-22
sp|B1MTH4|DOPP1_CALMO Dolichyldiphosphatase 1 OS=Callicebus moloch GN=DOLPP1 PE=3 SV=1 11 173 2.0E-22
sp|Q9JMF7|DOPP1_MOUSE Dolichyldiphosphatase 1 OS=Mus musculus GN=Dolpp1 PE=2 SV=1 11 173 2.0E-21
sp|O59747|PDF1_SCHPO Palmitoyl-protein thioesterase-dolichyl pyrophosphate phosphatase fusion 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pdf1 PE=1 SV=2 13 177 1.0E-17
sp|Q6NLA5|LPPG_ARATH Lipid phosphate phosphatase gamma, chloroplastic OS=Arabidopsis thaliana GN=LPPG PE=1 SV=1 8 167 1.0E-17
sp|Q6NQL6|LPPE2_ARATH Lipid phosphate phosphatase epsilon 2, chloroplastic OS=Arabidopsis thaliana GN=LPPE2 PE=1 SV=1 19 167 8.0E-08
sp|F4J220|LPPE1_ARATH Lipid phosphate phosphatase epsilon 1, chloroplastic OS=Arabidopsis thaliana GN=LPPE1 PE=1 SV=1 38 169 4.0E-07
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 40 0.5

Transmembrane Domains

Domain # Start End Length
1 26 48 22
2 119 141 22
3 151 173 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|5818
MAVHDTPLASLSLTHVYYDPNDSISLICAYLALVPQALCIVYATLVLASREAEVVLALVGQVACEALNLALKRAI
KQRRPLRFHDCGYGMPSSHAQFLAFWATQLALFLMLRYQPRLSAWWHRALTSLAAALLAAAVAWSRVYLGYHSPA
QVLVGCAAGAACALAWFALTAALRSSGWLRXXXXXXXXXXXXXXXXXGFVPGWLGKVAAHTGPGAAA*
Coding >OphauB2|5818
ATGGCCGTCCACGACACGCCCCTGGCCTCCCTATCGCTCACCCACGTCTACTATGATCCAAACGACTCCATCTCC
CTAATATGCGCATACCTCGCCCTCGTCCCCCAGGCCCTATGCATCGTCTACGCCACGCTTGTTCTCGCCTCGCGC
GAAGCCGAAGTAGTGCTCGCCCTCGTCGGCCAAGTTGCTTGCGAGGCGCTTAATCTCGCCCTCAAGCGCGCCATC
AAGCAGCGCCGTCCTCTGCGCTTCCACGACTGCGGCTACGGCATGCCCTCGTCACATGCCCAGTTTCTCGCCTTT
TGGGCCACGCAGCTTGCTCTCTTCCTTATGCTTCGCTACCAGCCGCGCCTGAGTGCCTGGTGGCATCGCGCCTTG
ACGAGCTTGGCTGCCGCTCTGCTTGCTGCGGCGGTGGCGTGGAGCAGAGTCTATCTCGGCTATCATTCTCCCGCT
CAGGTGCTTGTTGGCTGCGCCGCCGGTGCTGCCTGCGCTCTGGCTTGGTTTGCACTCACGGCCGCCCTGCGCTCA
AGTGGCTGGCTGCGCTGNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNGGATTTGTG
CCAGGCTGGCTGGGAAAAGTGGCAGCGCACACGGGCCCAGGCGCCGCCGCCTGA
Transcript >OphauB2|5818
ATGGCCGTCCACGACACGCCCCTGGCCTCCCTATCGCTCACCCACGTCTACTATGATCCAAACGACTCCATCTCC
CTAATATGCGCATACCTCGCCCTCGTCCCCCAGGCCCTATGCATCGTCTACGCCACGCTTGTTCTCGCCTCGCGC
GAAGCCGAAGTAGTGCTCGCCCTCGTCGGCCAAGTTGCTTGCGAGGCGCTTAATCTCGCCCTCAAGCGCGCCATC
AAGCAGCGCCGTCCTCTGCGCTTCCACGACTGCGGCTACGGCATGCCCTCGTCACATGCCCAGTTTCTCGCCTTT
TGGGCCACGCAGCTTGCTCTCTTCCTTATGCTTCGCTACCAGCCGCGCCTGAGTGCCTGGTGGCATCGCGCCTTG
ACGAGCTTGGCTGCCGCTCTGCTTGCTGCGGCGGTGGCGTGGAGCAGAGTCTATCTCGGCTATCATTCTCCCGCT
CAGGTGCTTGTTGGCTGCGCCGCCGGTGCTGCCTGCGCTCTGGCTTGGTTTGCACTCACGGCCGCCCTGCGCTCA
AGTGGCTGGCTGCGCTGNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNGGATTTGTG
CCAGGCTGGCTGGGAAAAGTGGCAGCGCACACGGGCCCAGGCGCCGCCGCCTGA
Gene >OphauB2|5818
ATGGCCGTCCACGACACGCCCCTGGCCTCCCTATCGCTCACCCACGTCTACTATGTACGTCTTGCTCCTCCTCGC
ATCCCCCAAAACCTCTCATCGTATACACACGACTCACCCCCCCCCCCCCCCAGGATCCAAACGACTCCATCTCCC
TAATATGCGCATACCTCGCCCTCGTCCCCCAGGCCCTATGCATCGTCTACGCCACGCTTGTTCTCGCCTCGCGCG
AAGCCGAAGTAGTGCTCGCCCTCGTCGGCCAAGTTGCTTGCGAGGCGCTTAATCTCGCCCTCAAGCGCGCCATCA
AGCAGCGCCGTCCTCTGCGCTTCCACGACTGCGGCTACGGCATGCCCTCGTCACATGCCCAGTTTCTCGCCTTTT
GGGCCACGCAGCTTGCTCTCTTCCTTATGCTTCGCTACCAGCCGCGCCTGAGTGCCTGGTGGCATCGCGCCTTGA
CGAGCTTGGCTGCCGCTCTGCTTGCTGCGGCGGTGGCGTGGAGCAGAGTCTATCTCGGCTATCATTCTCCCGCTC
AGGTGCTTGTTGGCTGCGCCGCCGGTGCTGCCTGCGCTCTGGCTTGGTTTGCACTCACGGCCGCCCTGCGCTCAA
GTGGCTGGCTGCGCTGNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNGGATTTGTGC
CAGGCTGGCTGGGAAAAGTGGCAGCGCACACGGGCCCAGGCGCCGCCGCCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail