Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|5813
Gene name
LocationContig_49:4764..6129
Strand-
Gene length (bp)1365
Transcript length (bp)1044
Coding sequence length (bp)1044
Protein length (aa) 348

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00294 PfkB pfkB family carbohydrate kinase 4.5E-17 125 331

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q02974|KHK_RAT Ketohexokinase OS=Rattus norvegicus GN=Khk PE=1 SV=1 1 337 1.0E-26
sp|P50053|KHK_HUMAN Ketohexokinase OS=Homo sapiens GN=KHK PE=1 SV=2 1 337 4.0E-25
sp|Q5RD71|KHK_PONAB Ketohexokinase OS=Pongo abelii GN=KHK PE=3 SV=1 1 337 1.0E-24
sp|P97328|KHK_MOUSE Ketohexokinase OS=Mus musculus GN=Khk PE=1 SV=1 1 337 1.0E-24

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 20 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|5813
MATMHLVLVGACYLDTILSVPHFPAEDSKLRATSLSVRRGGNCPNTLEVLLQLLARHHGSERRVVPHLVSPLPRR
SSLATQRIIASFAGSNGFATGPATGSATGPATGPATGPANDGPNGLFQHCLYRDAHSEPASSYIIRSAESASRTI
VNYNALPDMTLPEFETVARSFGAADHDGWWHFEGRTPETTLACMHLLRNLLPAARISVEVEKPGRPGLEALAAEA
DVVFYSRAWAESRGHQSAGACLTAQKRRPGSLALCTWGADGAALLSDHCSLHCPVEQPAAVVDTVGAGDTFTAGI
LYALVCRASSWSLSRTLHFGVHLASLKVQREAFQGLAAALDDAAISM*
Coding >OphauB2|5813
ATGGCGACGATGCATCTCGTCCTTGTCGGCGCATGCTATCTCGACACCATTCTCAGCGTGCCTCACTTTCCTGCC
GAAGACTCCAAGTTGCGTGCCACCAGCCTCTCGGTGCGGCGCGGCGGCAACTGCCCCAACACGCTCGAGGTGCTG
CTTCAGCTTCTGGCCCGCCACCATGGCTCTGAGCGCCGTGTGGTGCCGCATCTAGTGTCGCCGCTGCCCCGACGG
TCCTCGTTGGCGACGCAGCGCATCATTGCGTCGTTTGCAGGTTCAAATGGCTTTGCAACTGGCCCTGCAACTGGC
TCTGCAACTGGCCCTGCAACGGGCCCTGCAACGGGCCCTGCAAACGACGGCCCCAATGGCCTCTTCCAGCACTGC
CTCTACCGCGATGCTCACTCGGAGCCAGCCAGCAGCTACATCATCCGCAGCGCCGAATCTGCCTCGCGCACCATT
GTCAACTACAATGCGCTACCCGACATGACGCTGCCCGAATTCGAGACGGTCGCTCGCAGCTTTGGCGCCGCAGAC
CATGATGGCTGGTGGCACTTTGAGGGCCGCACCCCCGAGACAACTCTGGCCTGCATGCATCTGTTGCGCAACCTG
CTGCCCGCCGCACGCATCAGTGTCGAGGTGGAGAAGCCCGGCCGCCCCGGGCTCGAAGCTCTGGCCGCCGAGGCC
GACGTCGTCTTTTATTCCCGCGCCTGGGCCGAGAGCCGCGGGCACCAGTCTGCCGGAGCATGTCTCACAGCCCAG
AAGCGCCGCCCAGGATCTCTTGCCTTGTGTACTTGGGGTGCAGATGGCGCCGCCCTCTTGTCTGACCACTGCTCG
CTGCATTGCCCCGTCGAGCAGCCAGCTGCCGTCGTCGATACGGTTGGCGCCGGAGACACCTTTACTGCTGGCATT
CTCTACGCGCTCGTCTGCCGCGCCTCATCATGGTCTCTATCCCGCACCCTGCACTTTGGCGTCCATCTGGCGTCC
CTCAAGGTCCAGCGCGAGGCCTTCCAAGGCCTGGCTGCTGCCTTGGACGATGCAGCCATCTCGATGTGA
Transcript >OphauB2|5813
ATGGCGACGATGCATCTCGTCCTTGTCGGCGCATGCTATCTCGACACCATTCTCAGCGTGCCTCACTTTCCTGCC
GAAGACTCCAAGTTGCGTGCCACCAGCCTCTCGGTGCGGCGCGGCGGCAACTGCCCCAACACGCTCGAGGTGCTG
CTTCAGCTTCTGGCCCGCCACCATGGCTCTGAGCGCCGTGTGGTGCCGCATCTAGTGTCGCCGCTGCCCCGACGG
TCCTCGTTGGCGACGCAGCGCATCATTGCGTCGTTTGCAGGTTCAAATGGCTTTGCAACTGGCCCTGCAACTGGC
TCTGCAACTGGCCCTGCAACGGGCCCTGCAACGGGCCCTGCAAACGACGGCCCCAATGGCCTCTTCCAGCACTGC
CTCTACCGCGATGCTCACTCGGAGCCAGCCAGCAGCTACATCATCCGCAGCGCCGAATCTGCCTCGCGCACCATT
GTCAACTACAATGCGCTACCCGACATGACGCTGCCCGAATTCGAGACGGTCGCTCGCAGCTTTGGCGCCGCAGAC
CATGATGGCTGGTGGCACTTTGAGGGCCGCACCCCCGAGACAACTCTGGCCTGCATGCATCTGTTGCGCAACCTG
CTGCCCGCCGCACGCATCAGTGTCGAGGTGGAGAAGCCCGGCCGCCCCGGGCTCGAAGCTCTGGCCGCCGAGGCC
GACGTCGTCTTTTATTCCCGCGCCTGGGCCGAGAGCCGCGGGCACCAGTCTGCCGGAGCATGTCTCACAGCCCAG
AAGCGCCGCCCAGGATCTCTTGCCTTGTGTACTTGGGGTGCAGATGGCGCCGCCCTCTTGTCTGACCACTGCTCG
CTGCATTGCCCCGTCGAGCAGCCAGCTGCCGTCGTCGATACGGTTGGCGCCGGAGACACCTTTACTGCTGGCATT
CTCTACGCGCTCGTCTGCCGCGCCTCATCATGGTCTCTATCCCGCACCCTGCACTTTGGCGTCCATCTGGCGTCC
CTCAAGGTCCAGCGCGAGGCCTTCCAAGGCCTGGCTGCTGCCTTGGACGATGCAGCCATCTCGATGTGA
Gene >OphauB2|5813
ATGGCGACGATGCATCTCGTCCTTGTCGGCGCATGCTATCTCGACACCATTCTCAGCGTGCCTCACTTTCCTGCC
GAAGACTCCAAGTTGCGTGCCACCAGCCTCTCGGTGCGGCGCGGCGGCAACTGCCCCAACACGCTCGAGGTGCTG
CTTCAGCTTCTGGCCCGCCACCATGGCTCTGAGCGCCGTGTGGTGCCGCATCTAGTGTCGCCGCTGCCCCGACGG
TCCTCGTTGGCGACGCAGCGCATCATTGCGTCGTTTGCAGGTTCAAATGGCTTTGCAACTGGCCCTGCAACTGGC
TCTGCAACTGGCCCTGCAACGGGCCCTGCAACGGGCCCTGCAAACGACGGCCCCAATGGCCTCTTCCAGCACTGC
CTCTACCGCGATGCTCACTCGGAGCCAGCCAGCAGCTACATCATCCGCAGCGCCGAATCTGCCTCGCGCACCATT
GTCAACTACAATGCGCTACCCGACATGACGCTGCCCGAATTCGAGACGGTCGCTCGCAGCTTTGGCGCCGCAGAC
CATGATGGCTGGTGGCACTTTGAGGTATGTCTCTCTGCAGCTCACACAGCCGGCCTGCTGCTCACTTTTCTTCTT
CTTGGCTGCTGCGCAACCAGGGCCGCACCCCCGAGACAACTCTGGCCTGCATGCATCTGTTGCGCAACCTGCTGC
CCGCCGCACGCATCAGTGTCGAGGTGGAGAAGCCCGGCCGCCCCGGGCTCGAAGCTCTGGCCGCCGAGGCCGACG
TCGTCTTTTATTCCCGCGCCTGGGCCGAGGTGAGGACGCGCTGTCCATCTACATACATTCATCCATGCCTGTTCT
GGCGCTCAGACGGATGCAGAGCCGCGGGCACCAGTCTGCCGGAGCATGTCTCACAGCCCAGAAGCGCCGCCCAGG
GTAATAATCCCCACGCCCTCTCCCCCTCTCCCCCTCCCCTCCTCCTCCCCTCCTCCCCTCTCGACTCCCCGGCGC
CGATTCGCTGACGGCAAAGATCTCTTGCCTTGTGTACTTGGGGTGCAGATGGCGCCGCCCTCTTGTCTGACCACT
GCTCGCTGCATTGCCCCGTCGAGCAGCCAGCTGCCGTCGTCGAGTGTGTTTCCCCCCTCTCGTGTCATGCCTTGC
TTTTCTTTTCCCTTGGCCGGCCTGCTGACGCTGCTGCTGGGGTGGGGGGCGTGAACAAGTACGGTTGGCGCCGGA
GACACCTTTACTGCTGGCATTCTCTACGCGCTCGTCTGCCGCGCCTCATCATGGTCTCTATCCCGCACCCTGCAC
TTTGGCGTCCATCTGGCGTCCCTCAAGGTCCAGCGCGAGGCCTTCCAAGGCCTGGCTGCTGCCTTGGACGATGCA
GCCATCTCGATGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail