Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|5811
Gene name
LocationContig_487:1093..1642
Strand-
Gene length (bp)549
Transcript length (bp)405
Coding sequence length (bp)405
Protein length (aa) 135

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF16211 Histone_H2A_C C-terminus of histone H2A 4.0E-21 94 128
PF00125 Histone Core histone H2A/H2B/H3/H4 5.6E-15 14 91
PF00808 CBFD_NFYB_HMF Histone-like transcription factor (CBF/NF-Y) and archaeal histone 2.9E-05 28 90

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q8X132|H2A_NEUCR Histone H2A OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=hh2a PE=3 SV=3 1 134 8.0E-89
sp|Q2HH37|H2A_CHAGB Histone H2A OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=HTA1 PE=3 SV=2 16 134 2.0E-77
sp|A1D8G8|H2A_NEOFI Histone H2A OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=hta1 PE=3 SV=1 16 134 4.0E-77
sp|Q2U5A8|H2A_ASPOR Histone H2A OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=hta1 PE=3 SV=3 16 134 4.0E-77
sp|Q4WWC6|H2A_ASPFU Histone H2A OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=hta1 PE=3 SV=3 16 134 4.0E-77
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q8X132|H2A_NEUCR Histone H2A OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=hh2a PE=3 SV=3 1 134 8.0E-89
sp|Q2HH37|H2A_CHAGB Histone H2A OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=HTA1 PE=3 SV=2 16 134 2.0E-77
sp|A1D8G8|H2A_NEOFI Histone H2A OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=hta1 PE=3 SV=1 16 134 4.0E-77
sp|Q2U5A8|H2A_ASPOR Histone H2A OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=hta1 PE=3 SV=3 16 134 4.0E-77
sp|Q4WWC6|H2A_ASPFU Histone H2A OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=hta1 PE=3 SV=3 16 134 4.0E-77
sp|A1CJ10|H2A_ASPCL Histone H2A OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=hta1 PE=3 SV=1 16 134 4.0E-77
sp|Q4HTT1|H2A_GIBZE Histone H2A OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=HTA1 PE=3 SV=3 16 134 5.0E-77
sp|O74268|H2A_BOTFB Histone H2A OS=Botryotinia fuckeliana (strain B05.10) GN=hta1 PE=3 SV=4 1 134 2.0E-76
sp|Q875B8|H2A_PODAS Histone H2A OS=Podospora anserina GN=HTA1 PE=3 SV=3 16 134 4.0E-76
sp|L7HZV6|H2A_MAGOY Histone H2A OS=Magnaporthe oryzae (strain Y34) GN=HTA1 PE=2 SV=1 16 134 6.0E-76
sp|P0CT12|H2A_MAGO7 Histone H2A OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=HTA1 PE=3 SV=1 16 134 6.0E-76
sp|P08844|H2A_EMENI Histone H2A OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=htaA PE=3 SV=2 16 134 6.0E-76
sp|P04909|H2A1_SCHPO Histone H2A-alpha OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=hta1 PE=1 SV=3 4 134 3.0E-75
sp|P0C952|H2A_ASPNG Histone H2A OS=Aspergillus niger GN=httA PE=2 SV=1 16 134 3.0E-75
sp|P0C953|H2A_ASPNC Histone H2A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=httA PE=3 SV=1 16 134 3.0E-75
sp|P04910|H2A2_SCHPO Histone H2A-beta OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=hta2 PE=1 SV=2 4 134 4.0E-74
sp|Q0CBD2|H2A_ASPTN Histone H2A OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=hta1 PE=3 SV=1 16 134 2.0E-73
sp|A3LZZ0|H2A1_PICST Histone H2A.1 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=HTA2 PE=3 SV=1 1 134 1.0E-72
sp|Q757L4|H2A2_ASHGO Histone H2A.2 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=HTA2 PE=3 SV=3 5 134 2.0E-71
sp|Q6CK59|H2A_KLULA Histone H2A OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=HTA1 PE=3 SV=3 5 134 2.0E-71
sp|Q59SU5|H2A1_CANAL Histone H2A.1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=HTA1 PE=3 SV=3 1 134 2.0E-71
sp|Q74ZL4|H2A1_ASHGO Histone H2A.1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=HTA1 PE=3 SV=3 5 134 4.0E-71
sp|A5DJJ2|H2A2_PICGU Histone H2A.2 OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=HTA2 PE=3 SV=1 1 134 1.0E-70
sp|Q6BKW8|H2A1_DEBHA Histone H2A.1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=HTA1 PE=3 SV=3 1 134 2.0E-70
sp|Q0U1A1|H2A_PHANO Histone H2A OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=HTA1 PE=3 SV=1 25 134 2.0E-70
sp|Q6BRG3|H2A2_DEBHA Histone H2A.2 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=HTA2 PE=3 SV=3 1 134 4.0E-70
sp|A3LXE7|H2A2_PICST Histone H2A.2 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=HTA2 PE=3 SV=1 1 134 5.0E-70
sp|A5DWF1|H2A1_LODEL Histone H2A.1 OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=HTA1 PE=3 SV=1 1 134 1.0E-69
sp|Q1E5N1|H2A_COCIM Histone H2A OS=Coccidioides immitis (strain RS) GN=HTA1 PE=3 SV=1 23 134 1.0E-69
sp|P04911|H2A1_YEAST Histone H2A.1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HTA1 PE=1 SV=2 18 134 3.0E-69
sp|A5DBG4|H2A1_PICGU Histone H2A.1 OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=HTA1 PE=3 SV=1 1 134 5.0E-69
sp|P04912|H2A2_YEAST Histone H2A.2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HTA2 PE=1 SV=2 18 134 7.0E-69
sp|Q6C4I6|H2A_YARLI Histone H2A OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=HTA1 PE=3 SV=3 1 134 1.0E-68
sp|Q6FM31|H2A2_CANGA Histone H2A.2 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=HTA2 PE=3 SV=3 13 134 1.0E-67
sp|P02264|H2A_ONCMY Histone H2A OS=Oncorhynchus mykiss PE=1 SV=2 1 128 1.0E-67
sp|A5DXS8|H2A2_LODEL Histone H2A.2 OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=HTA2 PE=3 SV=1 1 126 2.0E-67
sp|P13912|H2A_CAIMO Histone H2A OS=Cairina moschata PE=3 SV=2 1 123 3.0E-67
sp|P02263|H2A4_CHICK Histone H2A-IV OS=Gallus gallus PE=1 SV=2 1 123 3.0E-67
sp|Q64523|H2A2C_MOUSE Histone H2A type 2-C OS=Mus musculus GN=Hist2h2ac PE=1 SV=3 1 123 4.0E-67
sp|Q16777|H2A2C_HUMAN Histone H2A type 2-C OS=Homo sapiens GN=HIST2H2AC PE=1 SV=4 1 123 4.0E-67
sp|A1A4R1|H2A2C_BOVIN Histone H2A type 2-C OS=Bos taurus GN=HIST2H2AC PE=2 SV=1 1 123 4.0E-67
sp|Q7ZUY3|H2AX_DANRE Histone H2AX OS=Danio rerio GN=h2afx PE=2 SV=3 1 125 4.0E-67
sp|A9UMV8|H2AJ_RAT Histone H2A.J OS=Rattus norvegicus GN=H2afj PE=2 SV=1 1 123 4.0E-67
sp|Q8R1M2|H2AJ_MOUSE Histone H2A.J OS=Mus musculus GN=H2afj PE=1 SV=1 1 123 4.0E-67
sp|Q9BTM1|H2AJ_HUMAN Histone H2A.J OS=Homo sapiens GN=H2AFJ PE=1 SV=1 1 123 5.0E-67
sp|Q3ZBX9|H2AJ_BOVIN Histone H2A.J OS=Bos taurus GN=H2AFJ PE=2 SV=1 1 123 5.0E-67
sp|Q4R3X5|H2AJ_MACFA Histone H2A.J OS=Macaca fascicularis GN=H2AFJ PE=2 SV=1 1 123 5.0E-67
sp|P0C169|H2A1C_RAT Histone H2A type 1-C OS=Rattus norvegicus PE=1 SV=2 1 123 6.0E-67
sp|Q93077|H2A1C_HUMAN Histone H2A type 1-C OS=Homo sapiens GN=HIST1H2AC PE=1 SV=3 1 123 6.0E-67
sp|P16886|H2AL_STRPU Late histone H2A.L3 OS=Strongylocentrotus purpuratus PE=1 SV=2 1 128 7.0E-67
sp|P02262|H2A1_RAT Histone H2A type 1 OS=Rattus norvegicus PE=1 SV=2 1 123 7.0E-67
sp|Q6FWM7|H2A1_CANGA Histone H2A.1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=HTA1 PE=3 SV=3 18 134 7.0E-67
sp|P0CC09|H2A2A_RAT Histone H2A type 2-A OS=Rattus norvegicus GN=Hist2h2aa3 PE=1 SV=1 1 123 8.0E-67
sp|Q6GSS7|H2A2A_MOUSE Histone H2A type 2-A OS=Mus musculus GN=Hist2h2aa1 PE=1 SV=3 1 123 8.0E-67
sp|Q6FI13|H2A2A_HUMAN Histone H2A type 2-A OS=Homo sapiens GN=HIST2H2AA3 PE=1 SV=3 1 123 8.0E-67
sp|Q99878|H2A1J_HUMAN Histone H2A type 1-J OS=Homo sapiens GN=HIST1H2AJ PE=1 SV=3 1 123 9.0E-67
sp|Q96KK5|H2A1H_HUMAN Histone H2A type 1-H OS=Homo sapiens GN=HIST1H2AH PE=1 SV=3 1 123 1.0E-66
sp|P0C170|H2A1E_RAT Histone H2A type 1-E OS=Rattus norvegicus PE=1 SV=2 1 123 1.0E-66
sp|Q4FZT6|H2A3_RAT Histone H2A type 3 OS=Rattus norvegicus PE=2 SV=3 1 123 1.0E-66
sp|Q8BFU2|H2A3_MOUSE Histone H2A type 3 OS=Mus musculus GN=Hist3h2a PE=1 SV=3 1 123 1.0E-66
sp|Q7L7L0|H2A3_HUMAN Histone H2A type 3 OS=Homo sapiens GN=HIST3H2A PE=1 SV=3 1 123 1.0E-66
sp|P0C0S8|H2A1_HUMAN Histone H2A type 1 OS=Homo sapiens GN=HIST1H2AG PE=1 SV=2 1 123 1.0E-66
sp|P0C0S9|H2A1_BOVIN Histone H2A type 1 OS=Bos taurus PE=1 SV=2 1 123 1.0E-66
sp|P70082|H2AJ_CHICK Histone H2A.J OS=Gallus gallus GN=H2A-IX PE=3 SV=1 1 123 1.0E-66
sp|P06897|H2A1_XENLA Histone H2A type 1 OS=Xenopus laevis PE=1 SV=2 1 132 2.0E-66
sp|Q8CGP6|H2A1H_MOUSE Histone H2A type 1-H OS=Mus musculus GN=Hist1h2ah PE=1 SV=3 1 123 2.0E-66
sp|P35062|H2A3_CHICK Histone H2A-III OS=Gallus gallus PE=1 SV=2 1 123 2.0E-66
sp|Q8CGP7|H2A1K_MOUSE Histone H2A type 1-K OS=Mus musculus GN=Hist1h2ak PE=1 SV=3 1 123 3.0E-66
sp|P22752|H2A1_MOUSE Histone H2A type 1 OS=Mus musculus GN=Hist1h2ab PE=1 SV=3 1 123 3.0E-66
sp|P04908|H2A1B_HUMAN Histone H2A type 1-B/E OS=Homo sapiens GN=HIST1H2AB PE=1 SV=2 1 123 3.0E-66
sp|P16104|H2AX_HUMAN Histone H2AX OS=Homo sapiens GN=H2AFX PE=1 SV=2 1 133 3.0E-66
sp|P20671|H2A1D_HUMAN Histone H2A type 1-D OS=Homo sapiens GN=HIST1H2AD PE=1 SV=2 1 123 3.0E-66
sp|Q8IUE6|H2A2B_HUMAN Histone H2A type 2-B OS=Homo sapiens GN=HIST2H2AB PE=1 SV=3 1 123 4.0E-66
sp|Q8CGP5|H2A1F_MOUSE Histone H2A type 1-F OS=Mus musculus GN=Hist1h2af PE=1 SV=3 1 123 4.0E-66
sp|Q64522|H2A2B_MOUSE Histone H2A type 2-B OS=Mus musculus GN=Hist2h2ab PE=1 SV=3 1 123 5.0E-66
sp|P27661|H2AX_MOUSE Histone H2AX OS=Mus musculus GN=H2afx PE=1 SV=2 1 133 9.0E-66
sp|Q64598|H2A1F_RAT Histone H2A type 1-F OS=Rattus norvegicus PE=3 SV=3 1 123 2.0E-65
sp|Q96QV6|H2A1A_HUMAN Histone H2A type 1-A OS=Homo sapiens GN=HIST1H2AA PE=1 SV=3 1 123 2.0E-65
sp|Q4PEF9|H2A_USTMA Histone H2A OS=Ustilago maydis (strain 521 / FGSC 9021) GN=HTA1 PE=3 SV=3 12 134 8.0E-65
sp|P02269|H2A_ASTRU Histone H2A OS=Asterias rubens PE=1 SV=2 1 128 8.0E-65
sp|Q59VP2|H2A2_CANAL Histone H2A.2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=HTA2 PE=3 SV=3 1 120 9.0E-65
sp|P13630|H2A_PARLI Histone H2A OS=Paracentrotus lividus PE=3 SV=2 1 126 2.0E-64
sp|P04735|H2A1_PSAMI Late histone H2A.1 OS=Psammechinus miliaris PE=2 SV=2 1 128 2.0E-64
sp|Q00728|H2A4_RAT Histone H2A type 4 OS=Rattus norvegicus PE=2 SV=2 1 123 2.0E-64
sp|P35061|H2A_ACRFO Histone H2A OS=Acropora formosa PE=3 SV=2 1 125 3.0E-64
sp|P09589|H2A3_LYTPI Histone H2A, sperm (Fragment) OS=Lytechinus pictus PE=2 SV=1 17 128 8.0E-64
sp|P69141|H2A_STRPU Histone H2A, embryonic OS=Strongylocentrotus purpuratus PE=1 SV=2 1 126 2.0E-63
sp|P69142|H2AE_PSAMI Histone H2A, embryonic OS=Psammechinus miliaris PE=3 SV=2 1 126 2.0E-63
sp|Q6GM86|H2AX_XENLA Histone H2AX OS=Xenopus laevis GN=h2afx PE=1 SV=3 1 133 3.0E-63
sp|P02268|H2A_SEPOF Histone H2A OS=Sepia officinalis PE=1 SV=2 19 128 5.0E-63
sp|P69140|H2A_PARAN Histone H2A, gonadal OS=Parechinus angulosus PE=1 SV=2 19 124 6.0E-63
sp|P69139|H2A3_PSAMI Late histone H2A.3, gonadal OS=Psammechinus miliaris PE=1 SV=2 19 124 6.0E-63
sp|P19178|H2A_PLADU Histone H2A OS=Platynereis dumerilii PE=3 SV=2 19 126 2.0E-62
sp|Q9C681|H2A1_ARATH Probable histone H2A.1 OS=Arabidopsis thaliana GN=At1g51060 PE=1 SV=1 1 133 2.0E-62
sp|P84057|H2A_TIGCA Histone H2A OS=Tigriopus californicus GN=His2A PE=3 SV=2 19 125 2.0E-61
sp|P84056|H2A_RHYAM Histone H2A OS=Rhynchosciara americana GN=His2A PE=3 SV=2 19 125 2.0E-61
sp|P84055|H2A_DROYA Histone H2A OS=Drosophila yakuba GN=His2A PE=2 SV=2 19 125 2.0E-61
sp|P84054|H2A_DROSI Histone H2A OS=Drosophila simulans GN=His2A PE=3 SV=2 19 125 2.0E-61
sp|P84051|H2A_DROME Histone H2A OS=Drosophila melanogaster GN=His2A PE=1 SV=2 19 125 2.0E-61
sp|P84053|H2A_DROHY Histone H2A OS=Drosophila hydei GN=His2A PE=3 SV=2 19 125 2.0E-61
sp|P84052|H2A_DROER Histone H2A OS=Drosophila erecta GN=His2A PE=3 SV=2 19 125 2.0E-61
sp|P02270|H2A_SIPNU Histone H2A OS=Sipunculus nudus PE=1 SV=2 20 126 3.0E-61
sp|Q9HGX4|H2A_AGABI Histone H2A OS=Agaricus bisporus PE=2 SV=3 17 134 3.0E-61
sp|Q6PV61|H2A_LITVA Histone H2A OS=Litopenaeus vannamei PE=1 SV=3 20 125 6.0E-61
sp|P09588|H2A_CAEEL Histone H2A OS=Caenorhabditis elegans GN=his-3 PE=1 SV=2 19 124 6.0E-61
sp|P21896|H2A_CHITH Histone H2A OS=Chironomus thummi thummi PE=3 SV=2 19 123 6.0E-61
sp|Q9LD28|H2A6_ARATH Histone H2A.6 OS=Arabidopsis thaliana GN=RAT5 PE=1 SV=1 1 124 8.0E-61
sp|P27325|H2A_URECA Histone H2A OS=Urechis caupo PE=3 SV=2 20 128 1.0E-60
sp|O65759|H2AX_CICAR Histone H2AX OS=Cicer arietinum GN=HIS2A PE=2 SV=1 2 134 1.0E-60
sp|O04848|H2AXA_ARATH Probable histone H2AXa OS=Arabidopsis thaliana GN=At1g08880 PE=1 SV=1 2 134 3.0E-60
sp|P35063|H2AX_PICAB Histone H2AX OS=Picea abies PE=2 SV=1 1 134 5.0E-60
sp|Q9S9K7|H2AXB_ARATH Probable histone H2AXb OS=Arabidopsis thaliana GN=At1g54690 PE=1 SV=1 2 134 5.0E-60
sp|Q07135|H2AO_CHITH Histone H2A, orphon OS=Chironomus thummi thummi PE=3 SV=2 19 123 5.0E-60
sp|Q9LHQ5|H2A2_ARATH Probable histone H2A.2 OS=Arabidopsis thaliana GN=At3g20670 PE=1 SV=1 1 133 5.0E-60
sp|P50567|H2A_CHLRE Histone H2A OS=Chlamydomonas reinhardtii GN=H2A-II PE=3 SV=1 1 129 8.0E-60
sp|Q43312|H2A7_WHEAT Protein H2A.7 OS=Triticum aestivum GN=H2A-4 PE=2 SV=3 1 124 1.0E-59
sp|O81826|H2A3_ARATH Probable histone H2A.3 OS=Arabidopsis thaliana GN=At4g27230 PE=1 SV=1 1 126 2.0E-59
sp|P0CN98|H2A_CRYNJ Histone H2A OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=HTA1 PE=3 SV=1 1 134 2.0E-59
sp|P0CN99|H2A_CRYNB Histone H2A OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=HTA1 PE=3 SV=1 1 134 2.0E-59
sp|P16866|H2A4_VOLCA Histone H2A-IV OS=Volvox carteri PE=3 SV=1 1 129 4.0E-59
sp|Q6WV88|H2A_MYTGA Histone H2A OS=Mytilus galloprovincialis PE=3 SV=3 25 128 6.0E-59
sp|Q8I0T3|H2A_MYTED Histone H2A OS=Mytilus edulis PE=3 SV=3 25 128 6.0E-59
sp|Q6WV69|H2A_MYTCH Histone H2A OS=Mytilus chilensis PE=3 SV=3 25 128 6.0E-59
sp|Q6WV66|H2A_MYTCA Histone H2A OS=Mytilus californianus PE=3 SV=3 25 128 6.0E-59
sp|P16865|H2A3_VOLCA Histone H2A-III OS=Volvox carteri PE=3 SV=1 1 129 1.0E-58
sp|Q6ZL43|H2A1_ORYSJ Probable histone H2A.1 OS=Oryza sativa subsp. japonica GN=Os07g0545300 PE=2 SV=1 19 126 3.0E-58
sp|A2YMC5|H2A1_ORYSI Probable histone H2A.1 OS=Oryza sativa subsp. indica GN=OsI_26380 PE=3 SV=2 19 126 3.0E-58
sp|Q84NJ4|H2A3_ORYSJ Probable histone H2A.3 OS=Oryza sativa subsp. japonica GN=Os08g0427700 PE=3 SV=1 1 120 3.0E-58
sp|A2YVE5|H2A3_ORYSI Probable histone H2A.3 OS=Oryza sativa subsp. indica GN=OsI_028288 PE=3 SV=1 1 120 3.0E-58
sp|Q2QS71|H2A7_ORYSJ Probable histone H2A.7 OS=Oryza sativa subsp. japonica GN=Os12g0438000 PE=2 SV=1 19 126 4.0E-58
sp|A2ZK29|H2A7_ORYSI Probable histone H2A.7 OS=Oryza sativa subsp. indica GN=OsI_036922 PE=3 SV=1 19 126 4.0E-58
sp|Q6WV67|H2A_MYTTR Histone H2A OS=Mytilus trossulus PE=3 SV=3 25 128 5.0E-58
sp|Q43208|H2A4_WHEAT Histone H2A.4 OS=Triticum aestivum GN=TH254 PE=2 SV=3 19 122 2.0E-57
sp|Q6ZL42|H2A2_ORYSJ Probable histone H2A.2 OS=Oryza sativa subsp. japonica GN=Os07g0545400 PE=2 SV=1 1 120 2.0E-57
sp|A2YMC6|H2A2_ORYSI Probable histone H2A.2 OS=Oryza sativa subsp. indica GN=OsI_025469 PE=3 SV=1 1 120 2.0E-57
sp|P04736|H2A2_PSAMI Late histone H2A.2.1 OS=Psammechinus miliaris PE=2 SV=2 25 126 2.0E-57
sp|Q2QPG9|H2AXB_ORYSJ Probable histone H2AXb OS=Oryza sativa subsp. japonica GN=Os12g0530000 PE=2 SV=1 19 134 2.0E-57
sp|A2ZL69|H2AXB_ORYSI Probable histone H2AXb OS=Oryza sativa subsp. indica GN=OsI_037312 PE=3 SV=1 19 134 2.0E-57
sp|A2ZK26|H2A8_ORYSI Probable histone H2A.8 OS=Oryza sativa subsp. indica GN=OsI_036919 PE=3 SV=1 19 126 2.0E-57
sp|P07793|H2A4_PSAMI Late histone H2A.2.2 OS=Psammechinus miliaris PE=3 SV=2 25 122 7.0E-56
sp|P40280|H2A_MAIZE Histone H2A OS=Zea mays PE=2 SV=1 15 133 3.0E-55
sp|P40282|H2A_PLAFA Histone H2A OS=Plasmodium falciparum PE=2 SV=1 1 123 5.0E-55
sp|Q8LLP5|H2AXA_ORYSJ Probable histone H2AXa OS=Oryza sativa subsp. japonica GN=Os03g0721900 PE=3 SV=1 14 134 3.0E-54
sp|A2XLI0|H2AXA_ORYSI Probable histone H2AXa OS=Oryza sativa subsp. indica GN=OsI_012923 PE=3 SV=1 14 134 3.0E-54
sp|Q75L11|H2A6_ORYSJ Probable histone H2A.6 OS=Oryza sativa subsp. japonica GN=Os05g0113900 PE=2 SV=2 4 123 8.0E-54
sp|A2XZN0|H2A6_ORYSI Probable histone H2A.6 OS=Oryza sativa subsp. indica GN=OsI_017523 PE=3 SV=2 4 123 8.0E-54
sp|P19177|H2A_PETCR Histone H2A OS=Petroselinum crispum PE=2 SV=1 15 125 1.0E-53
sp|Q6L500|H2A4_ORYSJ Probable histone H2A.4 OS=Oryza sativa subsp. japonica GN=Os05g0461400 PE=2 SV=1 19 133 2.0E-53
sp|A2Y5G8|H2A4_ORYSI Probable histone H2A.4 OS=Oryza sativa subsp. indica GN=OsI_019561 PE=3 SV=1 19 133 2.0E-53
sp|P02274|H2A1_TETPY Histone H2A.1 OS=Tetrahymena pyriformis GN=HTA2 PE=1 SV=2 19 129 3.0E-53
sp|Q1S053|H2A3_MEDTR Probable histone H2A.3 OS=Medicago truncatula PE=3 SV=1 19 132 3.0E-53
sp|P35065|H2A1_TETTS Histone H2A.1 OS=Tetrahymena thermophila (strain SB210) GN=HTA2 PE=1 SV=2 19 126 4.0E-53
sp|P25469|H2A1_SOLLC Histone H2A.1 OS=Solanum lycopersicum PE=2 SV=1 4 126 5.0E-53
sp|P35064|H2AX_TETTS Histone H2AX OS=Tetrahymena thermophila (strain SB210) GN=HTA1 PE=1 SV=2 19 134 5.0E-53
sp|P02275|H2A1_WHEAT Histone H2A.1 OS=Triticum aestivum GN=H2A-9 PE=1 SV=2 7 123 6.0E-53
sp|Q2HU68|H2A1_MEDTR Probable histone H2A.1 OS=Medicago truncatula GN=MtrDRAFT_AC149210g1v1 PE=3 SV=1 15 127 6.0E-53
sp|Q9FJE8|H2A7_ARATH Probable histone H2A.7 OS=Arabidopsis thaliana GN=At5g59870 PE=1 SV=1 19 123 7.0E-53
sp|Q43213|H2A5_WHEAT Protein H2A.5 OS=Triticum aestivum GN=H2A-2 PE=2 SV=3 7 123 7.0E-53
sp|P02273|H2AX_TETPY Histone H2AX OS=Tetrahymena pyriformis GN=HTA1 PE=1 SV=2 19 134 2.0E-52
sp|Q43214|H2A6_WHEAT Protein H2A.6 OS=Triticum aestivum GN=H2A-3 PE=2 SV=3 5 133 6.0E-52
sp|Q2HU65|H2A2_MEDTR Probable histone H2A.2 OS=Medicago truncatula GN=MtrDRAFT_AC149210g4v1 PE=3 SV=1 19 126 9.0E-52
sp|Q9LZ46|H2A4_ARATH Probable histone H2A.4 OS=Arabidopsis thaliana GN=At5g02560 PE=1 SV=1 15 126 4.0E-51
sp|Q94E96|H2A5_ORYSJ Probable histone H2A.5 OS=Oryza sativa subsp. japonica GN=Os01g0502700 PE=2 SV=1 15 120 6.0E-51
sp|A2WQG7|H2A5_ORYSI Probable histone H2A.5 OS=Oryza sativa subsp. indica GN=OsI_002060 PE=3 SV=1 15 120 6.0E-51
sp|P40281|H2A2_PEA Histone H2A.2 OS=Pisum sativum PE=2 SV=1 17 127 1.0E-50
sp|P25470|H2A1_PEA Histone H2A.1 OS=Pisum sativum PE=2 SV=1 19 122 3.0E-50
sp|Q94F49|H2A5_ARATH Probable histone H2A.5 OS=Arabidopsis thaliana GN=At5g27670 PE=1 SV=1 4 123 3.0E-50
sp|Q9M531|H2A_EUPES Histone H2A OS=Euphorbia esula PE=2 SV=1 15 119 4.0E-50
sp|P02277|H2A3_WHEAT Histone H2A.2.2 OS=Triticum aestivum PE=1 SV=1 15 120 1.0E-49
sp|P02276|H2A2_WHEAT Histone H2A.2.1 OS=Triticum aestivum PE=1 SV=1 15 120 4.0E-49
sp|P09590|H2A3_STRPU Histone H2A-beta, sperm (Fragment) OS=Strongylocentrotus purpuratus PE=1 SV=1 17 99 3.0E-48
sp|P40279|H2A_EUGGR Histone H2A OS=Euglena gracilis PE=2 SV=1 20 122 4.0E-48
sp|P06898|H2A2_XENLA Histone H2A type 2 OS=Xenopus laevis PE=3 SV=3 1 123 2.0E-46
sp|O75367|H2AY_HUMAN Core histone macro-H2A.1 OS=Homo sapiens GN=H2AFY PE=1 SV=4 8 128 4.0E-46
sp|Q02874|H2AY_RAT Core histone macro-H2A.1 OS=Rattus norvegicus GN=H2afy PE=1 SV=4 8 128 5.0E-46
sp|O93327|H2AY_CHICK Core histone macro-H2A.1 OS=Gallus gallus GN=H2AFY PE=1 SV=3 8 128 5.0E-46
sp|Q9QZQ8|H2AY_MOUSE Core histone macro-H2A.1 OS=Mus musculus GN=H2afy PE=1 SV=3 8 128 6.0E-46
sp|Q8CCK0|H2AW_MOUSE Core histone macro-H2A.2 OS=Mus musculus GN=H2afy2 PE=1 SV=3 19 131 2.0E-45
sp|Q9P0M6|H2AW_HUMAN Core histone macro-H2A.2 OS=Homo sapiens GN=H2AFY2 PE=1 SV=3 19 131 2.0E-45
sp|Q6CUC8|H2AZ_KLULA Histone H2A.Z OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=HTZ1 PE=3 SV=3 3 121 2.0E-39
sp|Q5BJ65|H2AV_XENTR Histone H2A.V OS=Xenopus tropicalis GN=h2afv PE=2 SV=3 1 122 2.0E-38
sp|Q6GM74|H2AV_XENLA Histone H2A.V OS=Xenopus laevis GN=h2afv PE=2 SV=3 1 122 2.0E-38
sp|Q6Y237|H2AV_PAGMA Histone H2A.V OS=Pagrus major GN=h2afv PE=2 SV=3 1 122 2.0E-38
sp|Q3THW5|H2AV_MOUSE Histone H2A.V OS=Mus musculus GN=H2afv PE=1 SV=3 1 122 2.0E-38
sp|Q71UI9|H2AV_HUMAN Histone H2A.V OS=Homo sapiens GN=H2AFV PE=1 SV=3 1 122 2.0E-38
sp|Q71PD7|H2AV_DANRE Histone H2A.V OS=Danio rerio GN=h2afv PE=2 SV=3 1 122 2.0E-38
sp|P02272|H2AV_CHICK Histone H2A.V OS=Gallus gallus GN=H2AFV PE=1 SV=2 1 122 2.0E-38
sp|Q32LA7|H2AV_BOVIN Histone H2A.V OS=Bos taurus GN=H2AFV PE=2 SV=3 1 122 2.0E-38
sp|Q6YNC8|H2AZ_SHEEP Histone H2A.Z OS=Ovis aries GN=H2AFZ PE=2 SV=3 1 122 3.0E-38
sp|P0C0S7|H2AZ_RAT Histone H2A.Z OS=Rattus norvegicus GN=H2afz PE=1 SV=2 1 122 3.0E-38
sp|Q5RC42|H2AZ_PONAB Histone H2A.Z OS=Pongo abelii GN=H2AFZ PE=2 SV=3 1 122 3.0E-38
sp|P22647|H2AZ_ONCMY Histone H2A.Z OS=Oncorhynchus mykiss GN=h2afz PE=1 SV=4 1 122 3.0E-38
sp|P0C0S6|H2AZ_MOUSE Histone H2A.Z OS=Mus musculus GN=H2afz PE=1 SV=2 1 122 3.0E-38
sp|P0C0S5|H2AZ_HUMAN Histone H2A.Z OS=Homo sapiens GN=H2AFZ PE=1 SV=2 1 122 3.0E-38
sp|P0C0S4|H2AZ_BOVIN Histone H2A.Z OS=Bos taurus GN=H2AFZ PE=1 SV=2 1 122 3.0E-38
sp|Q6DER6|H2AZL_XENTR Histone H2A.Z-like OS=Xenopus tropicalis GN=h2a.zl PE=2 SV=3 1 122 3.0E-38
sp|P70094|H2AZL_XENLA Histone H2A.Z-like OS=Xenopus laevis GN=h2a.zl1 PE=2 SV=3 1 122 3.0E-38
sp|Q5ZMD6|H2AZ_CHICK Histone H2A.Z OS=Gallus gallus GN=H2AFZ PE=1 SV=3 4 122 4.0E-38
sp|P08985|H2AV_DROME Histone H2A.v OS=Drosophila melanogaster GN=His2Av PE=1 SV=2 1 122 4.0E-38
sp|P08991|H2AV_STRPU Histone H2A.V (Fragment) OS=Strongylocentrotus purpuratus GN=H2A.F/Z PE=1 SV=1 5 122 6.0E-38
sp|Q75CC6|H2AZ_ASHGO Histone H2A.Z OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=HTZ1 PE=3 SV=3 3 121 1.0E-37
sp|O62695|H2AV_RABIT Histone H2A.V OS=Oryctolagus cuniculus GN=H2AFV PE=2 SV=3 1 122 1.0E-37
sp|Q9C944|H2AV3_ARATH Probable histone H2A variant 3 OS=Arabidopsis thaliana GN=At1g52740 PE=1 SV=1 1 121 1.0E-37
sp|Q27511|H2AV_CAEEL Histone H2A.V OS=Caenorhabditis elegans GN=htz-1 PE=2 SV=3 1 122 1.0E-37
sp|Q84MP7|H2AV3_ORYSJ Probable histone H2A variant 3 OS=Oryza sativa subsp. japonica GN=Os03g0743400 PE=2 SV=1 10 123 6.0E-37
sp|P0CO00|H2AZ_CRYNJ Histone H2A.Z OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=HTZ1 PE=3 SV=1 14 121 7.0E-37
sp|P0CO01|H2AZ_CRYNB Histone H2A.Z OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=HTZ1 PE=3 SV=1 14 121 7.0E-37
sp|Q54WG6|H2AX_DICDI Histone H2AX OS=Dictyostelium discoideum GN=H2AX PE=1 SV=1 18 117 8.0E-37
sp|Q9SII0|H2AV2_ARATH Probable histone H2A variant 2 OS=Arabidopsis thaliana GN=At2g38810 PE=2 SV=1 10 123 2.0E-36
sp|Q6C341|H2AZ_YARLI Histone H2A.Z OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=HTZ1 PE=3 SV=1 18 121 9.0E-36
sp|Q2GUP0|H2AZ_CHAGB Histone H2A.Z OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=HTZ1 PE=3 SV=1 12 121 9.0E-36
sp|Q8H7Y8|H2AV1_ORYSJ Probable histone H2A variant 1 OS=Oryza sativa subsp. japonica GN=Os03g0162200 PE=2 SV=1 19 123 2.0E-35
sp|Q873G4|H2AZ_NEUCR Histone H2A.Z OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=hH2Az PE=3 SV=1 12 133 3.0E-35
sp|O23628|H2AV1_ARATH Histone H2A variant 1 OS=Arabidopsis thaliana GN=H2AV PE=1 SV=1 19 123 3.0E-35
sp|Q5AUJ1|H2AZ_EMENI Histone H2A.Z OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=htz1 PE=3 SV=1 9 130 4.0E-35
sp|A4QVR2|H2AZ_MAGO7 Histone H2A.Z OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=HTZ1 PE=3 SV=1 12 121 5.0E-35
sp|C0HJQ3|H2A_ACIGU Histone H2A (Fragments) OS=Acipenser gueldenstaedtii PE=1 SV=1 1 88 5.0E-35
sp|A2R702|H2AZ_ASPNC Histone H2A.Z OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=HTZ1 PE=3 SV=1 9 121 6.0E-35
sp|Q5AEE1|H2AZ_CANAL Histone H2A.Z OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=HTZ1 PE=3 SV=3 14 128 7.0E-35
sp|Q4IMD1|H2AZ_GIBZE Histone H2A.Z OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=HTZ1 PE=3 SV=1 13 129 8.0E-35
sp|Q8S857|H2AV2_ORYSJ Probable histone H2A variant 2 OS=Oryza sativa subsp. japonica GN=Os10g0418000 PE=2 SV=1 19 121 1.0E-34
sp|A5DXC6|H2AZ_LODEL Histone H2A.Z OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=HTZ1 PE=3 SV=1 14 121 1.0E-34
sp|Q2UJ80|H2AZ_ASPOR Histone H2A.Z OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=HTZ1 PE=3 SV=1 9 121 2.0E-34
sp|Q0UG93|H2AZ_PHANO Histone H2A.Z OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=HTZ1 PE=3 SV=1 12 133 2.0E-34
sp|Q12692|H2AZ_YEAST Histone H2A.Z OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HTZ1 PE=1 SV=3 3 128 2.0E-34
sp|A1D0C1|H2AZ_NEOFI Histone H2A.Z OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=htz1 PE=3 SV=1 9 121 3.0E-34
sp|Q4WE68|H2AZ_ASPFU Histone H2A.Z OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=htz1 PE=3 SV=1 9 121 3.0E-34
sp|A1C5F1|H2AZ_ASPCL Histone H2A.Z OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=HTZ1 PE=3 SV=1 9 121 3.0E-34
sp|A3GHC1|H2AZ_PICST Histone H2A.Z OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=HTZ1 PE=3 SV=2 11 128 4.0E-34
sp|Q1DTG2|H2AZ_COCIM Histone H2A.Z OS=Coccidioides immitis (strain RS) GN=HTZ1 PE=3 SV=1 10 121 8.0E-34
sp|P48003|H2AZ_SCHPO Histone H2A.Z OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pht1 PE=1 SV=3 13 125 9.0E-34
sp|Q4PHE4|H2AZ_USTMA Histone H2A.Z OS=Ustilago maydis (strain 521 / FGSC 9021) GN=HTZ1 PE=3 SV=1 4 119 9.0E-34
sp|A5DQL2|H2AZ_PICGU Histone H2A.Z OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=HTZ1 PE=3 SV=1 11 121 1.0E-33
sp|Q6BQE9|H2AZ_DEBHA Histone H2A.Z OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=HTZ1 PE=3 SV=3 11 128 1.0E-33
sp|Q09FM9|H2AZ_MONPU Histone H2A.Z OS=Monascus purpureus GN=HTZ1 PE=3 SV=1 13 128 1.0E-33
sp|Q0C919|H2AZ_ASPTN Histone H2A.Z OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=HTZ1 PE=3 SV=1 9 131 2.0E-33
sp|Q54HW2|H2AV1_DICDI Histone H2A.v1 OS=Dictyostelium discoideum GN=H2Av1 PE=3 SV=1 6 124 2.0E-31
sp|Q9LD75|H2A2_LILLO Histone H2A.2 OS=Lilium longiflorum GN=gH2A PE=1 SV=1 7 122 9.0E-31
sp|P08992|H2AV_TETTS Histone H2A.Z OS=Tetrahymena thermophila (strain SB210) GN=HTA3 PE=1 SV=2 18 125 2.0E-30
sp|P35066|H2A_TRYCR Histone H2A OS=Trypanosoma cruzi PE=3 SV=2 20 118 5.0E-30
sp|P82897|H2A_OLILU Histone H2A (Fragment) OS=Olisthodiscus luteus PE=1 SV=1 48 114 3.0E-28
sp|P27891|H2A1_LEIIN Histone H2A.1 OS=Leishmania infantum PE=2 SV=1 19 114 7.0E-28
sp|P27892|H2A2_LEIIN Histone H2A.2 OS=Leishmania infantum PE=2 SV=1 14 116 3.0E-27
sp|Q54LA5|H2AZ_DICDI Histone H2A.z OS=Dictyostelium discoideum GN=H2AZ PE=3 SV=1 1 118 7.0E-27
sp|Q5Y2C3|H2AY_TETTS Histone H2A.Y OS=Tetrahymena thermophila (strain SB210) GN=HTAY PE=2 SV=2 3 116 1.0E-24
sp|Q9CQ70|H2AB1_MOUSE Histone H2A-Bbd type 1 OS=Mus musculus GN=H2afb1 PE=2 SV=1 19 100 9.0E-23
sp|P0C5Z0|H2AB2_HUMAN Histone H2A-Bbd type 2/3 OS=Homo sapiens GN=H2AFB2 PE=2 SV=1 19 107 3.0E-22
sp|Q9XG56|H2A1_LILLO Histone H2A.1 OS=Lilium longiflorum GN=gcH2A PE=2 SV=1 5 98 3.0E-21
sp|P0C5Y9|H2AB1_HUMAN Histone H2A-Bbd type 1 OS=Homo sapiens GN=H2AFB1 PE=2 SV=1 19 107 4.0E-21
sp|Q9T0H7|H2A8_ARATH Histone H2A.8 OS=Arabidopsis thaliana GN=At4g13570 PE=1 SV=1 25 115 5.0E-21
sp|P59890|H2A_HIPHI Histone H2A (Fragment) OS=Hippoglossus hippoglossus PE=1 SV=2 1 54 1.0E-18
sp|Q54HV9|H2AV2_DICDI Histone H2A.v2 OS=Dictyostelium discoideum GN=H2Av2 PE=3 SV=1 19 119 6.0E-18
sp|Q54BC2|H2BV1_DICDI Histone H2B.v1 OS=Dictyostelium discoideum GN=H2Bv1 PE=3 SV=1 37 112 2.0E-14
sp|P55897|H2A_BUFGR Histone H2A (Fragment) OS=Bufo gargarizans PE=1 SV=1 3 42 5.0E-09
sp|Q54HV7|H2AV3_DICDI Histone H2A.v3 OS=Dictyostelium discoideum GN=H2Av3 PE=3 SV=1 43 113 2.0E-08
sp|Q6C6M5|DPB3_YARLI DNA polymerase epsilon subunit C OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=DPB3 PE=3 SV=1 28 125 1.0E-07
sp|Q62245|SOS1_MOUSE Son of sevenless homolog 1 OS=Mus musculus GN=Sos1 PE=1 SV=2 11 96 1.0E-06
sp|Q1LVW0|BTBBA_DANRE Ankyrin repeat and BTB/POZ domain-containing protein BTBD11-A OS=Danio rerio GN=btbd11a PE=3 SV=2 11 129 2.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0003677 DNA binding Yes
GO:0003674 molecular_function No
GO:0005488 binding No
GO:1901363 heterocyclic compound binding No
GO:0097159 organic cyclic compound binding No
GO:0003676 nucleic acid binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 31 0.45

Transmembrane Domains

(None)

Transcription Factor Class

Transcription Factor Class
(based on PFAM domains)
Histone-like TF

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|5811
MTGGGKSGGKASGSKNAQSRSSKAGLAFPVGRVHRLLRKGNYAQRVGAGAPVYLAAVLEYLAAEILELAGNAARD
NKKTRIIPRHLQLAIRNDEELNKLLGHVTIAQGGVLPNIHQNLLPKKTGKAGKGASQEL*
Coding >OphauB2|5811
ATGACGGGCGGTGGCAAATCTGGCGGTAAGGCCTCTGGCTCGAAAAATGCGCAATCGCGCTCCTCCAAAGCTGGA
CTCGCATTTCCTGTCGGTCGTGTCCATCGGCTTTTACGAAAAGGCAACTATGCACAACGTGTGGGTGCCGGCGCT
CCGGTCTATTTGGCTGCAGTTCTAGAGTATTTGGCTGCCGAAATCCTCGAGCTGGCCGGCAATGCCGCTCGCGAC
AACAAGAAGACGCGTATTATTCCTCGTCATCTTCAGCTTGCCATCCGCAACGATGAGGAGCTCAATAAATTATTG
GGACACGTTACTATTGCACAGGGTGGTGTACTGCCAAATATTCATCAAAATTTACTGCCAAAGAAGACCGGAAAG
GCAGGCAAAGGTGCAAGTCAGGAGCTATAA
Transcript >OphauB2|5811
ATGACGGGCGGTGGCAAATCTGGCGGTAAGGCCTCTGGCTCGAAAAATGCGCAATCGCGCTCCTCCAAAGCTGGA
CTCGCATTTCCTGTCGGTCGTGTCCATCGGCTTTTACGAAAAGGCAACTATGCACAACGTGTGGGTGCCGGCGCT
CCGGTCTATTTGGCTGCAGTTCTAGAGTATTTGGCTGCCGAAATCCTCGAGCTGGCCGGCAATGCCGCTCGCGAC
AACAAGAAGACGCGTATTATTCCTCGTCATCTTCAGCTTGCCATCCGCAACGATGAGGAGCTCAATAAATTATTG
GGACACGTTACTATTGCACAGGGTGGTGTACTGCCAAATATTCATCAAAATTTACTGCCAAAGAAGACCGGAAAG
GCAGGCAAAGGTGCAAGTCAGGAGCTATAA
Gene >OphauB2|5811
ATGACGGGCGGTGGCAAATCTGGCGGTAAGGCCTCTGGCTCGAAAAATGCGCAATCGTAAGTCAATATTTGCTTC
TACAACGCGTCGACAGACCGGAGGAATGTCTTGCAATAACATGAGCACTGGCTGATCATTTCATTTCAATTTAGG
CGCTCCTCCAAAGCTGGACTCGCATTTCCTGTCGGTCGTGTCCATCGGCTTTTACGAAAAGGCAACTATGCACAA
CGTGTGGGTGCCGGCGCTCCGGTCTATTTGGCTGCAGTTCTAGAGTATTTGGCTGCCGAAATCCTCGAGCTGGCC
GGCAATGCCGCTCGCGACAACAAGAAGACGCGTATTATTCCTCGTCATCTTCAGCTTGCCATCCGCAACGATGAG
GAGCTCAATAAATTATTGGGACACGTTACTATTGCACAGGGTGGTGTACTGCCAAATATTCATCAAAGTAAGTAT
TCGAAATCAACGCACATGACTGGTGGAAGTTAACACGAGCTAGATTTACTGCCAAAGAAGACCGGAAAGGCAGGC
AAAGGTGCAAGTCAGGAGCTATAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail