Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|581
Gene name
LocationContig_11:148822..149650
Strand-
Gene length (bp)828
Transcript length (bp)828
Coding sequence length (bp)828
Protein length (aa) 276

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01121 CoaE Dephospho-CoA kinase 1.3E-40 3 194

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q03941|CAB5_YEAST Dephospho-CoA kinase CAB5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CAB5 PE=1 SV=1 1 265 2.0E-51
sp|O74414|YJL1_SCHPO Uncharacterized protein C14G10.01 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC14G10.01 PE=1 SV=1 1 246 3.0E-46
sp|P34558|YNP5_CAEEL Uncharacterized protein T05G5.5 OS=Caenorhabditis elegans GN=T05G5.5 PE=3 SV=2 1 229 3.0E-39
sp|Q5KWC4|COAE_GEOKA Dephospho-CoA kinase OS=Geobacillus kaustophilus (strain HTA426) GN=coaE PE=3 SV=1 2 219 4.0E-37
sp|Q0P4C4|DCAKD_DANRE Dephospho-CoA kinase domain-containing protein OS=Danio rerio GN=dcakd PE=2 SV=1 1 254 2.0E-35
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q03941|CAB5_YEAST Dephospho-CoA kinase CAB5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CAB5 PE=1 SV=1 1 265 2.0E-51
sp|O74414|YJL1_SCHPO Uncharacterized protein C14G10.01 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC14G10.01 PE=1 SV=1 1 246 3.0E-46
sp|P34558|YNP5_CAEEL Uncharacterized protein T05G5.5 OS=Caenorhabditis elegans GN=T05G5.5 PE=3 SV=2 1 229 3.0E-39
sp|Q5KWC4|COAE_GEOKA Dephospho-CoA kinase OS=Geobacillus kaustophilus (strain HTA426) GN=coaE PE=3 SV=1 2 219 4.0E-37
sp|Q0P4C4|DCAKD_DANRE Dephospho-CoA kinase domain-containing protein OS=Danio rerio GN=dcakd PE=2 SV=1 1 254 2.0E-35
sp|O34932|COAE_BACSU Dephospho-CoA kinase OS=Bacillus subtilis (strain 168) GN=coaE PE=3 SV=1 2 223 1.0E-34
sp|Q8Y6W8|COAE_LISMO Dephospho-CoA kinase OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=coaE PE=3 SV=1 4 221 5.0E-34
sp|Q8EPE7|COAE_OCEIH Dephospho-CoA kinase OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=coaE PE=3 SV=1 2 223 1.0E-33
sp|Q5WEG9|COAE_BACSK Dephospho-CoA kinase OS=Bacillus clausii (strain KSM-K16) GN=coaE PE=3 SV=1 4 224 3.0E-32
sp|Q9K857|COAE_BACHD Dephospho-CoA kinase OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=coaE PE=3 SV=1 2 219 1.0E-31
sp|Q92BF2|COAE_LISIN Dephospho-CoA kinase OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=coaE PE=3 SV=1 4 221 2.0E-31
sp|Q72ZF3|COAE_BACC1 Dephospho-CoA kinase OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=coaE PE=3 SV=1 2 223 3.0E-31
sp|Q6AY55|DCAKD_RAT Dephospho-CoA kinase domain-containing protein OS=Rattus norvegicus GN=Dcakd PE=2 SV=1 1 192 3.0E-31
sp|Q71ZA4|COAE_LISMF Dephospho-CoA kinase OS=Listeria monocytogenes serotype 4b (strain F2365) GN=coaE PE=3 SV=1 4 221 3.0E-31
sp|Q8WVC6|DCAKD_HUMAN Dephospho-CoA kinase domain-containing protein OS=Homo sapiens GN=DCAKD PE=1 SV=1 1 192 2.0E-30
sp|Q6HSG2|COAE_BACAN Dephospho-CoA kinase OS=Bacillus anthracis GN=coaE PE=3 SV=1 2 211 2.0E-30
sp|Q8BHC4|DCAKD_MOUSE Dephospho-CoA kinase domain-containing protein OS=Mus musculus GN=Dcakd PE=1 SV=1 1 192 2.0E-30
sp|Q817G7|COAE_BACCR Dephospho-CoA kinase OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=coaE PE=3 SV=1 2 211 4.0E-30
sp|Q6HCU7|COAE_BACHK Dephospho-CoA kinase OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=coaE PE=3 SV=1 2 211 4.0E-30
sp|Q67R57|COAE_SYMTH Dephospho-CoA kinase OS=Symbiobacterium thermophilum (strain T / IAM 14863) GN=coaE PE=3 SV=1 1 222 5.0E-30
sp|Q633L3|COAE_BACCZ Dephospho-CoA kinase OS=Bacillus cereus (strain ZK / E33L) GN=coaE PE=3 SV=1 2 211 6.0E-30
sp|Q94DR2|COAE_ORYSJ Dephospho-CoA kinase OS=Oryza sativa subsp. japonica GN=Os01g0360600 PE=2 SV=1 1 234 5.0E-29
sp|A4IH68|DCAKD_XENTR Dephospho-CoA kinase domain-containing protein OS=Xenopus tropicalis GN=dcakd PE=2 SV=1 1 229 1.0E-28
sp|Q3ZBS0|DCAKD_BOVIN Dephospho-CoA kinase domain-containing protein OS=Bos taurus GN=DCAKD PE=2 SV=2 1 192 1.0E-28
sp|Q65G95|COAE_BACLD Dephospho-CoA kinase OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=coaE PE=3 SV=1 2 235 3.0E-28
sp|Q9ZQH0|COAE_ARATH Dephospho-CoA kinase OS=Arabidopsis thaliana GN=COAE PE=2 SV=1 1 228 1.0E-27
sp|Q2ILC5|COAE_ANADE Dephospho-CoA kinase OS=Anaeromyxobacter dehalogenans (strain 2CP-C) GN=coaE PE=3 SV=1 1 216 5.0E-27
sp|Q74IB6|COAE_LACJO Dephospho-CoA kinase OS=Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533) GN=coaE PE=3 SV=1 3 226 1.0E-26
sp|Q88WV3|COAE_LACPL Dephospho-CoA kinase OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=coaE PE=3 SV=2 3 196 4.0E-26
sp|Q4L730|COAE_STAHJ Dephospho-CoA kinase OS=Staphylococcus haemolyticus (strain JCSC1435) GN=coaE PE=3 SV=1 3 224 3.0E-25
sp|Q5HNL6|COAE_STAEQ Dephospho-CoA kinase OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=coaE PE=3 SV=1 3 220 5.0E-25
sp|Q49YB9|COAE_STAS1 Dephospho-CoA kinase OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=coaE PE=3 SV=1 3 191 5.0E-25
sp|Q8CS70|COAE_STAES Dephospho-CoA kinase OS=Staphylococcus epidermidis (strain ATCC 12228) GN=coaE PE=3 SV=1 3 192 6.0E-25
sp|Q39R83|COAE_GEOMG Dephospho-CoA kinase OS=Geobacter metallireducens (strain GS-15 / ATCC 53774 / DSM 7210) GN=coaE PE=3 SV=1 1 219 2.0E-24
sp|Q837G2|COAE_ENTFA Dephospho-CoA kinase OS=Enterococcus faecalis (strain ATCC 700802 / V583) GN=coaE PE=3 SV=1 3 220 2.0E-24
sp|P63832|COAE_STAAW Dephospho-CoA kinase OS=Staphylococcus aureus (strain MW2) GN=coaE PE=3 SV=1 3 220 6.0E-24
sp|Q6G8N8|COAE_STAAS Dephospho-CoA kinase OS=Staphylococcus aureus (strain MSSA476) GN=coaE PE=3 SV=1 3 220 6.0E-24
sp|P63831|COAE_STAAN Dephospho-CoA kinase OS=Staphylococcus aureus (strain N315) GN=coaE PE=1 SV=1 3 220 6.0E-24
sp|P63830|COAE_STAAM Dephospho-CoA kinase OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=coaE PE=3 SV=1 3 220 6.0E-24
sp|Q5HF85|COAE_STAAC Dephospho-CoA kinase OS=Staphylococcus aureus (strain COL) GN=coaE PE=3 SV=1 3 220 6.0E-24
sp|Q2FG49|COAE_STAA3 Dephospho-CoA kinase OS=Staphylococcus aureus (strain USA300) GN=coaE PE=3 SV=1 3 220 6.0E-24
sp|Q6GG18|COAE_STAAR Dephospho-CoA kinase OS=Staphylococcus aureus (strain MRSA252) GN=coaE PE=3 SV=1 3 220 6.0E-24
sp|Q2YTA2|COAE_STAAB Dephospho-CoA kinase OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=coaE PE=3 SV=1 3 220 9.0E-24
sp|Q8DKG1|COAE_THEEB Dephospho-CoA kinase OS=Thermosynechococcus elongatus (strain BP-1) GN=coaE PE=3 SV=1 1 224 1.0E-23
sp|Q8EJP9|COAE_SHEON Dephospho-CoA kinase OS=Shewanella oneidensis (strain MR-1) GN=coaE PE=3 SV=1 2 220 1.0E-23
sp|Q9S2K7|COAE_STRCO Dephospho-CoA kinase OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=coaE PE=3 SV=1 1 220 2.0E-23
sp|Q82A24|COAE_STRAW Dephospho-CoA kinase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=coaE PE=3 SV=2 1 219 5.0E-23
sp|Q6MIK8|COAE_BDEBA Dephospho-CoA kinase OS=Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIB 9529 / HD100) GN=coaE PE=3 SV=1 4 219 8.0E-23
sp|Q8RHR7|COAE_FUSNN Dephospho-CoA kinase OS=Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / CIP 101130 / JCM 8532 / LMG 13131) GN=coaE PE=3 SV=1 1 220 1.0E-22
sp|Q3ABL6|COAE_CARHZ Dephospho-CoA kinase OS=Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901) GN=coaE PE=3 SV=1 3 223 1.0E-22
sp|Q3MGH8|COAE_ANAVT Dephospho-CoA kinase OS=Anabaena variabilis (strain ATCC 29413 / PCC 7937) GN=coaE PE=3 SV=1 3 223 2.0E-22
sp|Q87LT4|COAE_VIBPA Dephospho-CoA kinase OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=coaE PE=3 SV=1 2 185 2.0E-22
sp|Q2RHF1|COAE_MOOTA Dephospho-CoA kinase OS=Moorella thermoacetica (strain ATCC 39073) GN=coaE PE=3 SV=1 1 187 2.0E-22
sp|Q9RT73|COAE_DEIRA Dephospho-CoA kinase OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=coaE PE=3 SV=1 4 223 7.0E-22
sp|Q74FU2|COAE_GEOSL Dephospho-CoA kinase OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) GN=coaE PE=3 SV=1 1 211 7.0E-22
sp|P56187|COAE_CORGT Dephospho-CoA kinase (Fragment) OS=Corynebacterium glutamicum GN=coaE PE=3 SV=1 1 226 2.0E-21
sp|Q9CHQ8|COAE_LACLA Dephospho-CoA kinase OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=coaE PE=3 SV=1 2 229 4.0E-21
sp|Q5R0N3|COAE_IDILO Dephospho-CoA kinase OS=Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR) GN=coaE PE=3 SV=1 3 220 9.0E-21
sp|Q6AF53|COAE_LEIXX Dephospho-CoA kinase OS=Leifsonia xyli subsp. xyli (strain CTCB07) GN=coaE PE=3 SV=1 1 219 1.0E-20
sp|Q8FPN2|COAE_COREF Dephospho-CoA kinase OS=Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395) GN=coaE PE=3 SV=1 1 226 1.0E-20
sp|Q9KPE3|COAE_VIBCH Dephospho-CoA kinase OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=coaE PE=3 SV=2 2 219 1.0E-20
sp|Q56741|COAE_VIBVU Dephospho-CoA kinase OS=Vibrio vulnificus (strain CMCP6) GN=coaE PE=3 SV=2 2 171 2.0E-20
sp|Q7U3S5|COAE_SYNPX Dephospho-CoA kinase OS=Synechococcus sp. (strain WH8102) GN=coaE PE=3 SV=1 4 185 3.0E-20
sp|Q8YW62|COAE_NOSS1 Dephospho-CoA kinase OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=coaE PE=3 SV=1 3 223 3.0E-20
sp|Q7M7Q5|COAE_WOLSU Dephospho-CoA kinase OS=Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / LMG 7466 / NCTC 11488 / FDC 602W) GN=coaE PE=3 SV=1 4 229 4.0E-20
sp|Q7MHT5|COAE_VIBVY Dephospho-CoA kinase OS=Vibrio vulnificus (strain YJ016) GN=coaE PE=3 SV=1 2 170 5.0E-20
sp|Q66EJ1|COAE_YERPS Dephospho-CoA kinase OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=coaE PE=3 SV=1 3 185 6.0E-20
sp|Q8ZBI0|COAE_YERPE Dephospho-CoA kinase OS=Yersinia pestis GN=coaE PE=3 SV=1 3 185 6.0E-20
sp|Q55515|COAE_SYNY3 Dephospho-CoA kinase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=coaE PE=3 SV=1 3 222 9.0E-20
sp|Q3IID1|COAE_PSEHT Dephospho-CoA kinase OS=Pseudoalteromonas haloplanktis (strain TAC 125) GN=coaE PE=3 SV=1 3 211 1.0E-19
sp|P9WPA3|COAE_MYCTU Dephospho-CoA kinase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=coaE PE=1 SV=1 1 218 5.0E-19
sp|P9WPA2|COAE_MYCTO Dephospho-CoA kinase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=coaE PE=3 SV=1 1 218 5.0E-19
sp|P63827|COAE_MYCBO Dephospho-CoA kinase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=coaE PE=3 SV=1 1 218 5.0E-19
sp|Q31DD4|COAE_PROM9 Dephospho-CoA kinase OS=Prochlorococcus marinus (strain MIT 9312) GN=coaE PE=3 SV=1 4 179 5.0E-19
sp|Q2JCJ1|COAE_FRASC Dephospho-CoA kinase OS=Frankia sp. (strain CcI3) GN=coaE PE=3 SV=1 1 220 8.0E-19
sp|P58897|COAE_CORGL Dephospho-CoA kinase OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=coaE PE=3 SV=1 1 226 2.0E-18
sp|Q7VM70|COAE_HAEDU Dephospho-CoA kinase OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=coaE PE=3 SV=1 2 170 3.0E-18
sp|Q4JW20|COAE_CORJK Dephospho-CoA kinase OS=Corynebacterium jeikeium (strain K411) GN=coaE PE=3 SV=1 1 219 5.0E-18
sp|Q3AGR0|COAE_SYNSC Dephospho-CoA kinase OS=Synechococcus sp. (strain CC9605) GN=coaE PE=3 SV=1 4 185 5.0E-18
sp|Q9CPF5|COAE_PASMU Dephospho-CoA kinase OS=Pasteurella multocida (strain Pm70) GN=coaE PE=3 SV=1 3 187 6.0E-18
sp|Q7NIP9|COAE_GLOVI Dephospho-CoA kinase OS=Gloeobacter violaceus (strain PCC 7421) GN=coaE PE=3 SV=1 3 223 8.0E-18
sp|Q493P4|COAE_BLOPB Dephospho-CoA kinase OS=Blochmannia pennsylvanicus (strain BPEN) GN=coaE PE=3 SV=1 3 221 1.0E-17
sp|Q2JWS5|COAE_SYNJA Dephospho-CoA kinase OS=Synechococcus sp. (strain JA-3-3Ab) GN=coaE PE=3 SV=1 1 225 2.0E-17
sp|Q9JRM6|COAE_AGGAC Dephospho-CoA kinase OS=Aggregatibacter actinomycetemcomitans GN=coaE PE=3 SV=1 3 172 3.0E-17
sp|Q8FL55|COAE_ECOL6 Dephospho-CoA kinase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=coaE PE=3 SV=1 3 219 4.0E-17
sp|Q47QN9|COAE_THEFY Dephospho-CoA kinase OS=Thermobifida fusca (strain YX) GN=coaE PE=3 SV=2 1 219 5.0E-17
sp|Q2NVT9|COAE_SODGM Dephospho-CoA kinase OS=Sodalis glossinidius (strain morsitans) GN=coaE PE=3 SV=1 3 221 8.0E-17
sp|Q8PHK7|COAE_XANAC Dephospho-CoA kinase OS=Xanthomonas axonopodis pv. citri (strain 306) GN=coaE PE=3 SV=1 2 186 1.0E-16
sp|Q8RBE5|COAE_CALS4 Dephospho-CoA kinase OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=coaE PE=3 SV=1 1 185 1.0E-16
sp|Q7V435|COAE_PROMM Dephospho-CoA kinase OS=Prochlorococcus marinus (strain MIT 9313) GN=coaE PE=3 SV=1 4 221 2.0E-16
sp|Q38VS6|COAE_LACSS Dephospho-CoA kinase OS=Lactobacillus sakei subsp. sakei (strain 23K) GN=coaE PE=3 SV=1 3 229 2.0E-16
sp|Q3AVV9|COAE_SYNS9 Dephospho-CoA kinase OS=Synechococcus sp. (strain CC9902) GN=coaE PE=3 SV=1 4 223 2.0E-16
sp|Q5M575|COAE_STRT2 Dephospho-CoA kinase OS=Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311) GN=coaE PE=3 SV=2 2 223 2.0E-16
sp|Q5H2I4|COAE_XANOR Dephospho-CoA kinase OS=Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85) GN=coaE PE=3 SV=1 2 220 5.0E-16
sp|Q2P5F7|COAE_XANOM Dephospho-CoA kinase OS=Xanthomonas oryzae pv. oryzae (strain MAFF 311018) GN=coaE PE=3 SV=1 2 220 5.0E-16
sp|Q7V3M6|COAE_PROMP Dephospho-CoA kinase OS=Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / MED4) GN=coaE PE=3 SV=1 4 170 1.0E-15
sp|Q2LUP6|COAE_SYNAS Dephospho-CoA kinase OS=Syntrophus aciditrophicus (strain SB) GN=coaE PE=3 SV=1 1 219 1.0E-15
sp|Q5FIV9|COAE_LACAC Dephospho-CoA kinase OS=Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM) GN=coaE PE=3 SV=1 3 229 1.0E-15
sp|Q6D0J6|COAE_PECAS Dephospho-CoA kinase OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=coaE PE=3 SV=1 3 185 1.0E-15
sp|Q46526|COAE_DICNO Dephospho-CoA kinase OS=Dichelobacter nodosus GN=coaE PE=3 SV=1 2 170 1.0E-15
sp|P56186|COAE_AERHY Dephospho-CoA kinase OS=Aeromonas hydrophila GN=coaE PE=3 SV=1 1 219 2.0E-15
sp|Q3Z5Q6|COAE_SHISS Dephospho-CoA kinase OS=Shigella sonnei (strain Ss046) GN=coaE PE=3 SV=1 3 219 3.0E-15
sp|Q32JY9|COAE_SHIDS Dephospho-CoA kinase OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=coaE PE=3 SV=1 3 219 3.0E-15
sp|Q326D2|COAE_SHIBS Dephospho-CoA kinase OS=Shigella boydii serotype 4 (strain Sb227) GN=coaE PE=3 SV=1 3 219 3.0E-15
sp|P0A6I9|COAE_ECOLI Dephospho-CoA kinase OS=Escherichia coli (strain K12) GN=coaE PE=1 SV=1 3 219 3.0E-15
sp|P0A6J0|COAE_ECO57 Dephospho-CoA kinase OS=Escherichia coli O157:H7 GN=coaE PE=3 SV=1 3 219 3.0E-15
sp|Q7C397|COAE_SHIFL Dephospho-CoA kinase OS=Shigella flexneri GN=coaE PE=3 SV=1 3 219 5.0E-15
sp|Q3A6J1|COAE_PELCD Dephospho-CoA kinase OS=Pelobacter carbinolicus (strain DSM 2380 / Gra Bd 1) GN=coaE PE=3 SV=1 1 224 7.0E-15
sp|Q8DYJ2|COAE_STRA5 Dephospho-CoA kinase OS=Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R) GN=coaE PE=3 SV=1 3 223 1.0E-14
sp|Q3K029|COAE_STRA1 Dephospho-CoA kinase OS=Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700) GN=coaE PE=3 SV=1 3 223 1.0E-14
sp|Q8E449|COAE_STRA3 Dephospho-CoA kinase OS=Streptococcus agalactiae serotype III (strain NEM316) GN=coaE PE=3 SV=1 3 223 2.0E-14
sp|Q740M4|COAE_MYCPA Dephospho-CoA kinase OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=coaE PE=3 SV=1 1 215 2.0E-14
sp|Q2JLX1|COAE_SYNJB Dephospho-CoA kinase OS=Synechococcus sp. (strain JA-2-3B'a(2-13)) GN=coaE PE=3 SV=1 1 225 2.0E-14
sp|P0DA45|COAE_STRPQ Dephospho-CoA kinase OS=Streptococcus pyogenes serotype M3 (strain SSI-1) GN=coaE PE=3 SV=1 2 223 3.0E-14
sp|P63834|COAE_STRP8 Dephospho-CoA kinase OS=Streptococcus pyogenes serotype M18 (strain MGAS8232) GN=coaE PE=3 SV=1 2 223 3.0E-14
sp|Q5XDE3|COAE_STRP6 Dephospho-CoA kinase OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) GN=coaE PE=3 SV=2 2 223 3.0E-14
sp|P0DA44|COAE_STRP3 Dephospho-CoA kinase OS=Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315) GN=coaE PE=3 SV=1 2 223 3.0E-14
sp|Q5E2R2|COAE_VIBF1 Dephospho-CoA kinase OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=coaE PE=3 SV=1 3 170 4.0E-14
sp|Q7VEG0|COAE_PROMA Dephospho-CoA kinase OS=Prochlorococcus marinus (strain SARG / CCMP1375 / SS120) GN=coaE PE=3 SV=1 4 185 5.0E-14
sp|Q6A9M5|COAE_PROAC Dephospho-CoA kinase OS=Propionibacterium acnes (strain KPA171202 / DSM 16379) GN=coaE PE=3 SV=1 4 187 7.0E-14
sp|Q5P2L4|COAE_AROAE Dephospho-CoA kinase OS=Aromatoleum aromaticum (strain EbN1) GN=coaE PE=3 SV=1 2 186 8.0E-14
sp|Q57TB6|COAE_SALCH Dephospho-CoA kinase OS=Salmonella choleraesuis (strain SC-B67) GN=coaE PE=3 SV=1 4 219 8.0E-14
sp|Q6NHI5|COAE_CORDI Dephospho-CoA kinase OS=Corynebacterium diphtheriae (strain ATCC 700971 / NCTC 13129 / Biotype gravis) GN=coaE PE=3 SV=1 1 217 1.0E-13
sp|P63828|COAE_SALTY Dephospho-CoA kinase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=coaE PE=3 SV=1 4 219 1.0E-13
sp|P63829|COAE_SALTI Dephospho-CoA kinase OS=Salmonella typhi GN=coaE PE=3 SV=1 4 219 1.0E-13
sp|Q7N158|COAE_PHOLL Dephospho-CoA kinase OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=coaE PE=3 SV=1 3 185 2.0E-13
sp|P44920|COAE_HAEIN Dephospho-CoA kinase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=coaE PE=1 SV=2 3 172 2.0E-13
sp|Q4QM18|COAE_HAEI8 Dephospho-CoA kinase OS=Haemophilus influenzae (strain 86-028NP) GN=coaE PE=3 SV=2 3 172 2.0E-13
sp|Q5PDH9|COAE_SALPA Dephospho-CoA kinase OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=coaE PE=3 SV=1 4 219 2.0E-13
sp|Q9PAI2|COAE_XYLFA Dephospho-CoA kinase OS=Xylella fastidiosa (strain 9a5c) GN=coaE PE=3 SV=2 4 219 3.0E-13
sp|Q5FPK0|COAE_GLUOX Dephospho-CoA kinase OS=Gluconobacter oxydans (strain 621H) GN=coaE PE=3 SV=1 1 230 3.0E-13
sp|Q87AA7|COAE_XYLFT Dephospho-CoA kinase OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=coaE PE=3 SV=1 4 219 4.0E-13
sp|Q2SZG8|COAE_BURTA Dephospho-CoA kinase OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=coaE PE=3 SV=1 1 228 4.0E-13
sp|Q5N2P0|COAE_SYNP6 Dephospho-CoA kinase OS=Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1) GN=coaE PE=3 SV=1 4 226 4.0E-13
sp|Q31RL4|COAE_SYNE7 Dephospho-CoA kinase OS=Synechococcus elongatus (strain PCC 7942) GN=coaE PE=3 SV=1 4 226 4.0E-13
sp|Q8KD46|COAE_CHLTE Dephospho-CoA kinase OS=Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) GN=coaE PE=3 SV=1 2 220 5.0E-13
sp|Q46X10|COAE_CUPPJ Dephospho-CoA kinase OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=coaE PE=3 SV=1 1 219 7.0E-13
sp|P58100|COAE_CAUCR Dephospho-CoA kinase OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=coaE PE=3 SV=1 1 196 7.0E-13
sp|Q97R60|COAE_STRPN Dephospho-CoA kinase OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=coaE PE=3 SV=1 11 185 8.0E-13
sp|P58102|COAE_STRP1 Dephospho-CoA kinase OS=Streptococcus pyogenes serotype M1 GN=coaE PE=3 SV=1 2 223 9.0E-13
sp|Q21MF7|COAE_SACD2 Dephospho-CoA kinase OS=Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024) GN=coaE PE=3 SV=1 2 172 9.0E-13
sp|Q2J352|COAE_RHOP2 Dephospho-CoA kinase OS=Rhodopseudomonas palustris (strain HaA2) GN=coaE PE=3 SV=1 1 181 1.0E-12
sp|Q7NRF7|COAE_CHRVO Dephospho-CoA kinase OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=coaE PE=3 SV=1 3 169 1.0E-12
sp|Q31I33|COAE_THICR Dephospho-CoA kinase OS=Thiomicrospira crunogena (strain XCL-2) GN=coaE PE=3 SV=1 1 223 1.0E-12
sp|Q30NW0|COAE_SULDN Dephospho-CoA kinase OS=Sulfurimonas denitrificans (strain ATCC 33889 / DSM 1251) GN=coaE PE=3 SV=1 4 195 1.0E-12
sp|Q606C5|COAE_METCA Dephospho-CoA kinase OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) GN=coaE PE=3 SV=1 1 154 1.0E-12
sp|Q8DSZ0|COAE_STRMU Dephospho-CoA kinase OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=coaE PE=3 SV=1 3 191 1.0E-12
sp|Q21UD7|COAE_RHOFT Dephospho-CoA kinase OS=Rhodoferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118) GN=coaE PE=3 SV=1 1 209 2.0E-12
sp|Q5X597|COAE_LEGPA Dephospho-CoA kinase OS=Legionella pneumophila (strain Paris) GN=coaE PE=3 SV=1 4 193 2.0E-12
sp|Q83F01|COAE_COXBU Dephospho-CoA kinase OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) GN=coaE PE=3 SV=1 1 171 2.0E-12
sp|Q48UU5|COAE_STRPM Dephospho-CoA kinase OS=Streptococcus pyogenes serotype M28 (strain MGAS6180) GN=coaE PE=3 SV=2 2 223 2.0E-12
sp|Q892J5|COAE_CLOTE Dephospho-CoA kinase OS=Clostridium tetani (strain Massachusetts / E88) GN=coaE PE=3 SV=1 1 185 2.0E-12
sp|Q2GC60|COAE_NOVAD Dephospho-CoA kinase OS=Novosphingobium aromaticivorans (strain DSM 12444 / F199) GN=coaE PE=3 SV=1 2 169 2.0E-12
sp|P63825|COAE_BRUSU Dephospho-CoA kinase OS=Brucella suis biovar 1 (strain 1330) GN=coaE PE=3 SV=1 1 219 4.0E-12
sp|P63824|COAE_BRUME Dephospho-CoA kinase OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=coaE PE=3 SV=1 1 219 4.0E-12
sp|Q5ZVH3|COAE_LEGPH Dephospho-CoA kinase OS=Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) GN=coaE PE=1 SV=2 4 220 4.0E-12
sp|Q57AI8|COAE_BRUAB Dephospho-CoA kinase OS=Brucella abortus biovar 1 (strain 9-941) GN=coaE PE=3 SV=1 1 219 5.0E-12
sp|Q2YR03|COAE_BRUA2 Dephospho-CoA kinase OS=Brucella abortus (strain 2308) GN=coaE PE=3 SV=1 1 219 5.0E-12
sp|Q65VP4|COAE_MANSM Dephospho-CoA kinase OS=Mannheimia succiniciproducens (strain MBEL55E) GN=coaE PE=3 SV=1 3 172 5.0E-12
sp|Q6ND09|COAE_RHOPA Dephospho-CoA kinase OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=coaE PE=3 SV=1 1 171 6.0E-12
sp|Q88Q65|COAE_PSEPK Dephospho-CoA kinase OS=Pseudomonas putida (strain KT2440) GN=coaE PE=3 SV=1 3 219 7.0E-12
sp|O69082|COAE_PSEPG Dephospho-CoA kinase OS=Pseudomonas putida (strain GB-1) GN=coaE PE=3 SV=1 3 219 8.0E-12
sp|Q2KE98|COAE_RHIEC Dephospho-CoA kinase OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=coaE PE=3 SV=1 1 186 8.0E-12
sp|Q2VYH5|COAE_MAGSA Dephospho-CoA kinase OS=Magnetospirillum magneticum (strain AMB-1 / ATCC 700264) GN=coaE PE=3 SV=1 1 185 8.0E-12
sp|Q9ZL12|COAE_HELPJ Dephospho-CoA kinase OS=Helicobacter pylori (strain J99 / ATCC 700824) GN=coaE PE=3 SV=1 4 226 9.0E-12
sp|Q3JEA9|COAE_NITOC Dephospho-CoA kinase OS=Nitrosococcus oceani (strain ATCC 19707 / NCIMB 11848) GN=coaE PE=3 SV=1 4 220 1.0E-11
sp|Q5WW92|COAE_LEGPL Dephospho-CoA kinase OS=Legionella pneumophila (strain Lens) GN=coaE PE=3 SV=1 4 220 1.0E-11
sp|Q8DQ32|COAE_STRR6 Dephospho-CoA kinase OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=coaE PE=3 SV=2 11 185 3.0E-11
sp|Q3SGD0|COAE_THIDA Dephospho-CoA kinase OS=Thiobacillus denitrificans (strain ATCC 25259) GN=coaE PE=3 SV=1 1 219 3.0E-11
sp|Q6FF48|COAE_ACIAD Dephospho-CoA kinase OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=coaE PE=3 SV=1 1 219 3.0E-11
sp|Q98DY2|COAE_RHILO Dephospho-CoA kinase OS=Rhizobium loti (strain MAFF303099) GN=coaE PE=3 SV=1 1 169 4.0E-11
sp|Q6G1B3|COAE_BARQU Dephospho-CoA kinase OS=Bartonella quintana (strain Toulouse) GN=coaE PE=3 SV=1 1 169 4.0E-11
sp|Q50178|COAE_MYCLE Dephospho-CoA kinase OS=Mycobacterium leprae (strain TN) GN=coaE PE=3 SV=1 30 185 4.0E-11
sp|Q5NRJ0|COAE_ZYMMO Dephospho-CoA kinase OS=Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4) GN=coaE PE=3 SV=1 1 155 5.0E-11
sp|Q5YYJ6|COAE_NOCFA Dephospho-CoA kinase OS=Nocardia farcinica (strain IFM 10152) GN=coaE PE=3 SV=1 1 219 7.0E-11
sp|P0DMK3|COAE_BURPS Dephospho-CoA kinase OS=Burkholderia pseudomallei (strain K96243) GN=coaE PE=3 SV=1 1 193 1.0E-10
sp|I1WFB9|COAE_BURP2 Dephospho-CoA kinase OS=Burkholderia pseudomallei (strain 1026b) GN=coaE PE=3 SV=1 1 193 1.0E-10
sp|Q3JNF3|COAE_BURP1 Dephospho-CoA kinase OS=Burkholderia pseudomallei (strain 1710b) GN=coaE PE=3 SV=1 1 193 1.0E-10
sp|Q62GU3|COAE_BURMA Dephospho-CoA kinase OS=Burkholderia mallei (strain ATCC 23344) GN=coaE PE=3 SV=1 1 193 1.0E-10
sp|Q3BQ76|COAE_XANC5 Dephospho-CoA kinase OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) GN=coaE PE=3 SV=1 2 218 1.0E-10
sp|Q888U3|COAE_PSESM Dephospho-CoA kinase OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=coaE PE=3 SV=1 3 193 2.0E-10
sp|Q9HVP8|COAE_PSEAE Dephospho-CoA kinase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=coaE PE=3 SV=1 3 219 2.0E-10
sp|Q9F7L5|COAE_PRB01 Dephospho-CoA kinase OS=Gamma-proteobacterium EBAC31A08 GN=coaE PE=3 SV=1 2 220 2.0E-10
sp|Q6G5A8|COAE_BARHE Dephospho-CoA kinase OS=Bartonella henselae (strain ATCC 49882 / DSM 28221 / Houston 1) GN=coaE PE=3 SV=1 1 171 4.0E-10
sp|Q47VS4|COAE_COLP3 Dephospho-CoA kinase OS=Colwellia psychrerythraea (strain 34H / ATCC BAA-681) GN=coaE PE=3 SV=1 2 195 4.0E-10
sp|Q8XIX0|COAE_CLOPE Dephospho-CoA kinase OS=Clostridium perfringens (strain 13 / Type A) GN=coaE PE=3 SV=1 1 219 4.0E-10
sp|P36644|COAE_PSEPU Dephospho-CoA kinase OS=Pseudomonas putida GN=coaE PE=3 SV=1 3 171 4.0E-10
sp|Q2RYU8|COAE_SALRD Dephospho-CoA kinase OS=Salinibacter ruber (strain DSM 13855 / M31) GN=coaE PE=3 SV=1 1 218 6.0E-10
sp|Q46I08|COAE_PROMT Dephospho-CoA kinase OS=Prochlorococcus marinus (strain NATL2A) GN=coaE PE=3 SV=1 4 185 7.0E-10
sp|Q2SBL9|COAE_HAHCH Dephospho-CoA kinase OS=Hahella chejuensis (strain KCTC 2396) GN=coaE PE=3 SV=1 2 184 9.0E-10
sp|Q2RN89|COAE_RHORT Dephospho-CoA kinase OS=Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1) GN=coaE PE=3 SV=2 2 169 1.0E-09
sp|Q48NC2|COAE_PSE14 Dephospho-CoA kinase OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=coaE PE=3 SV=1 3 193 2.0E-09
sp|Q39JV5|COAE_BURL3 Dephospho-CoA kinase OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=coaE PE=3 SV=1 1 219 2.0E-09
sp|Q5HSQ6|COAE_CAMJR Dephospho-CoA kinase OS=Campylobacter jejuni (strain RM1221) GN=coaE PE=3 SV=1 6 196 2.0E-09
sp|Q8G5L8|COAE_BIFLO Dephospho-CoA kinase OS=Bifidobacterium longum (strain NCC 2705) GN=coaE PE=3 SV=1 1 186 2.0E-09
sp|Q9ZEL7|COAE_PSEST Dephospho-CoA kinase OS=Pseudomonas stutzeri GN=coaE PE=3 SV=1 3 171 6.0E-09
sp|Q2Y748|COAE_NITMU Dephospho-CoA kinase OS=Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849) GN=coaE PE=3 SV=1 1 228 7.0E-09
sp|Q6LMG7|COAE_PHOPR Dephospho-CoA kinase OS=Photobacterium profundum GN=coaE PE=3 SV=1 2 219 8.0E-09
sp|O51497|COAE_BORBU Dephospho-CoA kinase OS=Borrelia burgdorferi (strain ATCC 35210 / B31 / CIP 102532 / DSM 4680) GN=coaE PE=3 SV=1 2 162 9.0E-09
sp|Q56764|COAE_XANCP Dephospho-CoA kinase OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=coaE PE=3 SV=2 2 218 1.0E-08
sp|Q4UXU8|COAE_XANC8 Dephospho-CoA kinase OS=Xanthomonas campestris pv. campestris (strain 8004) GN=coaE PE=3 SV=1 2 218 1.0E-08
sp|Q4FVM3|COAE_PSYA2 Dephospho-CoA kinase OS=Psychrobacter arcticus (strain DSM 17307 / 273-4) GN=coaE PE=3 SV=1 2 196 2.0E-08
sp|Q97K22|COAE_CLOAB Dephospho-CoA kinase OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=coaE PE=3 SV=1 1 226 3.0E-08
sp|Q3ZYN7|COAE_DEHMC Dephospho-CoA kinase OS=Dehalococcoides mccartyi (strain CBDB1) GN=coaE PE=3 SV=1 1 193 3.0E-08
sp|Q1QEQ3|COAE_PSYCK Dephospho-CoA kinase OS=Psychrobacter cryohalolentis (strain K5) GN=coaE PE=3 SV=1 2 171 4.0E-08
sp|Q4K5X1|COAE_PSEF5 Dephospho-CoA kinase OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=coaE PE=3 SV=1 4 171 5.0E-08
sp|Q8MIR4|COASY_PIG Bifunctional coenzyme A synthase OS=Sus scrofa GN=COASY PE=1 SV=1 3 185 1.0E-07
sp|Q21CL5|COAE_RHOPB Dephospho-CoA kinase OS=Rhodopseudomonas palustris (strain BisB18) GN=coaE PE=3 SV=1 1 181 2.0E-07
sp|Q9DBL7|COASY_MOUSE Bifunctional coenzyme A synthase OS=Mus musculus GN=Coasy PE=1 SV=2 1 185 3.0E-07
sp|Q3Z6W5|COAE_DEHM1 Dephospho-CoA kinase OS=Dehalococcoides mccartyi (strain ATCC BAA-2266 / KCTC 15142 / 195) GN=coaE PE=3 SV=1 1 193 4.0E-07
sp|Q9X1A7|COAE_THEMA Dephospho-CoA kinase OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=coaE PE=1 SV=1 2 226 5.0E-07
sp|Q3SWG9|COAE_NITWN Dephospho-CoA kinase OS=Nitrobacter winogradskyi (strain Nb-255 / ATCC 25391) GN=coaE PE=3 SV=1 1 169 6.0E-07
sp|Q8K9U1|COAE_BUCAP Dephospho-CoA kinase OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=coaE PE=3 SV=1 1 220 8.0E-07
sp|Q7VSV5|COAE_BORPE Dephospho-CoA kinase OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=coaE PE=3 SV=1 1 211 9.0E-07
sp|Q7W3R8|COAE_BORPA Dephospho-CoA kinase OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=coaE PE=3 SV=2 1 211 1.0E-06
sp|Q7WF46|COAE_BORBR Dephospho-CoA kinase OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=coaE PE=3 SV=2 1 211 1.0E-06
sp|Q13057|COASY_HUMAN Bifunctional coenzyme A synthase OS=Homo sapiens GN=COASY PE=1 SV=4 1 185 2.0E-06
sp|Q3B3J7|COAE_CHLL7 Dephospho-CoA kinase OS=Chlorobium luteolum (strain DSM 273 / 2530) GN=coaE PE=3 SV=1 2 235 2.0E-06
sp|Q92TE9|COAE_RHIME Dephospho-CoA kinase OS=Rhizobium meliloti (strain 1021) GN=coaE PE=3 SV=1 1 169 2.0E-06
sp|Q8XVK2|COAE_RALSO Dephospho-CoA kinase OS=Ralstonia solanacearum (strain GMI1000) GN=coaE PE=3 SV=1 1 219 6.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0004140 dephospho-CoA kinase activity Yes
GO:0015937 coenzyme A biosynthetic process Yes
GO:0005524 ATP binding Yes
GO:0044237 cellular metabolic process No
GO:0009150 purine ribonucleotide metabolic process No
GO:1901576 organic substance biosynthetic process No
GO:0016301 kinase activity No
GO:0032553 ribonucleotide binding No
GO:1901293 nucleoside phosphate biosynthetic process No
GO:1901137 carbohydrate derivative biosynthetic process No
GO:0009259 ribonucleotide metabolic process No
GO:0006796 phosphate-containing compound metabolic process No
GO:0000166 nucleotide binding No
GO:0018130 heterocycle biosynthetic process No
GO:0006807 nitrogen compound metabolic process No
GO:0097367 carbohydrate derivative binding No
GO:0019637 organophosphate metabolic process No
GO:1901360 organic cyclic compound metabolic process No
GO:0019438 aromatic compound biosynthetic process No
GO:0034032 purine nucleoside bisphosphate metabolic process No
GO:0019693 ribose phosphate metabolic process No
GO:0016773 phosphotransferase activity, alcohol group as acceptor No
GO:0009117 nucleotide metabolic process No
GO:0009152 purine ribonucleotide biosynthetic process No
GO:0006725 cellular aromatic compound metabolic process No
GO:0034654 nucleobase-containing compound biosynthetic process No
GO:0008150 biological_process No
GO:0016772 transferase activity, transferring phosphorus-containing groups No
GO:0090407 organophosphate biosynthetic process No
GO:0033866 nucleoside bisphosphate biosynthetic process No
GO:0043167 ion binding No
GO:0005488 binding No
GO:0034030 ribonucleoside bisphosphate biosynthetic process No
GO:0003674 molecular_function No
GO:0033875 ribonucleoside bisphosphate metabolic process No
GO:0006793 phosphorus metabolic process No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0017076 purine nucleotide binding No
GO:0072521 purine-containing compound metabolic process No
GO:0036094 small molecule binding No
GO:0008152 metabolic process No
GO:1901362 organic cyclic compound biosynthetic process No
GO:0034033 purine nucleoside bisphosphate biosynthetic process No
GO:0009987 cellular process No
GO:0044238 primary metabolic process No
GO:0015936 coenzyme A metabolic process No
GO:0009058 biosynthetic process No
GO:0032559 adenyl ribonucleotide binding No
GO:0006753 nucleoside phosphate metabolic process No
GO:0033865 nucleoside bisphosphate metabolic process No
GO:0030554 adenyl nucleotide binding No
GO:0016740 transferase activity No
GO:1901564 organonitrogen compound metabolic process No
GO:0046483 heterocycle metabolic process No
GO:0043168 anion binding No
GO:0009165 nucleotide biosynthetic process No
GO:0032555 purine ribonucleotide binding No
GO:0003824 catalytic activity No
GO:0006139 nucleobase-containing compound metabolic process No
GO:1901135 carbohydrate derivative metabolic process No
GO:0097159 organic cyclic compound binding No
GO:1901265 nucleoside phosphate binding No
GO:0055086 nucleobase-containing small molecule metabolic process No
GO:0006164 purine nucleotide biosynthetic process No
GO:0044249 cellular biosynthetic process No
GO:0044271 cellular nitrogen compound biosynthetic process No
GO:1901363 heterocyclic compound binding No
GO:0044281 small molecule metabolic process No
GO:0009260 ribonucleotide biosynthetic process No
GO:0071704 organic substance metabolic process No
GO:0072522 purine-containing compound biosynthetic process No
GO:1901566 organonitrogen compound biosynthetic process No
GO:0046390 ribose phosphate biosynthetic process No
GO:0006163 purine nucleotide metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.45

Transmembrane Domains

Domain # Start End Length
1 233 255 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|581
MLLIGLTGSIATGKSTVSSLLSSPPHSLTVIDADLLARKVVEPGTNGYKAIVGYFGPSTPDLLVEVSATMPVNGI
ANKGRPLNRPALGRRVFGDSDERKRDRAVLNGIVHPAVRWEMFKMVFSCYLRGHWAVVLDVPLLFESALDRFCGV
VVVVAVANADIQMARLMARDSHLTREDAENRVCSQTDVRIKAARCEARGPQKGIVLWNDGSKEELSRQIHTAMAA
VHKSSPDWWSWLLLGCPPLALLSAAWNMWHNLQINKRWNKSHESRLKGKL*
Coding >OphauB2|581
ATGCTCTTAATCGGACTCACGGGCTCCATTGCTACTGGCAAGTCGACGGTGTCGTCGCTGCTGTCGTCGCCGCCT
CACTCCCTCACCGTCATTGATGCAGATTTGCTGGCACGCAAGGTTGTGGAACCTGGCACAAATGGCTACAAGGCT
ATTGTTGGGTACTTTGGTCCCAGCACCCCAGACCTGCTCGTCGAGGTGTCAGCCACCATGCCCGTCAACGGCATT
GCCAACAAGGGCCGACCGCTGAACCGGCCTGCGCTGGGCCGTCGCGTCTTTGGCGACAGCGACGAGCGCAAGCGT
GACCGCGCCGTCCTCAACGGCATTGTGCACCCTGCAGTGCGCTGGGAAATGTTCAAAATGGTGTTCAGCTGCTAC
CTGCGTGGCCACTGGGCCGTTGTGCTTGACGTGCCGCTCCTCTTTGAAAGCGCACTGGACCGCTTCTGTGGCGTC
GTCGTCGTCGTGGCCGTGGCCAATGCCGACATACAGATGGCACGGCTCATGGCCCGTGACTCACATTTGACGCGG
GAGGATGCCGAAAACCGCGTCTGCAGCCAGACAGACGTGCGCATCAAGGCAGCGCGCTGCGAGGCTCGGGGTCCC
CAAAAAGGCATTGTCCTCTGGAACGACGGCTCCAAGGAGGAATTGTCACGGCAAATCCATACCGCCATGGCAGCT
GTGCACAAGTCGAGTCCTGACTGGTGGTCTTGGCTGCTGCTGGGCTGTCCCCCTCTGGCTCTTCTTTCCGCTGCT
TGGAACATGTGGCACAACTTGCAAATCAACAAGCGCTGGAACAAGTCACATGAGAGTCGGTTAAAGGGCAAGTTG
TAG
Transcript >OphauB2|581
ATGCTCTTAATCGGACTCACGGGCTCCATTGCTACTGGCAAGTCGACGGTGTCGTCGCTGCTGTCGTCGCCGCCT
CACTCCCTCACCGTCATTGATGCAGATTTGCTGGCACGCAAGGTTGTGGAACCTGGCACAAATGGCTACAAGGCT
ATTGTTGGGTACTTTGGTCCCAGCACCCCAGACCTGCTCGTCGAGGTGTCAGCCACCATGCCCGTCAACGGCATT
GCCAACAAGGGCCGACCGCTGAACCGGCCTGCGCTGGGCCGTCGCGTCTTTGGCGACAGCGACGAGCGCAAGCGT
GACCGCGCCGTCCTCAACGGCATTGTGCACCCTGCAGTGCGCTGGGAAATGTTCAAAATGGTGTTCAGCTGCTAC
CTGCGTGGCCACTGGGCCGTTGTGCTTGACGTGCCGCTCCTCTTTGAAAGCGCACTGGACCGCTTCTGTGGCGTC
GTCGTCGTCGTGGCCGTGGCCAATGCCGACATACAGATGGCACGGCTCATGGCCCGTGACTCACATTTGACGCGG
GAGGATGCCGAAAACCGCGTCTGCAGCCAGACAGACGTGCGCATCAAGGCAGCGCGCTGCGAGGCTCGGGGTCCC
CAAAAAGGCATTGTCCTCTGGAACGACGGCTCCAAGGAGGAATTGTCACGGCAAATCCATACCGCCATGGCAGCT
GTGCACAAGTCGAGTCCTGACTGGTGGTCTTGGCTGCTGCTGGGCTGTCCCCCTCTGGCTCTTCTTTCCGCTGCT
TGGAACATGTGGCACAACTTGCAAATCAACAAGCGCTGGAACAAGTCACATGAGAGTCGGTTAAAGGGCAAGTTG
TAG
Gene >OphauB2|581
ATGCTCTTAATCGGACTCACGGGCTCCATTGCTACTGGCAAGTCGACGGTGTCGTCGCTGCTGTCGTCGCCGCCT
CACTCCCTCACCGTCATTGATGCAGATTTGCTGGCACGCAAGGTTGTGGAACCTGGCACAAATGGCTACAAGGCT
ATTGTTGGGTACTTTGGTCCCAGCACCCCAGACCTGCTCGTCGAGGTGTCAGCCACCATGCCCGTCAACGGCATT
GCCAACAAGGGCCGACCGCTGAACCGGCCTGCGCTGGGCCGTCGCGTCTTTGGCGACAGCGACGAGCGCAAGCGT
GACCGCGCCGTCCTCAACGGCATTGTGCACCCTGCAGTGCGCTGGGAAATGTTCAAAATGGTGTTCAGCTGCTAC
CTGCGTGGCCACTGGGCCGTTGTGCTTGACGTGCCGCTCCTCTTTGAAAGCGCACTGGACCGCTTCTGTGGCGTC
GTCGTCGTCGTGGCCGTGGCCAATGCCGACATACAGATGGCACGGCTCATGGCCCGTGACTCACATTTGACGCGG
GAGGATGCCGAAAACCGCGTCTGCAGCCAGACAGACGTGCGCATCAAGGCAGCGCGCTGCGAGGCTCGGGGTCCC
CAAAAAGGCATTGTCCTCTGGAACGACGGCTCCAAGGAGGAATTGTCACGGCAAATCCATACCGCCATGGCAGCT
GTGCACAAGTCGAGTCCTGACTGGTGGTCTTGGCTGCTGCTGGGCTGTCCCCCTCTGGCTCTTCTTTCCGCTGCT
TGGAACATGTGGCACAACTTGCAAATCAACAAGCGCTGGAACAAGTCACATGAGAGTCGGTTAAAGGGCAAGTTG
TAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail