Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|5808
Gene name
LocationContig_486:75..702
Strand+
Gene length (bp)627
Transcript length (bp)354
Coding sequence length (bp)354
Protein length (aa) 118

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05129 Elf1 Transcription elongation factor Elf1 like 8.7E-29 2 79

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O13868|ELOF1_SCHPO Transcription elongation factor 1 homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1B3.02c PE=1 SV=1 1 84 2.0E-28
sp|P36053|ELF1_YEAST Transcription elongation factor 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ELF1 PE=1 SV=1 1 81 2.0E-25
sp|Q9XVZ8|ELOF1_CAEEL Transcription elongation factor 1 homolog OS=Caenorhabditis elegans GN=Y54G11A.11 PE=3 SV=1 1 79 4.0E-24
sp|Q8MQI6|ELOF1_DROME Transcription elongation factor 1 homolog OS=Drosophila melanogaster GN=CG40228 PE=1 SV=1 1 80 3.0E-20
sp|Q8LHP0|ELOF1_ORYSJ Transcription elongation factor 1 homolog OS=Oryza sativa subsp. japonica GN=Os07g0631100 PE=3 SV=1 1 81 7.0E-19
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O13868|ELOF1_SCHPO Transcription elongation factor 1 homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1B3.02c PE=1 SV=1 1 84 2.0E-28
sp|P36053|ELF1_YEAST Transcription elongation factor 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ELF1 PE=1 SV=1 1 81 2.0E-25
sp|Q9XVZ8|ELOF1_CAEEL Transcription elongation factor 1 homolog OS=Caenorhabditis elegans GN=Y54G11A.11 PE=3 SV=1 1 79 4.0E-24
sp|Q8MQI6|ELOF1_DROME Transcription elongation factor 1 homolog OS=Drosophila melanogaster GN=CG40228 PE=1 SV=1 1 80 3.0E-20
sp|Q8LHP0|ELOF1_ORYSJ Transcription elongation factor 1 homolog OS=Oryza sativa subsp. japonica GN=Os07g0631100 PE=3 SV=1 1 81 7.0E-19
sp|Q9U501|ELOF1_MANSE Transcription elongation factor 1 homolog OS=Manduca sexta PE=3 SV=1 1 80 3.0E-18
sp|Q8LEF3|ELOF1_ARATH Transcription elongation factor 1 homolog OS=Arabidopsis thaliana GN=At5g46030 PE=2 SV=1 1 81 4.0E-17
sp|Q54KR5|ELOF1_DICDI Transcription elongation factor 1 homolog OS=Dictyostelium discoideum GN=elof1 PE=3 SV=1 1 81 8.0E-17
sp|P60003|ELOF1_MOUSE Transcription elongation factor 1 homolog OS=Mus musculus GN=Elof1 PE=1 SV=1 20 80 1.0E-16
sp|P60002|ELOF1_HUMAN Transcription elongation factor 1 homolog OS=Homo sapiens GN=ELOF1 PE=3 SV=1 20 80 1.0E-16
sp|A4IFR3|ELOF1_BOVIN Transcription elongation factor 1 homolog OS=Bos taurus GN=ELOF1 PE=3 SV=1 20 80 1.0E-16
sp|Q8STS7|ELOF1_ENCCU Transcription elongation factor 1 homolog OS=Encephalitozoon cuniculi (strain GB-M1) GN=ECU09_0850 PE=3 SV=2 1 76 1.0E-09
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 13 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|5808
MGKRKKSSRKPMGPKKSDPLPTTFTCLFCNHERSVTVKLDRKAGVGQLDCRICGQRFQCSVNYLSAAVDVYGEWV
DAADAVAKEHPANSGDHSITAISSGMRASRSDGGDDDNENEL*
Coding >OphauB2|5808
ATGGGTAAGCGCAAGAAATCTTCGAGGAAACCAATGGGTCCTAAAAAGTCCGACCCATTGCCTACCACCTTCACC
TGTCTCTTTTGCAATCACGAAAGATCCGTTACTGTCAAGCTTGACCGAAAAGCTGGTGTCGGTCAGCTCGATTGC
CGCATTTGTGGGCAGAGATTTCAATGCTCTGTTAATTATCTGTCTGCCGCTGTTGACGTATATGGAGAGTGGGTT
GATGCCGCAGATGCCGTCGCCAAAGAACATCCGGCCAATTCTGGCGACCATTCCATAACTGCTATTTCAAGCGGT
ATGCGCGCTTCCCGATCTGACGGTGGTGATGACGACAACGAAAATGAATTATAA
Transcript >OphauB2|5808
ATGGGTAAGCGCAAGAAATCTTCGAGGAAACCAATGGGTCCTAAAAAGTCCGACCCATTGCCTACCACCTTCACC
TGTCTCTTTTGCAATCACGAAAGATCCGTTACTGTCAAGCTTGACCGAAAAGCTGGTGTCGGTCAGCTCGATTGC
CGCATTTGTGGGCAGAGATTTCAATGCTCTGTTAATTATCTGTCTGCCGCTGTTGACGTATATGGAGAGTGGGTT
GATGCCGCAGATGCCGTCGCCAAAGAACATCCGGCCAATTCTGGCGACCATTCCATAACTGCTATTTCAAGCGGT
ATGCGCGCTTCCCGATCTGACGGTGGTGATGACGACAACGAAAATGAATTATAA
Gene >OphauB2|5808
ATGGGTAAGCGCAAGAAATCTTCGAGGAAACCAATGGGTCCTAAAAAGGTAGGTCACACAAAATTTACTACCGTA
ACCGCACTACACCGCTAGGCCTCTCTCGACCCGTTCCTATGCACAGTATCGCCATCACATACTCGTCATTTAGAA
TCTTCATAACATTCTATTATAGTCCGACCCATTGCCTACCACCTTCACCTGTCTCTTTTGCAATCACGAAAGATC
CGTTACTGTCAAGCTTGACCGAAAAGCTGGTGTCGGTCAGCTCGATTGCCGCATTTGTGGGCAGAGATTTCAATG
CTCTGTTAATTGTTCGTACCCCATTACCATAGACCGGCCATTTTATAATCACACTATCAATCACAACATTGACCA
TCTTTGGCTCAGATCTGTCTGCCGCTGTTGACGTATATGGAGAGTGGGTTGATGCCGCAGGTTCGTATGAAACAA
TCTTCAACCCGACTGGTCGAGGCCTCCTAGACCAGTTACTCAACTATCTTCTCTATAGATGCCGTCGCCAAAGAA
CATCCGGCCAATTCTGGCGACCATTCCATAACTGCTATTTCAAGCGGTATGCGCGCTTCCCGATCTGACGGTGGT
GATGACGACAACGAAAATGAATTATAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail