Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|5804
Gene name
LocationContig_48:120396..121758
Strand-
Gene length (bp)1362
Transcript length (bp)1362
Coding sequence length (bp)1362
Protein length (aa) 454

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02537 CRCB CrcB-like protein, Camphor Resistance (CrcB) 1.1E-11 110 249
PF02537 CRCB CrcB-like protein, Camphor Resistance (CrcB) 5.7E-23 329 437

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q9UTS8|YI7B_SCHPO UPF0695 membrane protein C977.11/PB8B6.06c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC977.11 PE=3 SV=1 103 449 4.0E-34
sp|Q08913|YO390_YEAST UPF0695 membrane protein YOR390W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YOR390W PE=3 SV=1 113 452 1.0E-26
sp|Q08991|YP279_YEAST UPF0695 membrane protein YPL279C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YPL279C PE=3 SV=1 113 452 5.0E-26

GO

GO Term Description Terminal node
GO:0016021 integral component of membrane Yes
GO:0005575 cellular_component No
GO:0044425 membrane part No
GO:0031224 intrinsic component of membrane No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 44 0.45

Transmembrane Domains

Domain # Start End Length
1 105 127 22
2 132 154 22
3 200 222 22
4 252 274 22
5 295 317 22
6 327 348 21
7 355 377 22
8 392 414 22
9 421 443 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|5804
MEPTAPSHGVDSRKHTPNANQHASNANQQPYSVPDRWTNLDELAAPSPVENVADAPIHHTSLEAARSQDQNRTRS
ANIGLAALDEDVPKDASQLRRVSARATQLYTISHLVFFSLLGTLARLGLTALTRYPNAPVIFSTVWANFGGSLVM
GFLAEDRALFRQEWGTLPVQVGTDANRVGTSQDAAAAEAAKKAHLATKKTIPLYIGLATGFCGSFTSFSSFVRDI
FLAMSNDLVAPGPGQSVAVGRNGGYSFMAMLAVIIATLALSLGGLVIGAHVAIAWAPMMPVIPYKFSRRLADPLV
VLVAWGCWLGAVLLSIFPPHDFWRGRATFALVFAPPGCLLRFYLSLLLNAKAKAFPLGTFTANILGTALLAMAWD
LAHGQVGGVGGCQVLQGIQDGFCGCLTTVSTWVAELNGLQRRSAHVYGVASVAVAFALTVIIMGGMRWTRGFDSL
LCH*
Coding >OphauB2|5804
ATGGAGCCCACGGCGCCCAGCCATGGCGTCGATTCTCGAAAACACACACCCAATGCAAATCAACACGCATCCAAC
GCCAACCAGCAACCCTATAGCGTGCCAGACCGCTGGACCAATCTCGACGAGCTAGCTGCACCGAGCCCCGTGGAA
AATGTCGCCGACGCGCCTATACACCACACCAGCCTCGAGGCGGCGCGCAGCCAGGACCAGAACCGGACAAGGAGT
GCAAATATCGGCCTGGCGGCGCTAGACGAGGATGTACCCAAGGATGCTTCACAGCTGCGCCGCGTCTCGGCTCGG
GCGACGCAGCTGTACACCATTTCACACCTCGTCTTCTTCTCCTTGCTCGGCACTCTGGCCCGGCTTGGTCTCACG
GCGCTGACGCGGTATCCCAACGCGCCCGTAATTTTTAGCACAGTATGGGCCAATTTTGGAGGGAGCCTCGTCATG
GGCTTCTTGGCCGAGGACCGCGCCCTCTTTCGCCAGGAGTGGGGGACGCTGCCGGTGCAAGTCGGGACAGACGCG
AATCGAGTCGGCACCAGCCAAGACGCTGCTGCGGCAGAGGCGGCGAAAAAGGCGCACTTGGCCACCAAGAAGACC
ATCCCCCTCTACATTGGCCTGGCGACTGGCTTCTGCGGCAGCTTCACCAGCTTCTCGAGCTTTGTGCGCGACATC
TTCTTGGCCATGTCCAACGACTTGGTAGCGCCTGGGCCTGGGCAGTCGGTTGCAGTGGGCCGCAACGGCGGCTAT
TCCTTCATGGCCATGCTGGCCGTGATTATTGCCACTCTTGCCCTCTCCCTCGGCGGCCTCGTCATTGGGGCCCAT
GTGGCCATTGCTTGGGCACCCATGATGCCCGTCATCCCATACAAATTTAGCCGCCGACTGGCTGATCCCTTGGTC
GTTCTTGTCGCCTGGGGCTGCTGGCTAGGCGCCGTCTTGCTCTCCATATTTCCTCCCCATGATTTCTGGCGCGGA
CGAGCCACCTTTGCACTGGTATTCGCGCCTCCGGGGTGTCTGCTGCGCTTCTACCTATCGCTGCTGCTCAATGCC
AAGGCCAAGGCGTTTCCCCTGGGGACCTTTACCGCCAATATACTGGGCACTGCACTACTGGCCATGGCATGGGAC
CTGGCGCACGGACAGGTGGGAGGCGTGGGTGGCTGCCAGGTGCTGCAGGGGATCCAAGACGGCTTCTGCGGATGC
TTGACGACGGTGTCGACATGGGTGGCTGAGCTGAATGGCCTGCAGCGGCGCAGTGCCCATGTGTATGGAGTGGCT
AGTGTTGCTGTTGCGTTTGCTCTCACGGTAATCATTATGGGCGGCATGCGCTGGACTCGTGGCTTTGACTCGTTG
CTCTGCCATTGA
Transcript >OphauB2|5804
ATGGAGCCCACGGCGCCCAGCCATGGCGTCGATTCTCGAAAACACACACCCAATGCAAATCAACACGCATCCAAC
GCCAACCAGCAACCCTATAGCGTGCCAGACCGCTGGACCAATCTCGACGAGCTAGCTGCACCGAGCCCCGTGGAA
AATGTCGCCGACGCGCCTATACACCACACCAGCCTCGAGGCGGCGCGCAGCCAGGACCAGAACCGGACAAGGAGT
GCAAATATCGGCCTGGCGGCGCTAGACGAGGATGTACCCAAGGATGCTTCACAGCTGCGCCGCGTCTCGGCTCGG
GCGACGCAGCTGTACACCATTTCACACCTCGTCTTCTTCTCCTTGCTCGGCACTCTGGCCCGGCTTGGTCTCACG
GCGCTGACGCGGTATCCCAACGCGCCCGTAATTTTTAGCACAGTATGGGCCAATTTTGGAGGGAGCCTCGTCATG
GGCTTCTTGGCCGAGGACCGCGCCCTCTTTCGCCAGGAGTGGGGGACGCTGCCGGTGCAAGTCGGGACAGACGCG
AATCGAGTCGGCACCAGCCAAGACGCTGCTGCGGCAGAGGCGGCGAAAAAGGCGCACTTGGCCACCAAGAAGACC
ATCCCCCTCTACATTGGCCTGGCGACTGGCTTCTGCGGCAGCTTCACCAGCTTCTCGAGCTTTGTGCGCGACATC
TTCTTGGCCATGTCCAACGACTTGGTAGCGCCTGGGCCTGGGCAGTCGGTTGCAGTGGGCCGCAACGGCGGCTAT
TCCTTCATGGCCATGCTGGCCGTGATTATTGCCACTCTTGCCCTCTCCCTCGGCGGCCTCGTCATTGGGGCCCAT
GTGGCCATTGCTTGGGCACCCATGATGCCCGTCATCCCATACAAATTTAGCCGCCGACTGGCTGATCCCTTGGTC
GTTCTTGTCGCCTGGGGCTGCTGGCTAGGCGCCGTCTTGCTCTCCATATTTCCTCCCCATGATTTCTGGCGCGGA
CGAGCCACCTTTGCACTGGTATTCGCGCCTCCGGGGTGTCTGCTGCGCTTCTACCTATCGCTGCTGCTCAATGCC
AAGGCCAAGGCGTTTCCCCTGGGGACCTTTACCGCCAATATACTGGGCACTGCACTACTGGCCATGGCATGGGAC
CTGGCGCACGGACAGGTGGGAGGCGTGGGTGGCTGCCAGGTGCTGCAGGGGATCCAAGACGGCTTCTGCGGATGC
TTGACGACGGTGTCGACATGGGTGGCTGAGCTGAATGGCCTGCAGCGGCGCAGTGCCCATGTGTATGGAGTGGCT
AGTGTTGCTGTTGCGTTTGCTCTCACGGTAATCATTATGGGCGGCATGCGCTGGACTCGTGGCTTTGACTCGTTG
CTCTGCCATTGA
Gene >OphauB2|5804
ATGGAGCCCACGGCGCCCAGCCATGGCGTCGATTCTCGAAAACACACACCCAATGCAAATCAACACGCATCCAAC
GCCAACCAGCAACCCTATAGCGTGCCAGACCGCTGGACCAATCTCGACGAGCTAGCTGCACCGAGCCCCGTGGAA
AATGTCGCCGACGCGCCTATACACCACACCAGCCTCGAGGCGGCGCGCAGCCAGGACCAGAACCGGACAAGGAGT
GCAAATATCGGCCTGGCGGCGCTAGACGAGGATGTACCCAAGGATGCTTCACAGCTGCGCCGCGTCTCGGCTCGG
GCGACGCAGCTGTACACCATTTCACACCTCGTCTTCTTCTCCTTGCTCGGCACTCTGGCCCGGCTTGGTCTCACG
GCGCTGACGCGGTATCCCAACGCGCCCGTAATTTTTAGCACAGTATGGGCCAATTTTGGAGGGAGCCTCGTCATG
GGCTTCTTGGCCGAGGACCGCGCCCTCTTTCGCCAGGAGTGGGGGACGCTGCCGGTGCAAGTCGGGACAGACGCG
AATCGAGTCGGCACCAGCCAAGACGCTGCTGCGGCAGAGGCGGCGAAAAAGGCGCACTTGGCCACCAAGAAGACC
ATCCCCCTCTACATTGGCCTGGCGACTGGCTTCTGCGGCAGCTTCACCAGCTTCTCGAGCTTTGTGCGCGACATC
TTCTTGGCCATGTCCAACGACTTGGTAGCGCCTGGGCCTGGGCAGTCGGTTGCAGTGGGCCGCAACGGCGGCTAT
TCCTTCATGGCCATGCTGGCCGTGATTATTGCCACTCTTGCCCTCTCCCTCGGCGGCCTCGTCATTGGGGCCCAT
GTGGCCATTGCTTGGGCACCCATGATGCCCGTCATCCCATACAAATTTAGCCGCCGACTGGCTGATCCCTTGGTC
GTTCTTGTCGCCTGGGGCTGCTGGCTAGGCGCCGTCTTGCTCTCCATATTTCCTCCCCATGATTTCTGGCGCGGA
CGAGCCACCTTTGCACTGGTATTCGCGCCTCCGGGGTGTCTGCTGCGCTTCTACCTATCGCTGCTGCTCAATGCC
AAGGCCAAGGCGTTTCCCCTGGGGACCTTTACCGCCAATATACTGGGCACTGCACTACTGGCCATGGCATGGGAC
CTGGCGCACGGACAGGTGGGAGGCGTGGGTGGCTGCCAGGTGCTGCAGGGGATCCAAGACGGCTTCTGCGGATGC
TTGACGACGGTGTCGACATGGGTGGCTGAGCTGAATGGCCTGCAGCGGCGCAGTGCCCATGTGTATGGAGTGGCT
AGTGTTGCTGTTGCGTTTGCTCTCACGGTAATCATTATGGGCGGCATGCGCTGGACTCGTGGCTTTGACTCGTTG
CTCTGCCATTGA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail