Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|5803
Gene name
LocationContig_48:118778..119684
Strand-
Gene length (bp)906
Transcript length (bp)771
Coding sequence length (bp)771
Protein length (aa) 257

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF14497 GST_C_3 Glutathione S-transferase, C-terminal domain 1.2E-26 120 233

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q8MU52|GST_PLAFA Glutathione S-transferase OS=Plasmodium falciparum GN=GST PE=1 SV=1 8 238 2.0E-12
sp|Q8ILQ7|GST_PLAF7 Glutathione S-transferase OS=Plasmodium falciparum (isolate 3D7) GN=GST PE=3 SV=1 8 238 2.0E-12
sp|Q8JFZ2|GSTP1_XENLA Glutathione S-transferase P 1 OS=Xenopus laevis GN=gstp1 PE=1 SV=1 4 237 7.0E-10
sp|Q7REH6|GST_PLAYO Glutathione S-transferase OS=Plasmodium yoelii yoelii GN=GST PE=3 SV=1 16 238 1.0E-09
sp|Q0ZS46|GST_PLAVI Glutathione S-transferase OS=Plasmodium vivax GN=GST PE=2 SV=1 8 238 4.0E-09
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q8MU52|GST_PLAFA Glutathione S-transferase OS=Plasmodium falciparum GN=GST PE=1 SV=1 8 238 2.0E-12
sp|Q8ILQ7|GST_PLAF7 Glutathione S-transferase OS=Plasmodium falciparum (isolate 3D7) GN=GST PE=3 SV=1 8 238 2.0E-12
sp|Q8JFZ2|GSTP1_XENLA Glutathione S-transferase P 1 OS=Xenopus laevis GN=gstp1 PE=1 SV=1 4 237 7.0E-10
sp|Q7REH6|GST_PLAYO Glutathione S-transferase OS=Plasmodium yoelii yoelii GN=GST PE=3 SV=1 16 238 1.0E-09
sp|Q0ZS46|GST_PLAVI Glutathione S-transferase OS=Plasmodium vivax GN=GST PE=2 SV=1 8 238 4.0E-09
sp|P46426|GSTP_DIRIM Glutathione S-transferase OS=Dirofilaria immitis PE=2 SV=1 6 237 8.0E-09
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 58 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|5803
MAQPEYELIYWPKLIGRGEFIRLVFEEAGTAYTDSSRQPDAIPHLISFTSTSNKGDARNPPVLACPILKHGDFYI
SQLPNILLYLGQQLGLVPDGAATHALFHMNAIALTLLEGLCDEAHDSHHPIASSIYYEEQKDEAARRTREYLSKR
LPQFMTYIQRLLEAETSAQHGPWLYGEKLTYIDIVLFQCIDGVEYAFPSAVKRLRESGLYNAVFELHQAVMQRPR
IKEYLASERRNKYGECIWRFYPDLQEEVLMK*
Coding >OphauB2|5803
ATGGCCCAGCCCGAGTACGAGCTCATATACTGGCCCAAGCTCATTGGCCGCGGCGAATTCATCCGCCTCGTGTTT
GAAGAAGCCGGCACGGCCTATACCGACTCGTCTCGCCAACCCGACGCCATTCCCCACCTCATTTCATTCACGTCC
ACCTCCAACAAGGGCGACGCGCGCAACCCCCCCGTGCTCGCGTGTCCCATCCTCAAGCACGGCGACTTTTACATT
AGCCAGCTACCAAACATTCTCCTATACCTTGGCCAGCAGCTCGGCCTGGTGCCCGACGGAGCAGCCACGCATGCC
CTATTCCACATGAATGCCATTGCGCTGACGCTCCTCGAGGGCCTGTGCGACGAGGCGCACGACTCGCACCATCCC
ATTGCCTCGTCGATTTACTATGAAGAACAAAAGGACGAGGCGGCGCGGCGGACGCGCGAGTACTTGTCAAAGCGC
CTGCCGCAGTTTATGACGTATATCCAACGACTGCTCGAGGCTGAGACGAGTGCCCAGCATGGACCGTGGCTGTAT
GGCGAGAAGCTGACGTATATCGACATTGTTCTCTTTCAGTGCATTGATGGCGTCGAGTATGCGTTTCCGTCGGCC
GTCAAGCGCCTCAGAGAGTCGGGCCTGTACAACGCCGTCTTTGAGCTGCACCAAGCTGTCATGCAGCGGCCCCGC
ATCAAGGAATACCTGGCGAGCGAACGACGCAACAAGTACGGGGAATGCATTTGGCGATTTTACCCCGATTTGCAA
GAAGAAGTCTTGATGAAGTAA
Transcript >OphauB2|5803
ATGGCCCAGCCCGAGTACGAGCTCATATACTGGCCCAAGCTCATTGGCCGCGGCGAATTCATCCGCCTCGTGTTT
GAAGAAGCCGGCACGGCCTATACCGACTCGTCTCGCCAACCCGACGCCATTCCCCACCTCATTTCATTCACGTCC
ACCTCCAACAAGGGCGACGCGCGCAACCCCCCCGTGCTCGCGTGTCCCATCCTCAAGCACGGCGACTTTTACATT
AGCCAGCTACCAAACATTCTCCTATACCTTGGCCAGCAGCTCGGCCTGGTGCCCGACGGAGCAGCCACGCATGCC
CTATTCCACATGAATGCCATTGCGCTGACGCTCCTCGAGGGCCTGTGCGACGAGGCGCACGACTCGCACCATCCC
ATTGCCTCGTCGATTTACTATGAAGAACAAAAGGACGAGGCGGCGCGGCGGACGCGCGAGTACTTGTCAAAGCGC
CTGCCGCAGTTTATGACGTATATCCAACGACTGCTCGAGGCTGAGACGAGTGCCCAGCATGGACCGTGGCTGTAT
GGCGAGAAGCTGACGTATATCGACATTGTTCTCTTTCAGTGCATTGATGGCGTCGAGTATGCGTTTCCGTCGGCC
GTCAAGCGCCTCAGAGAGTCGGGCCTGTACAACGCCGTCTTTGAGCTGCACCAAGCTGTCATGCAGCGGCCCCGC
ATCAAGGAATACCTGGCGAGCGAACGACGCAACAAGTACGGGGAATGCATTTGGCGATTTTACCCCGATTTGCAA
GAAGAAGTCTTGATGAAGTAA
Gene >OphauB2|5803
ATGGCCCAGCCCGAGTACGAGCTCATATACTGGCCCAAGCTCATTGGCCGCGGCGAATTCATCCGCCTCGTGTTT
GAAGAAGCCGGCACGGCCTATACCGACTCGTCTCGCCAACCCGACGCCATTCCCCACCTCATTTCATTCACGTCC
ACCTCCAACAAGGGCGACGCGCGCAACCCCCCCGTGCTCGCGTGTCCCATCCTCAAGCACGGCGACTTTTACATT
AGCCAGCTACCAAACATTCTCCTATACCTTGGCCAGCAGCTCGGCCTGGTGCCCGACGGAGCAGCCACGCATGCC
CTATTCCACATGAATGCCATTGCGCTGACGCTCCTCGAGGGCCTGTGCGACGAGGCGCACGACTCGCACCATCCC
ATTGCCTCGTCGATTTACTATGAAGAACAAAAGGACGAGGCGGCGCGGCGGACGCGCGAGTACTTGTCAAAGCGC
CTGCCGCAGTTTATGACGTATATCCAACGACTGCTCGAGGCTGAGACGAGTGCCCAGCATGGACCGTGGCTGTAT
GGCGAGAAGCTGACGTATATCGACATTGTTCTCTTTCAGGCAAGCCCATGGTTTTCTCTTTGCCTAGACTTGCTC
CCGGGGTTGAGACCTCTAGTCTACTACCCATGGTTTTTTTAAAAAAAAAAGAAAACTCTCTGCTATTTTTTTTTA
ATCGGATTGCTGACTTTGGCATAGTGCATTGATGGCGTCGAGTATGCGTTTCCGTCGGCCGTCAAGCGCCTCAGA
GAGTCGGGCCTGTACAACGCCGTCTTTGAGCTGCACCAAGCTGTCATGCAGCGGCCCCGCATCAAGGAATACCTG
GCGAGCGAACGACGCAACAAGTACGGGGAATGCATTTGGCGATTTTACCCCGATTTGCAAGAAGAAGTCTTGATG
AAGTAA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail