Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|5802
Gene name
LocationContig_48:115098..118121
Strand-
Gene length (bp)3023
Transcript length (bp)2889
Coding sequence length (bp)2889
Protein length (aa) 963

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07969 Amidohydro_3 Amidohydrolase family 9.2E-09 460 516
PF01979 Amidohydro_1 Amidohydrolase family 2.7E-07 451 529

Swissprot hits

(None)

GO

GO Term Description Terminal node
GO:0016787 hydrolase activity Yes
GO:0003674 molecular_function No
GO:0003824 catalytic activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 40 0.5

Transmembrane Domains

Domain # Start End Length
1 21 43 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|5802
MKGKSQPPPAIRRRIRNHLRLRRSLSLLSLSLLAIIAFSQWHQAWHTPSHHAPHLSRQQLERDLATCQQLRVKPS
DPPGPGRRQSERYGDWKPTLIRNATVWTGEPRRGTSEHEARRGEGWEWVRANVWLERGLITRVDVRHGNDEEREV
TIPDNMLVYDAHGRQLTAGIIDMHSHAGVASLPQVQGNDDTNEMSENITPWARSIDGLMPLDPQLQIIKSGGVTT
SLILPGSGNNIGGEAYVVKHAIGHPDGRPELSAADMLADKTRSWRYIKMACGENAKRAYGSKGKRPVSRMGESFD
FRRAFEQARGLVRRQNDWCARAERGLAGVEEYLPQELAWETLAAVLRGQVLVNTHCYTVPDFEAMVDHSNEFEFA
IRAFHHAHQTFLVPELLNRTWGGRPPSSALFADSMYYKMESYIGTPHAGKILYDAGLTPIYVSDNPVLNAQHVVF
EAAKAYRYGLPYHAALASVTSAPANELGLGQRLGKVKPGFDADVVVWDSDPLSVGATPMQVWIDGRAQFEEPFVL
DKPNRGPIKPDESLQQIDDDDDDEPVEAKHAVFTGVEKVLLEQDYGSQDGHSIFDKTLTKTFNAVVTDGKLSCIG
ACTAQVQAATAAGAPTSHLRNGYITHSLTGAAGLLGLNDIDAEPSTENGNNAEKFTRAVDALQLGGKKLRAGARY
GVTRAISAPKLNDGSTHHGTSVGFVTTAKTSLDEGAVFAQDVAVHYTLDLAVRPEKSYSDVFGELRHKLLAAVAA
IAKENKAGDAPDAYSEAAQLKKVVGGEMVLALTIHSADGIATALRIKHEIDTAMHTTHQSNTTMRMAIIGGSEAH
LVASHLAAANTGVILTPPRPYTSRWDMRRALPGAPLTNGTVADWLADAGVPIALGLAEDYMVRHLGLDAGTAWRN
GGGRWDEKRALDLVSVNVEAILGVQASRAGHFVVSEQSPLETWSRVVAVGAGGGSVALYGSG*
Coding >OphauB2|5802
ATGAAGGGCAAAAGCCAGCCTCCCCCCGCCATCCGTCGGCGCATCCGCAACCACCTTCGCCTTCGCCGCTCCCTC
TCGCTCTTGAGCCTCTCGCTGCTCGCCATTATTGCCTTTTCACAATGGCATCAAGCCTGGCACACACCCAGCCAC
CACGCCCCCCATCTTTCGCGGCAGCAGCTTGAGCGCGACCTGGCCACGTGCCAGCAGCTACGCGTCAAGCCGTCT
GATCCCCCCGGGCCAGGCCGGCGGCAGAGCGAGCGCTACGGCGACTGGAAGCCCACGCTGATTCGCAATGCTACG
GTGTGGACGGGCGAGCCGAGACGCGGCACGTCGGAGCACGAGGCGCGTCGAGGCGAGGGATGGGAATGGGTGCGT
GCAAATGTCTGGCTGGAGCGGGGGCTGATTACCCGAGTCGACGTGCGTCATGGAAATGACGAGGAAAGAGAGGTC
ACGATTCCGGATAACATGCTCGTCTACGATGCTCACGGACGGCAGCTGACGGCGGGCATCATTGACATGCATAGC
CATGCTGGCGTCGCCTCTCTTCCTCAAGTCCAAGGCAACGACGACACTAATGAAATGTCTGAAAACATCACCCCC
TGGGCCCGCTCCATTGACGGCCTCATGCCCCTTGACCCCCAACTGCAAATCATCAAATCCGGCGGCGTAACCACA
TCCCTCATCCTCCCCGGCTCCGGCAACAATATCGGCGGCGAAGCCTACGTCGTCAAGCACGCCATTGGCCACCCC
GACGGCCGCCCCGAGCTCAGCGCCGCAGACATGCTCGCCGACAAGACGCGCTCCTGGCGCTACATCAAAATGGCA
TGCGGCGAGAATGCAAAGCGCGCCTATGGCTCCAAGGGGAAGAGGCCCGTGAGCCGCATGGGCGAGAGCTTCGAT
TTCCGACGGGCGTTTGAGCAGGCGCGCGGCTTGGTGCGGCGGCAGAATGACTGGTGTGCCAGGGCGGAGAGGGGG
CTGGCGGGCGTGGAGGAGTATTTGCCGCAAGAGCTGGCCTGGGAGACGCTGGCGGCGGTGCTGCGTGGCCAGGTG
CTGGTTAATACGCACTGCTATACCGTGCCGGATTTCGAGGCCATGGTGGACCATTCCAACGAGTTTGAGTTTGCT
ATTCGGGCTTTTCACCACGCTCATCAGACCTTTCTCGTGCCCGAGCTGCTCAACCGCACCTGGGGAGGCCGCCCC
CCCTCGTCGGCCCTCTTTGCCGACTCCATGTACTACAAGATGGAATCCTACATTGGCACGCCGCACGCCGGCAAG
ATTCTCTACGACGCAGGCCTCACCCCCATCTACGTGAGCGACAACCCCGTGCTCAATGCCCAGCACGTGGTGTTT
GAAGCGGCAAAGGCCTACCGCTACGGCCTGCCCTACCACGCCGCCCTGGCCAGCGTCACCTCTGCGCCCGCCAAC
GAGCTGGGTCTGGGCCAGCGCCTGGGCAAGGTCAAGCCGGGCTTTGATGCCGATGTGGTTGTCTGGGACAGCGAT
CCGCTGAGCGTGGGTGCGACGCCCATGCAGGTCTGGATTGATGGCCGGGCGCAGTTTGAAGAGCCGTTTGTGCTG
GACAAGCCCAACAGGGGGCCGATTAAGCCCGACGAGTCGCTGCAGCAGATTGACGACGACGACGACGACGAGCCA
GTCGAGGCAAAGCATGCCGTCTTTACTGGTGTGGAAAAGGTGCTGCTGGAGCAAGACTATGGGAGCCAAGACGGC
CACAGCATTTTCGACAAGACGCTGACCAAGACGTTTAACGCAGTCGTCACCGACGGCAAGCTATCCTGCATTGGC
GCCTGCACAGCTCAAGTGCAAGCCGCCACTGCTGCGGGCGCCCCAACAAGCCATTTGCGCAACGGCTACATTACG
CACTCGCTCACCGGCGCGGCGGGCCTCCTCGGCCTCAACGACATTGACGCCGAGCCAAGCACGGAAAACGGCAAC
AATGCCGAGAAATTCACGCGCGCCGTCGACGCCCTCCAGCTGGGCGGCAAGAAGCTGCGCGCGGGCGCCCGCTAC
GGCGTAACGAGGGCCATTTCAGCGCCCAAGCTCAACGACGGGTCGACACACCACGGCACCAGCGTCGGCTTCGTA
ACAACAGCCAAGACGAGCCTCGACGAGGGCGCCGTGTTTGCGCAGGACGTGGCGGTGCACTACACGCTCGACTTG
GCGGTGCGGCCGGAAAAGAGCTACTCGGACGTCTTTGGCGAGCTGCGGCACAAGCTCCTGGCAGCCGTGGCAGCC
ATTGCCAAAGAGAACAAGGCAGGTGACGCGCCAGATGCCTATTCCGAAGCAGCCCAGCTCAAAAAAGTCGTGGGG
GGCGAAATGGTGCTGGCCCTCACCATCCACAGCGCCGACGGCATCGCCACCGCCCTCCGCATCAAGCACGAAATC
GACACCGCCATGCACACCACGCACCAAAGCAACACCACCATGCGCATGGCCATTATCGGCGGCTCAGAAGCCCAC
CTCGTCGCCTCCCACCTCGCCGCAGCAAACACTGGCGTCATCCTCACGCCTCCCCGCCCCTACACCTCGCGCTGG
GACATGCGCCGCGCCCTCCCCGGCGCGCCCCTCACCAACGGCACCGTGGCGGACTGGCTGGCCGACGCGGGCGTC
CCCATTGCTCTAGGCCTGGCCGAGGACTACATGGTGCGCCACCTGGGGCTCGATGCCGGCACGGCGTGGCGCAAC
GGGGGGGGACGCTGGGACGAGAAGCGCGCGCTGGACCTGGTGAGTGTAAATGTAGAGGCCATTCTGGGCGTGCAG
GCGTCGCGCGCAGGCCATTTTGTGGTGAGTGAGCAGAGTCCGTTGGAGACGTGGTCGCGAGTCGTGGCTGTGGGG
GCGGGGGGAGGGAGCGTGGCGCTCTATGGAAGCGGGTAA
Transcript >OphauB2|5802
ATGAAGGGCAAAAGCCAGCCTCCCCCCGCCATCCGTCGGCGCATCCGCAACCACCTTCGCCTTCGCCGCTCCCTC
TCGCTCTTGAGCCTCTCGCTGCTCGCCATTATTGCCTTTTCACAATGGCATCAAGCCTGGCACACACCCAGCCAC
CACGCCCCCCATCTTTCGCGGCAGCAGCTTGAGCGCGACCTGGCCACGTGCCAGCAGCTACGCGTCAAGCCGTCT
GATCCCCCCGGGCCAGGCCGGCGGCAGAGCGAGCGCTACGGCGACTGGAAGCCCACGCTGATTCGCAATGCTACG
GTGTGGACGGGCGAGCCGAGACGCGGCACGTCGGAGCACGAGGCGCGTCGAGGCGAGGGATGGGAATGGGTGCGT
GCAAATGTCTGGCTGGAGCGGGGGCTGATTACCCGAGTCGACGTGCGTCATGGAAATGACGAGGAAAGAGAGGTC
ACGATTCCGGATAACATGCTCGTCTACGATGCTCACGGACGGCAGCTGACGGCGGGCATCATTGACATGCATAGC
CATGCTGGCGTCGCCTCTCTTCCTCAAGTCCAAGGCAACGACGACACTAATGAAATGTCTGAAAACATCACCCCC
TGGGCCCGCTCCATTGACGGCCTCATGCCCCTTGACCCCCAACTGCAAATCATCAAATCCGGCGGCGTAACCACA
TCCCTCATCCTCCCCGGCTCCGGCAACAATATCGGCGGCGAAGCCTACGTCGTCAAGCACGCCATTGGCCACCCC
GACGGCCGCCCCGAGCTCAGCGCCGCAGACATGCTCGCCGACAAGACGCGCTCCTGGCGCTACATCAAAATGGCA
TGCGGCGAGAATGCAAAGCGCGCCTATGGCTCCAAGGGGAAGAGGCCCGTGAGCCGCATGGGCGAGAGCTTCGAT
TTCCGACGGGCGTTTGAGCAGGCGCGCGGCTTGGTGCGGCGGCAGAATGACTGGTGTGCCAGGGCGGAGAGGGGG
CTGGCGGGCGTGGAGGAGTATTTGCCGCAAGAGCTGGCCTGGGAGACGCTGGCGGCGGTGCTGCGTGGCCAGGTG
CTGGTTAATACGCACTGCTATACCGTGCCGGATTTCGAGGCCATGGTGGACCATTCCAACGAGTTTGAGTTTGCT
ATTCGGGCTTTTCACCACGCTCATCAGACCTTTCTCGTGCCCGAGCTGCTCAACCGCACCTGGGGAGGCCGCCCC
CCCTCGTCGGCCCTCTTTGCCGACTCCATGTACTACAAGATGGAATCCTACATTGGCACGCCGCACGCCGGCAAG
ATTCTCTACGACGCAGGCCTCACCCCCATCTACGTGAGCGACAACCCCGTGCTCAATGCCCAGCACGTGGTGTTT
GAAGCGGCAAAGGCCTACCGCTACGGCCTGCCCTACCACGCCGCCCTGGCCAGCGTCACCTCTGCGCCCGCCAAC
GAGCTGGGTCTGGGCCAGCGCCTGGGCAAGGTCAAGCCGGGCTTTGATGCCGATGTGGTTGTCTGGGACAGCGAT
CCGCTGAGCGTGGGTGCGACGCCCATGCAGGTCTGGATTGATGGCCGGGCGCAGTTTGAAGAGCCGTTTGTGCTG
GACAAGCCCAACAGGGGGCCGATTAAGCCCGACGAGTCGCTGCAGCAGATTGACGACGACGACGACGACGAGCCA
GTCGAGGCAAAGCATGCCGTCTTTACTGGTGTGGAAAAGGTGCTGCTGGAGCAAGACTATGGGAGCCAAGACGGC
CACAGCATTTTCGACAAGACGCTGACCAAGACGTTTAACGCAGTCGTCACCGACGGCAAGCTATCCTGCATTGGC
GCCTGCACAGCTCAAGTGCAAGCCGCCACTGCTGCGGGCGCCCCAACAAGCCATTTGCGCAACGGCTACATTACG
CACTCGCTCACCGGCGCGGCGGGCCTCCTCGGCCTCAACGACATTGACGCCGAGCCAAGCACGGAAAACGGCAAC
AATGCCGAGAAATTCACGCGCGCCGTCGACGCCCTCCAGCTGGGCGGCAAGAAGCTGCGCGCGGGCGCCCGCTAC
GGCGTAACGAGGGCCATTTCAGCGCCCAAGCTCAACGACGGGTCGACACACCACGGCACCAGCGTCGGCTTCGTA
ACAACAGCCAAGACGAGCCTCGACGAGGGCGCCGTGTTTGCGCAGGACGTGGCGGTGCACTACACGCTCGACTTG
GCGGTGCGGCCGGAAAAGAGCTACTCGGACGTCTTTGGCGAGCTGCGGCACAAGCTCCTGGCAGCCGTGGCAGCC
ATTGCCAAAGAGAACAAGGCAGGTGACGCGCCAGATGCCTATTCCGAAGCAGCCCAGCTCAAAAAAGTCGTGGGG
GGCGAAATGGTGCTGGCCCTCACCATCCACAGCGCCGACGGCATCGCCACCGCCCTCCGCATCAAGCACGAAATC
GACACCGCCATGCACACCACGCACCAAAGCAACACCACCATGCGCATGGCCATTATCGGCGGCTCAGAAGCCCAC
CTCGTCGCCTCCCACCTCGCCGCAGCAAACACTGGCGTCATCCTCACGCCTCCCCGCCCCTACACCTCGCGCTGG
GACATGCGCCGCGCCCTCCCCGGCGCGCCCCTCACCAACGGCACCGTGGCGGACTGGCTGGCCGACGCGGGCGTC
CCCATTGCTCTAGGCCTGGCCGAGGACTACATGGTGCGCCACCTGGGGCTCGATGCCGGCACGGCGTGGCGCAAC
GGGGGGGGACGCTGGGACGAGAAGCGCGCGCTGGACCTGGTGAGTGTAAATGTAGAGGCCATTCTGGGCGTGCAG
GCGTCGCGCGCAGGCCATTTTGTGGTGAGTGAGCAGAGTCCGTTGGAGACGTGGTCGCGAGTCGTGGCTGTGGGG
GCGGGGGGAGGGAGCGTGGCGCTCTATGGAAGCGGGTAA
Gene >OphauB2|5802
ATGAAGGGCAAAAGCCAGCCTCCCCCCGCCATCCGTCGGCGCATCCGCAACCACCTTCGCCTTCGCCGCTCCCTC
TCGCTCTTGAGCCTCTCGCTGCTCGCCATTATTGCCTTTTCACAATGGCATCAAGCCTGGCACACACCCAGCCAC
CACGCCCCCCATCTTTCGCGGCAGCAGCTTGAGCGCGACCTGGCCACGTGCCAGCAGCTACGCGTCAAGCCGTCT
GATCCCCCCGGGCCAGGCCGGCGGCAGAGCGAGCGCTACGGCGACTGGAAGCCCACGCTGATTCGCAATGCTACG
GTGTGGACGGGCGAGCCGAGACGCGGCACGTCGGAGCACGAGGCGCGTCGAGGCGAGGGATGGGAATGGGTGCGT
GCAAATGTCTGGCTGGAGCGGGGGCTGATTACCCGAGTCGACGTGCGTCATGGAAATGACGAGGAAAGAGAGGTC
ACGATTCCGGATAACATGCTCGTCTACGATGCTCACGGACGGCAGCTGACGGCGGGCATCATTGACATGCATAGC
CATGCTGGCGTCGCCTCTCTTCCTCAAGTCCAAGGCAACGACGACACTAATGAAATGTCTGAAAACATCACCCCC
TGGGCCCGCTCCATTGACGGCCTCATGCCCCTTGACCCCCAACTGCAAATCATCAAATCCGGCGGCGTAACCACA
TCCCTCATCCTCCCCGGCTCCGGCAACAATATCGGCGGCGAAGCCTACGTCGTCAAGCACGCCATTGGCCACCCC
GACGGCCGCCCCGAGCTCAGCGCCGCAGACATGCTCGCCGACAAGACGCGCTCCTGGCGCTACATCAAAATGGCA
TGCGGCGAGAATGCAAAGCGCGCCTATGGCTCCAAGGGGAAGAGGCCCGTGAGCCGCATGGGCGAGAGCTTCGAT
TTCCGACGGGCGTTTGAGCAGGCGCGCGGCTTGGTGCGGCGGCAGAATGACTGGTGTGCCAGGGCGGAGAGGGGG
CTGGCGGGCGTGGAGGAGTATTTGCCGCAAGAGCTGGCCTGGGAGACGCTGGCGGCGGTGCTGCGTGGCCAGGTG
CTGGTTAATACGCACTGCTATACCGTGCCGGATTTCGAGGCCATGGTGGACCATTCCAACGAGTTTGAGTTTGCT
ATTCGGGCTTTTCACCACGCTCATCAGACCTTTCTCGTGCCCGAGGTGAGTAGCTGCTTTTTTTTTTTTTTTCCT
TTGCTTGTCGTTTTGCTTTTTTGAATCAACTGTTGCCCTCTCTATCGCGCCTTGTCGTTTTGCTTTTTTGAATCA
ACTGTTGCCCTCTCTAACGCGCCGTGTAGCTGCTCAACCGCACCTGGGGAGGCCGCCCCCCCTCGTCGGCCCTCT
TTGCCGACTCCATGTACTACAAGATGGAATCCTACATTGGCACGCCGCACGCCGGCAAGATTCTCTACGACGCAG
GCCTCACCCCCATCTACGTGAGCGACAACCCCGTGCTCAATGCCCAGCACGTGGTGTTTGAAGCGGCAAAGGCCT
ACCGCTACGGCCTGCCCTACCACGCCGCCCTGGCCAGCGTCACCTCTGCGCCCGCCAACGAGCTGGGTCTGGGCC
AGCGCCTGGGCAAGGTCAAGCCGGGCTTTGATGCCGATGTGGTTGTCTGGGACAGCGATCCGCTGAGCGTGGGTG
CGACGCCCATGCAGGTCTGGATTGATGGCCGGGCGCAGTTTGAAGAGCCGTTTGTGCTGGACAAGCCCAACAGGG
GGCCGATTAAGCCCGACGAGTCGCTGCAGCAGATTGACGACGACGACGACGACGAGCCAGTCGAGGCAAAGCATG
CCGTCTTTACTGGTGTGGAAAAGGTGCTGCTGGAGCAAGACTATGGGAGCCAAGACGGCCACAGCATTTTCGACA
AGACGCTGACCAAGACGTTTAACGCAGTCGTCACCGACGGCAAGCTATCCTGCATTGGCGCCTGCACAGCTCAAG
TGCAAGCCGCCACTGCTGCGGGCGCCCCAACAAGCCATTTGCGCAACGGCTACATTACGCACTCGCTCACCGGCG
CGGCGGGCCTCCTCGGCCTCAACGACATTGACGCCGAGCCAAGCACGGAAAACGGCAACAATGCCGAGAAATTCA
CGCGCGCCGTCGACGCCCTCCAGCTGGGCGGCAAGAAGCTGCGCGCGGGCGCCCGCTACGGCGTAACGAGGGCCA
TTTCAGCGCCCAAGCTCAACGACGGGTCGACACACCACGGCACCAGCGTCGGCTTCGTAACAACAGCCAAGACGA
GCCTCGACGAGGGCGCCGTGTTTGCGCAGGACGTGGCGGTGCACTACACGCTCGACTTGGCGGTGCGGCCGGAAA
AGAGCTACTCGGACGTCTTTGGCGAGCTGCGGCACAAGCTCCTGGCAGCCGTGGCAGCCATTGCCAAAGAGAACA
AGGCAGGTGACGCGCCAGATGCCTATTCCGAAGCAGCCCAGCTCAAAAAAGTCGTGGGGGGCGAAATGGTGCTGG
CCCTCACCATCCACAGCGCCGACGGCATCGCCACCGCCCTCCGCATCAAGCACGAAATCGACACCGCCATGCACA
CCACGCACCAAAGCAACACCACCATGCGCATGGCCATTATCGGCGGCTCAGAAGCCCACCTCGTCGCCTCCCACC
TCGCCGCAGCAAACACTGGCGTCATCCTCACGCCTCCCCGCCCCTACACCTCGCGCTGGGACATGCGCCGCGCCC
TCCCCGGCGCGCCCCTCACCAACGGCACCGTGGCGGACTGGCTGGCCGACGCGGGCGTCCCCATTGCTCTAGGCC
TGGCCGAGGACTACATGGTGCGCCACCTGGGGCTCGATGCCGGCACGGCGTGGCGCAACGGGGGGGGACGCTGGG
ACGAGAAGCGCGCGCTGGACCTGGTGAGTGTAAATGTAGAGGCCATTCTGGGCGTGCAGGCGTCGCGCGCAGGCC
ATTTTGTGGTGAGTGAGCAGAGTCCGTTGGAGACGTGGTCGCGAGTCGTGGCTGTGGGGGCGGGGGGAGGGAGCG
TGGCGCTCTATGGAAGCGGGTAA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail