Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|5801
Gene name
LocationContig_48:113608..114603
Strand-
Gene length (bp)995
Transcript length (bp)858
Coding sequence length (bp)858
Protein length (aa) 286

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02900 LigB Catalytic LigB subunit of aromatic ring-opening dioxygenase 1.9E-34 8 264

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q7XA48|DODA_PORGR 4,5-DOPA dioxygenase extradiol OS=Portulaca grandiflora GN=DODA PE=1 SV=1 44 257 1.0E-32
sp|Q70FG7|DODA_BETVU 4,5-DOPA dioxygenase extradiol OS=Beta vulgaris GN=DODA PE=1 SV=1 9 276 2.0E-32
sp|Q949R4|DIOXL_ARATH Extradiol ring-cleavage dioxygenase OS=Arabidopsis thaliana GN=LIGB PE=2 SV=1 9 255 5.0E-31
sp|I3PFJ3|DOD1U_BETVU 4,5-DOPA dioxygenase extradiol 1 OS=Beta vulgaris GN=DODA1 PE=2 SV=1 46 263 3.0E-28
sp|I3PFJ9|DOD1W_BETVU 4,5-DOPA dioxygenase extradiol 1 OS=Beta vulgaris GN=DODA1 PE=2 SV=1 46 263 3.0E-28
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q7XA48|DODA_PORGR 4,5-DOPA dioxygenase extradiol OS=Portulaca grandiflora GN=DODA PE=1 SV=1 44 257 1.0E-32
sp|Q70FG7|DODA_BETVU 4,5-DOPA dioxygenase extradiol OS=Beta vulgaris GN=DODA PE=1 SV=1 9 276 2.0E-32
sp|Q949R4|DIOXL_ARATH Extradiol ring-cleavage dioxygenase OS=Arabidopsis thaliana GN=LIGB PE=2 SV=1 9 255 5.0E-31
sp|I3PFJ3|DOD1U_BETVU 4,5-DOPA dioxygenase extradiol 1 OS=Beta vulgaris GN=DODA1 PE=2 SV=1 46 263 3.0E-28
sp|I3PFJ9|DOD1W_BETVU 4,5-DOPA dioxygenase extradiol 1 OS=Beta vulgaris GN=DODA1 PE=2 SV=1 46 263 3.0E-28
sp|B6F0W8|DODA_MIRJA 4,5-DOPA dioxygenase extradiol OS=Mirabilis jalapa GN=DOD PE=1 SV=1 46 255 2.0E-24
sp|P24197|YGID_ECOLI 4,5-DOPA dioxygenase extradiol OS=Escherichia coli (strain K12) GN=ygiD PE=1 SV=3 5 259 1.0E-23
sp|O74741|DIOXL_SCHPO 4,5-DOPA dioxygenase extradiol-like protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1709.16c PE=3 SV=2 45 259 4.0E-23
[Show less]

GO

GO Term Description Terminal node
GO:0008198 ferrous iron binding Yes
GO:0006725 cellular aromatic compound metabolic process Yes
GO:0016491 oxidoreductase activity Yes
GO:0008150 biological_process No
GO:0044237 cellular metabolic process No
GO:0009987 cellular process No
GO:0005488 binding No
GO:0043169 cation binding No
GO:0046914 transition metal ion binding No
GO:0005506 iron ion binding No
GO:0003674 molecular_function No
GO:0043167 ion binding No
GO:0008152 metabolic process No
GO:0046872 metal ion binding No
GO:0003824 catalytic activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 21 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|5801
MPTAPVVALSHGGGPLPILGDPSHKSIIYSLKHRIPRILNLGTPLQPQAIILVTAHWQTATPHVSSSAQHELLYD
YSNFPPESYSLKYPAPGSPAIAQKVVDAFTAAGVKDPRLDPDRPWDHGVFVPLTLIHPQAQIPIVQVSVLQGEDV
AEHMRMGEALRSLREQNIAVIGSGFASLHNLQTMRDLRQVSHEERAKFKAQSDEWNDALTNAVKAEKKDRRHHLE
KWRKMPHADKMHPPNGGEHFMPLLVCAGAADDGEEMRSYKDEYLGMDILTYYWGGAHHGD*
Coding >OphauB2|5801
ATGCCTACTGCACCAGTTGTTGCGCTTTCGCATGGTGGAGGCCCCCTCCCCATCCTCGGCGACCCAAGCCACAAA
TCAATCATCTACTCTCTCAAGCACCGCATCCCTCGCATCCTCAACCTCGGCACCCCCCTCCAGCCCCAAGCCATC
ATCCTCGTCACCGCCCACTGGCAAACCGCAACCCCCCACGTCTCTTCATCTGCCCAGCACGAGCTCCTCTACGAC
TACTCCAACTTCCCCCCCGAGTCCTACTCCCTCAAGTATCCCGCTCCCGGCTCCCCCGCCATTGCCCAAAAAGTC
GTCGACGCCTTTACCGCCGCCGGCGTAAAGGATCCCCGTCTTGACCCCGACCGCCCCTGGGACCACGGCGTCTTT
GTCCCGCTTACCCTTATCCACCCACAGGCCCAGATCCCAATCGTCCAGGTCTCGGTCCTTCAGGGCGAAGACGTG
GCTGAGCACATGCGCATGGGCGAGGCCCTGCGTTCCCTTCGCGAGCAAAATATTGCAGTCATTGGCTCGGGCTTT
GCCTCGCTGCATAACCTGCAAACTATGCGCGACTTGCGCCAAGTCAGCCATGAGGAGCGCGCAAAGTTCAAGGCT
CAGTCGGATGAGTGGAACGATGCCCTCACTAATGCCGTCAAGGCGGAGAAGAAGGACCGCAGACACCACTTGGAA
AAGTGGAGAAAGATGCCCCATGCTGATAAAATGCATCCCCCAAATGGCGGCGAACACTTTATGCCCCTCTTGGTC
TGTGCTGGAGCTGCTGACGACGGCGAGGAGATGAGGTCCTACAAGGATGAGTATCTCGGCATGGACATTCTGACT
TATTACTGGGGAGGCGCCCACCACGGAGACTAG
Transcript >OphauB2|5801
ATGCCTACTGCACCAGTTGTTGCGCTTTCGCATGGTGGAGGCCCCCTCCCCATCCTCGGCGACCCAAGCCACAAA
TCAATCATCTACTCTCTCAAGCACCGCATCCCTCGCATCCTCAACCTCGGCACCCCCCTCCAGCCCCAAGCCATC
ATCCTCGTCACCGCCCACTGGCAAACCGCAACCCCCCACGTCTCTTCATCTGCCCAGCACGAGCTCCTCTACGAC
TACTCCAACTTCCCCCCCGAGTCCTACTCCCTCAAGTATCCCGCTCCCGGCTCCCCCGCCATTGCCCAAAAAGTC
GTCGACGCCTTTACCGCCGCCGGCGTAAAGGATCCCCGTCTTGACCCCGACCGCCCCTGGGACCACGGCGTCTTT
GTCCCGCTTACCCTTATCCACCCACAGGCCCAGATCCCAATCGTCCAGGTCTCGGTCCTTCAGGGCGAAGACGTG
GCTGAGCACATGCGCATGGGCGAGGCCCTGCGTTCCCTTCGCGAGCAAAATATTGCAGTCATTGGCTCGGGCTTT
GCCTCGCTGCATAACCTGCAAACTATGCGCGACTTGCGCCAAGTCAGCCATGAGGAGCGCGCAAAGTTCAAGGCT
CAGTCGGATGAGTGGAACGATGCCCTCACTAATGCCGTCAAGGCGGAGAAGAAGGACCGCAGACACCACTTGGAA
AAGTGGAGAAAGATGCCCCATGCTGATAAAATGCATCCCCCAAATGGCGGCGAACACTTTATGCCCCTCTTGGTC
TGTGCTGGAGCTGCTGACGACGGCGAGGAGATGAGGTCCTACAAGGATGAGTATCTCGGCATGGACATTCTGACT
TATTACTGGGGAGGCGCCCACCACGGAGACTAG
Gene >OphauB2|5801
ATGCCTACTGCACCAGTTGTTGCGCTTTCGCATGGTGGAGGTGAGTCTATTACTGCTTCAACCTCGTCTGCCCGA
GCATGTGCCCACCCCAACCGTGATATTCTTTCATCAACGATAAACCAACACTCTTCATCACACCCCAAAACAAAA
CCTCACTAACCCATTCCCCCCATCTAGGCCCCCTCCCCATCCTCGGCGACCCAAGCCACAAATCAATCATCTACT
CTCTCAAGCACCGCATCCCTCGCATCCTCAACCTCGGCACCCCCCTCCAGCCCCAAGCCATCATCCTCGTCACCG
CCCACTGGCAAACCGCAACCCCCCACGTCTCTTCATCTGCCCAGCACGAGCTCCTCTACGACTACTCCAACTTCC
CCCCCGAGTCCTACTCCCTCAAGTATCCCGCTCCCGGCTCCCCCGCCATTGCCCAAAAAGTCGTCGACGCCTTTA
CCGCCGCCGGCGTAAAGGATCCCCGTCTTGACCCCGACCGCCCCTGGGACCACGGCGTCTTTGTCCCGCTTACCC
TTATCCACCCACAGGCCCAGATCCCAATCGTCCAGGTCTCGGTCCTTCAGGGCGAAGACGTGGCTGAGCACATGC
GCATGGGCGAGGCCCTGCGTTCCCTTCGCGAGCAAAATATTGCAGTCATTGGCTCGGGCTTTGCCTCGCTGCATA
ACCTGCAAACTATGCGCGACTTGCGCCAAGTCAGCCATGAGGAGCGCGCAAAGTTCAAGGCTCAGTCGGATGAGT
GGAACGATGCCCTCACTAATGCCGTCAAGGCGGAGAAGAAGGACCGCAGACACCACTTGGAAAAGTGGAGAAAGA
TGCCCCATGCTGATAAAATGCATCCCCCAAATGGCGGCGAACACTTTATGCCCCTCTTGGTCTGTGCTGGAGCTG
CTGACGACGGCGAGGAGATGAGGTCCTACAAGGATGAGTATCTCGGCATGGACATTCTGACTTATTACTGGGGAG
GCGCCCACCACGGAGACTAG

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail