Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|5797
Gene name
LocationContig_48:104559..105102
Strand+
Gene length (bp)543
Transcript length (bp)543
Coding sequence length (bp)543
Protein length (aa) 181

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup1966
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|3020
Ophiocordyceps australis map64 (Brazil) OphauB2|5797 (this protein)
Ophiocordyceps camponoti-floridani Ophcf2|03861
Ophiocordyceps camponoti-rufipedis Ophun1|4041
Ophiocordyceps kimflemingae Ophio5|1646
Ophiocordyceps subramaniannii Hirsu2|2143

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|5797
MLIVIFEIVAHVGFNKSSSTQAHQAPSLKPRLQLSHPLSQCGSSPAEAQKLGCRFDELSFAWQAPDCFDNKTVDE
FLATGPWKYFADEAGAVPMLHEDLSLDKVLVHVAWKFHIDHCLHLRRQMVRLVLDGRPMDSHLALYKHTVHCGVT
LLDADTPLDNLHTAAPVIYPACKPLPDWAA*
Coding >OphauB2|5797
ATGCTCATCGTCATCTTTGAAATTGTTGCACACGTTGGCTTCAACAAGTCCTCTTCTACACAGGCTCATCAAGCT
CCCAGCCTCAAGCCAAGGCTCCAACTCTCACACCCGCTCAGCCAGTGCGGATCCTCGCCCGCCGAGGCTCAGAAA
CTGGGGTGCCGCTTCGACGAGCTCAGTTTTGCGTGGCAGGCCCCCGACTGCTTCGATAACAAGACAGTCGACGAG
TTTCTCGCAACAGGCCCATGGAAGTACTTTGCCGACGAGGCCGGCGCTGTGCCCATGCTCCACGAGGACCTCAGT
CTGGACAAGGTGCTGGTGCACGTGGCGTGGAAGTTCCACATCGACCACTGTCTGCACTTGCGGCGGCAAATGGTG
CGCCTTGTTCTCGACGGAAGACCCATGGACAGCCATCTCGCCCTCTACAAGCACACAGTGCATTGCGGCGTCACA
CTGCTTGATGCAGACACGCCTCTCGACAATCTGCATACAGCGGCTCCAGTCATTTACCCCGCGTGTAAGCCACTG
CCTGACTGGGCTGCGTGA
Transcript >OphauB2|5797
ATGCTCATCGTCATCTTTGAAATTGTTGCACACGTTGGCTTCAACAAGTCCTCTTCTACACAGGCTCATCAAGCT
CCCAGCCTCAAGCCAAGGCTCCAACTCTCACACCCGCTCAGCCAGTGCGGATCCTCGCCCGCCGAGGCTCAGAAA
CTGGGGTGCCGCTTCGACGAGCTCAGTTTTGCGTGGCAGGCCCCCGACTGCTTCGATAACAAGACAGTCGACGAG
TTTCTCGCAACAGGCCCATGGAAGTACTTTGCCGACGAGGCCGGCGCTGTGCCCATGCTCCACGAGGACCTCAGT
CTGGACAAGGTGCTGGTGCACGTGGCGTGGAAGTTCCACATCGACCACTGTCTGCACTTGCGGCGGCAAATGGTG
CGCCTTGTTCTCGACGGAAGACCCATGGACAGCCATCTCGCCCTCTACAAGCACACAGTGCATTGCGGCGTCACA
CTGCTTGATGCAGACACGCCTCTCGACAATCTGCATACAGCGGCTCCAGTCATTTACCCCGCGTGTAAGCCACTG
CCTGACTGGGCTGCGTGA
Gene >OphauB2|5797
ATGCTCATCGTCATCTTTGAAATTGTTGCACACGTTGGCTTCAACAAGTCCTCTTCTACACAGGCTCATCAAGCT
CCCAGCCTCAAGCCAAGGCTCCAACTCTCACACCCGCTCAGCCAGTGCGGATCCTCGCCCGCCGAGGCTCAGAAA
CTGGGGTGCCGCTTCGACGAGCTCAGTTTTGCGTGGCAGGCCCCCGACTGCTTCGATAACAAGACAGTCGACGAG
TTTCTCGCAACAGGCCCATGGAAGTACTTTGCCGACGAGGCCGGCGCTGTGCCCATGCTCCACGAGGACCTCAGT
CTGGACAAGGTGCTGGTGCACGTGGCGTGGAAGTTCCACATCGACCACTGTCTGCACTTGCGGCGGCAAATGGTG
CGCCTTGTTCTCGACGGAAGACCCATGGACAGCCATCTCGCCCTCTACAAGCACACAGTGCATTGCGGCGTCACA
CTGCTTGATGCAGACACGCCTCTCGACAATCTGCATACAGCGGCTCCAGTCATTTACCCCGCGTGTAAGCCACTG
CCTGACTGGGCTGCGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail