Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|5788
Gene name
LocationContig_48:88914..90130
Strand-
Gene length (bp)1216
Transcript length (bp)1086
Coding sequence length (bp)1086
Protein length (aa) 362

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00141 peroxidase Peroxidase 5.4E-27 100 311

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q70LM3|PEM2_PHLRA Manganese peroxidase 2 OS=Phlebia radiata GN=mnp2 PE=1 SV=1 88 348 9.0E-37
sp|P19136|PEM4_PHACH Manganese peroxidase H4 OS=Phanerochaete chrysosporium PE=1 SV=1 89 348 4.0E-36
sp|Q02567|PEM1_PHACH Manganese peroxidase 1 OS=Phanerochaete chrysosporium GN=MNP1 PE=1 SV=1 89 348 4.0E-36
sp|Q96TS6|PEM3_PHLRA Manganese peroxidase 3 OS=Phlebia radiata GN=mnp3 PE=2 SV=1 89 347 9.0E-35
sp|O94753|VPL2_PLEER Versatile peroxidase VPL2 OS=Pleurotus eryngii GN=vpl2 PE=1 SV=1 89 348 3.0E-33
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q70LM3|PEM2_PHLRA Manganese peroxidase 2 OS=Phlebia radiata GN=mnp2 PE=1 SV=1 88 348 9.0E-37
sp|P19136|PEM4_PHACH Manganese peroxidase H4 OS=Phanerochaete chrysosporium PE=1 SV=1 89 348 4.0E-36
sp|Q02567|PEM1_PHACH Manganese peroxidase 1 OS=Phanerochaete chrysosporium GN=MNP1 PE=1 SV=1 89 348 4.0E-36
sp|Q96TS6|PEM3_PHLRA Manganese peroxidase 3 OS=Phlebia radiata GN=mnp3 PE=2 SV=1 89 347 9.0E-35
sp|O94753|VPL2_PLEER Versatile peroxidase VPL2 OS=Pleurotus eryngii GN=vpl2 PE=1 SV=1 89 348 3.0E-33
sp|Q9UR19|VPL1_PLEER Versatile peroxidase VPL1 OS=Pleurotus eryngii GN=vpl1 PE=1 SV=1 89 348 4.0E-33
sp|P78733|PEM3_PHACH Manganese peroxidase H3 OS=Phanerochaete chrysosporium PE=1 SV=2 89 348 4.0E-33
sp|P11543|LIG5_PHACH Ligninase LG5 OS=Phanerochaete chrysosporium GN=GLG5 PE=2 SV=1 86 348 7.0E-29
sp|P20013|LIGC_TRAVE Ligninase C OS=Trametes versicolor PE=1 SV=2 89 348 7.0E-28
sp|Q9UVP6|VPS1_PLEER Versatile peroxidase VPS1 OS=Pleurotus eryngii GN=vps1 PE=1 SV=1 85 348 8.0E-27
sp|P28313|PER_ARTRA Peroxidase OS=Arthromyces ramosus PE=1 SV=3 89 361 9.0E-27
sp|P28314|PER_COPCI Peroxidase OS=Coprinopsis cinerea GN=CIP1 PE=1 SV=2 89 361 9.0E-27
sp|A8NK72|PER_COPC7 Peroxidase OS=Coprinopsis cinerea (strain Okayama-7 / 130 / ATCC MYA-4618 / FGSC 9003) GN=CIP1 PE=3 SV=1 89 361 2.0E-26
sp|P20010|LIG_PHLRA Ligninase-3 OS=Phlebia radiata PE=3 SV=1 89 361 1.0E-25
sp|P49012|LIG2_PHACH Ligninase LG2 OS=Phanerochaete chrysosporium GN=GLG2 PE=1 SV=1 88 348 9.0E-25
sp|P06181|LIG8_PHACH Ligninase H8 OS=Phanerochaete chrysosporium GN=LPOA PE=1 SV=1 88 349 3.0E-23
sp|P31838|LIGB_PHACH Ligninase B OS=Phanerochaete chrysosporium GN=LIPB PE=3 SV=1 88 349 9.0E-22
sp|P11542|LIG4_PHACH Ligninase H2 OS=Phanerochaete chrysosporium GN=GLG4 PE=1 SV=2 89 348 2.0E-21
sp|P31837|LIGA_PHACH Ligninase A OS=Phanerochaete chrysosporium GN=LIPA PE=3 SV=1 88 348 4.0E-21
sp|P21764|LIG3_PHACH Ligninase LG3 OS=Phanerochaete chrysosporium GN=GLG3 PE=2 SV=1 108 349 4.0E-20
sp|P50622|LIG6_PHACH Ligninase LG6 OS=Phanerochaete chrysosporium GN=GLG6 PE=2 SV=1 109 348 1.0E-19
sp|C0IW58|LNP_TAICA Low-redox potential peroxidase OS=Taiwanofungus camphoratus GN=LnP PE=1 SV=1 141 348 2.0E-18
sp|Q42564|APX3_ARATH L-ascorbate peroxidase 3, peroxisomal OS=Arabidopsis thaliana GN=APX3 PE=1 SV=1 111 335 9.0E-14
sp|P48534|APX1_PEA L-ascorbate peroxidase, cytosolic OS=Pisum sativum GN=APX1 PE=1 SV=2 118 336 1.0E-13
sp|Q01MI9|APX3_ORYSI Probable L-ascorbate peroxidase 3 OS=Oryza sativa subsp. indica GN=APX3 PE=2 SV=1 118 335 9.0E-13
sp|Q0JEQ2|APX3_ORYSJ Probable L-ascorbate peroxidase 3 OS=Oryza sativa subsp. japonica GN=APX3 PE=3 SV=1 118 335 9.0E-13
sp|Q7XZP5|APX5_ARATH L-ascorbate peroxidase 5, peroxisomal OS=Arabidopsis thaliana GN=APX5 PE=1 SV=2 111 335 2.0E-12
sp|Q1PER6|APX2_ARATH L-ascorbate peroxidase 2, cytosolic OS=Arabidopsis thaliana GN=APX2 PE=2 SV=3 118 336 2.0E-12
sp|Q6ZJJ1|APX4_ORYSJ Probable L-ascorbate peroxidase 4 OS=Oryza sativa subsp. japonica GN=APX4 PE=2 SV=1 118 335 7.0E-12
sp|Q8GY91|APX6_ARATH Putative L-ascorbate peroxidase 6 OS=Arabidopsis thaliana GN=APX6 PE=2 SV=1 118 283 1.0E-11
sp|Q9FE01|APX2_ORYSJ L-ascorbate peroxidase 2, cytosolic OS=Oryza sativa subsp. japonica GN=APX2 PE=1 SV=1 111 336 1.0E-11
sp|Q05431|APX1_ARATH L-ascorbate peroxidase 1, cytosolic OS=Arabidopsis thaliana GN=APX1 PE=1 SV=2 111 336 2.0E-11
sp|Q10N21|APX1_ORYSJ L-ascorbate peroxidase 1, cytosolic OS=Oryza sativa subsp. japonica GN=APX1 PE=1 SV=1 118 336 1.0E-10
sp|A2XFC7|APX1_ORYSI L-ascorbate peroxidase 1, cytosolic OS=Oryza sativa subsp. indica GN=APX1 PE=2 SV=1 118 336 2.0E-10
sp|P22196|PER2_ARAHY Cationic peroxidase 2 OS=Arachis hypogaea GN=PNC2 PE=2 SV=1 113 350 5.0E-09
sp|Q69SV0|APX8_ORYSJ Probable L-ascorbate peroxidase 8, chloroplastic OS=Oryza sativa subsp. japonica GN=APX8 PE=2 SV=2 118 335 3.0E-08
sp|P0C0L1|APX6_ORYSJ Probable L-ascorbate peroxidase 6, chloroplastic OS=Oryza sativa subsp. japonica GN=APX6 PE=2 SV=1 118 335 8.0E-08
sp|Q42593|APXT_ARATH L-ascorbate peroxidase T, chloroplastic OS=Arabidopsis thaliana GN=APXT PE=2 SV=2 81 333 9.0E-08
sp|Q9SD46|PER36_ARATH Peroxidase 36 OS=Arabidopsis thaliana GN=PER36 PE=2 SV=2 35 249 1.0E-07
sp|Q96518|PER16_ARATH Peroxidase 16 OS=Arabidopsis thaliana GN=PER16 PE=1 SV=2 94 338 1.0E-07
sp|A5H454|PER66_MAIZE Peroxidase 66 OS=Zea mays GN=PER66 PE=1 SV=1 176 332 2.0E-07
sp|A5H453|PER42_MAIZE Peroxidase 42 OS=Zea mays GN=PER42 PE=2 SV=1 116 296 4.0E-07
sp|Q96512|PER9_ARATH Peroxidase 9 OS=Arabidopsis thaliana GN=PER9 PE=1 SV=1 113 249 4.0E-07
sp|Q42592|APXS_ARATH L-ascorbate peroxidase S, chloroplastic/mitochondrial OS=Arabidopsis thaliana GN=APXS PE=1 SV=2 118 335 9.0E-07
sp|O80822|PER25_ARATH Peroxidase 25 OS=Arabidopsis thaliana GN=PER25 PE=2 SV=2 118 256 9.0E-07
sp|Q9M9Q9|PER5_ARATH Peroxidase 5 OS=Arabidopsis thaliana GN=PER5 PE=3 SV=2 93 283 2.0E-06
sp|Q96511|PER69_ARATH Peroxidase 69 OS=Arabidopsis thaliana GN=PER69 PE=1 SV=1 118 339 2.0E-06
sp|P0C0L0|APX5_ORYSJ Probable L-ascorbate peroxidase 5, chloroplastic OS=Oryza sativa subsp. japonica GN=APX5 PE=2 SV=1 118 335 5.0E-06
sp|Q9FLC0|PER52_ARATH Peroxidase 52 OS=Arabidopsis thaliana GN=PER52 PE=2 SV=1 94 252 5.0E-06
sp|A7NY33|PER4_VITVI Peroxidase 4 OS=Vitis vinifera GN=GSVIVT00023967001 PE=1 SV=1 113 252 6.0E-06
sp|O23474|PER40_ARATH Peroxidase 40 OS=Arabidopsis thaliana GN=PER40 PE=2 SV=2 101 249 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0004601 peroxidase activity Yes
GO:0006979 response to oxidative stress Yes
GO:0020037 heme binding Yes
GO:0003824 catalytic activity No
GO:0046906 tetrapyrrole binding No
GO:0003674 molecular_function No
GO:0050896 response to stimulus No
GO:0005488 binding No
GO:0008150 biological_process No
GO:0016209 antioxidant activity No
GO:0006950 response to stress No
GO:1901363 heterocyclic compound binding No
GO:0016491 oxidoreductase activity No
GO:0016684 oxidoreductase activity, acting on peroxide as acceptor No
GO:0097159 organic cyclic compound binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 19 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|5788
MPPLTLLSLALLLPSALSYPNMETLRSHASLSRRSTALIGDLTTLPLSQLSPTGHAIRAILNGTASGLDTTSTYS
PPPRDSPACAADTCCIYAHLASAMRTAMLDPSGQCNNLARSSLRLGFHDAAGWSSKTGPAGGADGSIVLAGECEA
RAVNNGLQDACAQMRVWHDAYKASGVSMADVIQLAANVGTVVCPLGPRVRSFVGRKDSSVPAPEGNVPEATDSID
KLLSMFQDKTISPAGLVALVGAHTASQQFFFDPARAGAPQDTTPHIWDTDFYGNTLQEVAPNGIVRFDSDVALSR
DPRTSSSWQGFQGAQGFWAFAYGQEYVRLSLLGVSNINDLTECTKVLPEFISTVPAGLDTN*
Coding >OphauB2|5788
ATGCCCCCCCTGACCCTCCTCTCCCTCGCCCTCCTCCTCCCCTCGGCCCTCTCATACCCCAACATGGAAACGCTC
CGCTCCCACGCCTCCCTCTCCCGCCGTTCCACCGCCCTCATCGGCGACCTCACCACCCTCCCCCTCTCCCAGCTC
TCTCCCACCGGCCACGCCATCCGCGCCATCCTCAACGGCACCGCCTCAGGCCTCGACACCACCTCGACCTACTCC
CCCCCTCCCCGCGACTCTCCCGCCTGCGCCGCCGACACGTGCTGCATCTACGCCCACCTCGCCTCCGCCATGCGC
ACCGCCATGCTCGACCCCTCTGGCCAGTGCAACAACCTCGCCCGCTCCAGCCTCCGCCTCGGCTTCCACGACGCA
GCGGGCTGGTCCAGCAAAACCGGCCCGGCAGGCGGCGCCGACGGCTCCATCGTCTTGGCTGGCGAGTGTGAGGCG
CGTGCCGTAAACAACGGCTTGCAAGACGCGTGTGCGCAGATGCGGGTCTGGCACGACGCCTACAAGGCCAGCGGC
GTCTCCATGGCTGATGTCATTCAACTAGCCGCCAATGTCGGCACCGTCGTCTGTCCCCTGGGGCCGCGCGTGCGC
TCCTTTGTCGGCCGCAAAGACTCCAGTGTCCCGGCGCCAGAGGGAAACGTCCCCGAGGCAACGGATAGCATCGAC
AAGCTTCTCTCCATGTTCCAGGACAAGACCATTTCTCCGGCGGGCCTGGTGGCCCTGGTGGGTGCTCACACGGCT
AGCCAGCAATTCTTCTTTGACCCGGCTCGCGCTGGGGCGCCGCAGGACACCACGCCGCACATCTGGGACACTGAC
TTTTACGGCAACACGTTGCAGGAAGTTGCGCCCAATGGCATTGTTCGCTTTGATAGCGATGTCGCTCTAAGCCGG
GATCCGCGAACCAGTTCTAGCTGGCAGGGCTTTCAGGGGGCTCAGGGGTTTTGGGCTTTTGCATACGGCCAAGAA
TACGTCCGCCTCAGCCTCCTCGGCGTCTCCAACATCAACGACCTGACTGAATGCACAAAGGTCCTCCCAGAATTC
ATCAGCACCGTCCCTGCCGGCCTCGACACCAATTAA
Transcript >OphauB2|5788
ATGCCCCCCCTGACCCTCCTCTCCCTCGCCCTCCTCCTCCCCTCGGCCCTCTCATACCCCAACATGGAAACGCTC
CGCTCCCACGCCTCCCTCTCCCGCCGTTCCACCGCCCTCATCGGCGACCTCACCACCCTCCCCCTCTCCCAGCTC
TCTCCCACCGGCCACGCCATCCGCGCCATCCTCAACGGCACCGCCTCAGGCCTCGACACCACCTCGACCTACTCC
CCCCCTCCCCGCGACTCTCCCGCCTGCGCCGCCGACACGTGCTGCATCTACGCCCACCTCGCCTCCGCCATGCGC
ACCGCCATGCTCGACCCCTCTGGCCAGTGCAACAACCTCGCCCGCTCCAGCCTCCGCCTCGGCTTCCACGACGCA
GCGGGCTGGTCCAGCAAAACCGGCCCGGCAGGCGGCGCCGACGGCTCCATCGTCTTGGCTGGCGAGTGTGAGGCG
CGTGCCGTAAACAACGGCTTGCAAGACGCGTGTGCGCAGATGCGGGTCTGGCACGACGCCTACAAGGCCAGCGGC
GTCTCCATGGCTGATGTCATTCAACTAGCCGCCAATGTCGGCACCGTCGTCTGTCCCCTGGGGCCGCGCGTGCGC
TCCTTTGTCGGCCGCAAAGACTCCAGTGTCCCGGCGCCAGAGGGAAACGTCCCCGAGGCAACGGATAGCATCGAC
AAGCTTCTCTCCATGTTCCAGGACAAGACCATTTCTCCGGCGGGCCTGGTGGCCCTGGTGGGTGCTCACACGGCT
AGCCAGCAATTCTTCTTTGACCCGGCTCGCGCTGGGGCGCCGCAGGACACCACGCCGCACATCTGGGACACTGAC
TTTTACGGCAACACGTTGCAGGAAGTTGCGCCCAATGGCATTGTTCGCTTTGATAGCGATGTCGCTCTAAGCCGG
GATCCGCGAACCAGTTCTAGCTGGCAGGGCTTTCAGGGGGCTCAGGGGTTTTGGGCTTTTGCATACGGCCAAGAA
TACGTCCGCCTCAGCCTCCTCGGCGTCTCCAACATCAACGACCTGACTGAATGCACAAAGGTCCTCCCAGAATTC
ATCAGCACCGTCCCTGCCGGCCTCGACACCAATTAA
Gene >OphauB2|5788
ATGCCCCCCCTGACCCTCCTCTCCCTCGCCCTCCTCCTCCCCTCGGCCCTCTCATACCCCAACATGGAAACGCTC
CGCTCCCACGCCTCCCTCTCCCGCCGTTCCACCGCCCTCATCGGCGACCTCACCACCCTCCCCCTCTCCCAGCTC
TCTCCCACCGGCCACGCCATCCGCGCCATCCTCAACGGCACCGCCTCAGGCCTCGACACCACCTCGACCTACTCC
CCCCCTCCCCGCGACTCTCCCGCCTGCGCCGCCGACACGTGCTGCATCTACGCCCACCTCGCCTCCGCCATGCGC
ACCGCCATGCTCGACCCCTCTGGCCAGTGCAACAACCTCGCCCGCTCCAGCCTCCGCCTCGGCTTCCACGACGCA
GCGGGCTGGTCCAGCAAAACCGGCCCGGCAGGCGGCGCCGACGGCTCCATCGTCTTGGCTGGCGAGTGTGAGGCG
CGTGCCGTAAACAACGGCTTGCAAGACGCGTGTGCGCAGATGCGGGTCTGGCACGACGCCTACAAGGCCAGCGGC
GTCTCCATGGCTGATGTCATTCAACTAGCCGCCAATGTCGGCACCGTCGTCTGTCCCCTGGGGCCGCGCGTGCGC
TCCTTTGTCGGCCGCAAAGACTCCAGTGTCCCGGCGCCAGAGGGAAACGTCCCCGAGGCAACGGATAGCATCGAC
AAGCTTCTCTCCATGTTCCAGGACAAGACCATTTCTCCGGCGGGCCTGGTGGCCCTGGTGGGTGCTCACACGGCT
AGCCAGCAATTCTTCTTTGACCCGGCTCGCGCTGGGGCGCCGCAGGACACCACGCCGCACATCTGGGACACTGAC
TTTTACGGCAACACGTTGCAGGAAGTTGCGCCCAATGGCATTGTTCGCTTTGATAGCGATGTCGCTCTAAGCCGG
GATCCGCGAACCAGTTCTAGCTGGCAGGGCTTTCAGGGGGCTCAGGGGTTTTGGGCTTTTGTAAGTCGTTTTTTC
CCTCTCATCTCTTTCGTCCTATTCCTTCCATTTTCTCTCGATTCTTTTCATTTCTCTCGATTCTTTCCATCATAT
AACAGCTCCTCGCACAAATCAACCAGCTTACACCAACCAGGCATACGGCCAAGAATACGTCCGCCTCAGCCTCCT
CGGCGTCTCCAACATCAACGACCTGACTGAATGCACAAAGGTCCTCCCAGAATTCATCAGCACCGTCCCTGCCGG
CCTCGACACCAATTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail